[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF53444.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2j4rA.bssp"
#ERROR : Can't open dsspfile "1t6cA.bssp"
#ERROR : Can't open dsspfile "1u6zB.bssp"
#ERROR : Can't open dsspfile "1u6zA.bssp"
#ERROR : Can't open dsspfile "1t6dB.bssp"
#ERROR : Can't open dsspfile "1t6dA.bssp"
#ERROR : Can't open dsspfile "3hi0B.bssp"
#ERROR : Can't open dsspfile "3hi0A.bssp"
#ERROR : Can't open dsspfile "2floB.bssp"
#ERROR : Can't open dsspfile "2floA.bssp"
#ERROR : Can't open dsspfile "3cerD.bssp"
#ERROR : Can't open dsspfile "3cerC.bssp"
#ERROR : Can't open dsspfile "3cerA.bssp"

## Summary of PDB Search
:302
    7e-16  22%  2j4rA  [x.x.x] EXOPOLYPHOSPHATASE
    2e-15  22%  1t6cA  [c.55.1 - c.55.1] EXOPOLYPHOSPHATASE
    2e-14  25%  1u6zB  [x.x.x] EXOPOLYPHOSPHATASE
    2e-14  25%  1u6zA  [x.x.x] EXOPOLYPHOSPHATASE
    3e-13  22%  1t6dB  [c.55.1 - c.55.1] EXOPOLYPHOSPHATASE
    3e-13  22%  1t6dA  [c.55.1 - c.55.1] EXOPOLYPHOSPHATASE
    2e-08  28%  3hi0B  [x.x.x] PUTATIVE EXOPOLYPHOSPHATASE
    2e-08  28%  3hi0A  [x.x.x] PUTATIVE EXOPOLYPHOSPHATASE
    4e-07  26%  2floB  [x.x.x] EXOPOLYPHOSPHATASE
    4e-07  26%  2floA  [x.x.x] EXOPOLYPHOSPHATASE
    2e-04  26%  3cerD  [x.x.x] POSSIBLE EXOPOLYPHOSPHATASE-LIKE PROTEIN
    2e-04  26%  3cerC  [x.x.x] POSSIBLE EXOPOLYPHOSPHATASE-LIKE PROTEIN
    2e-04  26%  3cerA  [x.x.x] POSSIBLE EXOPOLYPHOSPHATASE-LIKE PROTEIN
:302

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGSNTVHLVAVDARPGGHPTPMSNWRTPLRLVELLDDSGAISEKGINKLTSAVGEAADLAKTLGCAELMP
2j4rA           IGSNSVRLTIAQIKDGKLSIILERGRIT-SLGTKVKETGRLQEDRIEETIQVLKEYKKLIDEFKVERVKA
1t6cA           IGSYSVRLTIAQIKDGKLSIILERGRIT-SLGTKVKETGRLQEDRIEETIQVLKEYKKLIDEFKVERVKA
1u6zB           LGSNSFHMVIARVVDGAMQI-IGRLKQRVHLADGLGPDNMLSEEAMTRGLNCLSLFAERLQGFSPASVCI
1u6zA           LGSNSFHMVIARVVDGAMQI-IGRLKQRVHLADGLGPDNMLSEEAMTRGLNCLSLFAERLQGFSPASVCI
1t6dB           IGSYSVRLTIAQIKDGKLSIILERGRIT-SLGTKVKETGRLQEDRIEETIQVLKEYKKLIDEFK-VERKA
1t6dA           IGSYSVRLTIAQIKDGKLSIILERGRIT-SLGTKVKETGRLQEDRIEETIQVLKEYKKLIDEFK-VERKA
3hi0B           IGSNSVRLVVYEGLSRA-PAVLFNEKVLCGLGKGLALTGR-HEEGVTRAL-ALRRFHVLSEQAQAQKLYV
3hi0A           IGSNSVRLVVYEGLSRA-PAVLFNEKVLCGLGKGLALTGR-HEEGVTRAL-ALRRFHVLSEQAQAQKLYV
2floB           LGSNSFHVIA---RVVDGAQIIGRLKQRVHLADGLDNLSEEATRGLNCLSLF----AERLQGFSPASVCI
2floA           LGSNSFHVIA---RVVDGAQIIGRLKQRVHLADGLDNLSEEATRGLNCLSLF----AERLQGFSPASVCI
3cerD           -GTNSIRLKIARVDADGHEVVPRILRV-IRLGQDVDKTHRFADEALERAYVAAREFAGVIAEHPIDGLRF
3cerC           -GTNSIRLKIARVDADGHEVVPRILRV-IRLGQDVDKTHRFADEALERAYVAAREFAGVIAEHPIDGLRF
3cerA           -GTNSIRLKIARVDADGHEVVPRILRV-IRLGQDVDKTHRFADEALERAYVAAREFAGVIAEHPIDGLRF


                         .         .         *         .         .         .         .:140
query           FATSAVRSATNSEAVLDHVEEETGVRLSILSGEDEARQTFLAVRRWYGWSAGRITNLDIGGGSLELSSGT
2j4rA           VATEAIRRAKNAEEFLERVKREVGLVVEVITPEQEGRYAYLAV-AYSLKPEGEVCVVDQGGGSTEYVFGK
1t6cA           VATEAIRRAKNAEEFLERVKREVGLVVEVITPEQEGRYAYLAV-AYSLKPEGEVCVVDQGGGSTEYVFGK
1u6zB           VGTHTLRQALNATDFLKRAEKVIPYPIEIISGNEEARLIFMGVEHTQP-EKGRKLVIDIGGGSTELVIGE
1u6zA           VGTHTLRQALNATDFLKRAEKVIPYPIEIISGNEEARLIFMGVEHTQP-EKGRKLVIDIGGGSTELVIGE
1t6dB           VATEAIRRAKNAEEFLERVKREVGLVVEVITPEQEGRYAYLAVA--YSLKPEGEVVVDQGGGSTEYVFGK
1t6dA           VATEAIRRAKNAEEFLERVKREVGLVVEVITPEQEGRYAYLAVA--YSLKPEGEVVVDQGGGSTEYVFGK
3hi0B           LATAAAREAENGPDFIREAEAILGCEIEVLSGEKEALYSAYGVISGFYQPDGIAG--DLGGGSLELIDIK
3hi0A           LATAAAREAENGPDFIREAEAILGCEIEVLSGEKEALYSAYGVISGFYQPDGIAG--DLGGGSLELIDIK
2floB           VGTHTLRQALNATDFLKRAEKVIPYPIEIISGNEEARLIFGVEHTQP--EKGRKLVIDIGGGSTELVIGE
2floA           VGTHTLRQALNATDFLKRAEKVIPYPIEIISGNEEARLIFGVEHTQP--EKGRKLVIDIGGGSTELVIGE
3cerD           VATSATXXXXXXXXXXXXXXXXLGVRPEVIPGTEEADLSFLGATSVVNRDPAPYLVVDLGGGSTELVIGG
3cerC           VATSATXXXXXXXXXXXXXXXXLGVRPEVIPGTEEADLSFLGATSVVNRDPAPYLVVDLGGGSTELVIGG
3cerA           VATSATXXXXXXXXXXXXXXXXLGVRPEVIPGTEEADLSFLGATSVVNRDPAPYLVVDLGGGSTELVIGG


                         +         .         .         .         .         *         .:210
query           DESPDLAFSLDLGAGRLTHNWFDTDPPARKKINLLRDYIDAELAEPARQMRTLGPARLAVGTSKTFRTLA
2j4rA           GYKVREVISLPIGIVNLTETFFKQDPPTEEEVKRFFEFLEKELSKVKKPVDXXXXXXXXXXXXXXXE---
1t6cA           GYKVREVISLPIGIVNLTETFFKQDPPTEEEVKRFFEFLEKELSKVKKPVDXXXXXXXXXXXXXXXE---
1u6zB           NFEPILVESRRMGCVSFAQLYFPGGVINKENFQRARMAAAQKLETLTWQFRIQG-WNVAMGASGTIKAAH
1u6zA           NFEPILVESRRMGCVSFAQLYFPGGVINKENFQRARMAAAQKLETLTWQFRIQG-WNVAMGASGTIKAAH
1t6dB           GYKVREVISLPIGIVNLTETFFKQDPPTEEEVKRFFEFLEKELSKVKKPVDXXXXXXXXXXXXXXXE---
1t6dA           GYKVREVISLPIGIVNLTETFFKQDPPTEEEVKRFFEFLEKELSKVKKPVDXXXXXXXXXXXXXXXE---
3hi0B           DKSCGEGITLPLGGLRLSE---QSDGSLEKAATIARKHV-----KSFAKLLAAGEGRTFYAVGGTWRNIA
3hi0A           DKSCGEGITLPLGGLRLSE---QSDGSLEKAATIARKHV-----KSFAKLLAAGEGRTFYAVGGTWRNIA
2floB           NFEPILVES------------------RRGCVSFAQLYFPGGVINKENFQRARAAAQKLETLTWQFRIQG
2floA           NFEPILVES------------------RRGCVSFAQLYFPGGVINKENFQRARAAAQKLETLTWQFRIQG
3cerD           DSAPTTAFS-NIGSVR-TERHLTNDPPTQTQIDEAVADVDEHIDEAFR----------------------
3cerC           DSAPTTAFS-NIGSVR-TERHLTNDPPTQTQIDEAVADVDEHIDEAFR----------------------
3cerA           DSAPTTAFS-NIGSVR-TERHLTNDPPTQTQIDEAVADVDEHIDEAFR----------------------


                         .         .         .         +         .         .         .:280
query           RLTGAAPSSAGPHVTRTLTAPGLRQLIAFISRMTAADRAELEGISSDRSHQIVAGALVAEAAMRALDIDK
2j4rA           --YNVYPYDPQKVHGKVLTYGQIKKWFDTFKEIPSEERSKFRQVEDRRAKVILAGIGIFLKTLEIFEKDC
1t6cA           --YNVYPYDPQKVHGKVLTYGQIKKWFDTFKEIPSEERSKFRQVEDRRAKVILAGIGIFLKTLEIFEKDC
1u6zB           EVLMEMGEKDG-----IITPERLEKLVKEVLRHRNFASLSLPGLSEERKTVFVPGLAILCGVFDALAIRE
1u6zA           EVLMEMGEKDG-----IITPERLEKLVKEVLRHRNFASLSLPGLSEERKTVFVPGLAILCGVFDALAIRE
1t6dB           --YNVYPYDPQKVHGKVLTYGQIKKWFDTFKEIPSEERSKFRQVEDRRAKVILAGIGIFLKTLEIFEKDL
1t6dA           --YNVYPYDPQKVHGKVLTYGQIKKWFDTFKEIPSEERSKFRQVEDRRAKVILAGIGIFLKTLEIFEKDL
3hi0B           KL--------------------------------------------------------------------
3hi0A           KL--------------------------------------------------------------------
2floB           NVAGASGTIKAAHEVGIITPERLEKLVKEVLRHRNFASLSLPGLSEERKTVFVPGLAILCGVFDALAIRE
2floA           NVAGASGTIKAAHEVGIITPERLEKLVKEVLRHRNFASLSLPGLSEERKTVFVPGLAILCGVFDALAIRE
3cerD           ----------------------------------------------------------------------
3cerC           ----------------------------------------------------------------------
3cerA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VEICPWALREGVILTRIDKxxx
2j4rA           LIVSDWGLREGVLVS-------
1t6cA           LIVSDWGLREGVLVSEVLK---
1u6zB           LRLSDGALREGVL---------
1u6zA           LRLSDGALREGVL---------
1t6dB           I-VSDWGLREGVLVSEL-----
1t6dA           I-VSDWGLREGVLVSEL-----
3hi0B           ----------------------
3hi0A           ----------------------
2floB           LRLSDGALREGVL---------
2floA           LRLSDGALREGVL---------
3cerD           ----------------------
3cerC           ----------------------
3cerA           ----------------------