[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF53422.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2hh7A.bssp"

## Summary of PDB Search
:100
    7e-11  38%  2hh7A  [x.x.x] HYPOTHETICAL PROTEIN CSOR
:100

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxEKQRYLARLKRIEGQTRGIHRMIDEEQYCIDILTQISAVNSALKNVAFGLLDDHLAH
2hh7A           -------------KKRAALNRLKTVRGHLDGIVRMLESDAYCVDVMKQISAVQSSLERANRVMLHNHLET


                         .         .         *         .         .         .         .:140
query           CVKEAADLGGDELDAKLKEVSDAIxxxxxx
2hh7A           CFSTAVLDGHGQ--AAIEELIDAV------