[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF53610.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vs5E.bssp"
#ERROR : Can't open dsspfile "2gy9E.bssp"
#ERROR : Can't open dsspfile "1i94E.bssp"
#ERROR : Can't open dsspfile "1fkaE.bssp"
#ERROR : Can't open dsspfile "2j00E.bssp"
#ERROR : Can't open dsspfile "3d5aE.bssp"
#ERROR : Can't open dsspfile "1pkpA.bssp"
#ERROR : Can't open dsspfile "3bbnE.bssp"
#ERROR : Can't open dsspfile "2zkqe.bssp"
#ERROR : Can't open dsspfile "1s1hE.bssp"

## Summary of PDB Search
:211
    2e-40  53%  1vs5E  [x.x.x] 30S RIBOSOMAL PROTEIN S5
    4e-39  52%  2gy9E  [x.x.x] 30S RIBOSOMAL SUBUNIT PROTEIN S5
    7e-32  44%  1i94E  [d.50.1 - d.14.1] 30S RIBOSOMAL PROTEIN S5
    7e-32  44%  1fkaE  [i.1.1] 30S RIBOSOMAL PROTEIN S5
    9e-32  46%  2j00E  [d.50.1 - d.14.1 (1fjgE)] 30S RIBOSOMAL PROTEIN S5
    9e-32  46%  3d5aE  [x.x.x] 30S RIBOSOMAL PROTEIN S5
    4e-29  64%  1pkpA  [x.x.x] RIBOSOMAL PROTEIN S5
    3e-22  48%  3bbnE  [x.x.x] RIBOSOMAL PROTEIN S5
    3e-05  27%  2zkqe  [x.x.x] 40S RIBOSOMAL PROTEIN S2E
    4e-05  24%  1s1hE  [i.1.1] 40S RIBOSOMAL PROTEIN S2
:211

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSQYIERVVTINRVSKVVKGGRRFSFTALX
1vs5E           ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
2gy9E           ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
1i94E           -----------------------------------------TDFEEKMILIRRTARMQAGGRRFRFGALV
1fkaE           -----------------------------------------TDFEEKMILIRRTARMQAGGRRFRFGALV
2j00E           ---------------------------------------------EKMILIRRTARMQAGGRRFRFGALV
3d5aE           ---------------------------------------------EKMILIRRTARMQAGGRRFRFGALV
1pkpA           ----------------------------------------------------------------------
3bbnE           ----------------------------------------------------------------------
2zkqe           ---------------------------------------------DEVLKIVPVQKQTRAGQRTRFKAFV
1s1hE           ---------------------------------------------DEVMNIKPVQKQTRAGQRTRFKAVV


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXXKAKEVPAAIQKGAEEARKNFFRVPMVNGTITHPVQGEKAAGIVMLKPAAPGTGVIA
1vs5E           VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
2gy9E           VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
1i94E           VVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIA
1fkaE           VVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIA
2j00E           VVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIA
3d5aE           VVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIA
1pkpA           --------------KAQEVPEAIRKAIEDAKKNLIEVPIVGTTIPHEVIGHFGAGEIILKPASEGTGVIA
3bbnE           --------------------SAVQKAAVDARRNIITVPMTKYTFPHRNEADYGAARVMLRPAAPGTGVIA
2zkqe           AIGDHNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRGYWGTVPCKVTGRSGSVPVRLIPAPRGTGIVS
1s1hE           VVGDSNGHVGLGIKTAKEVXXXXXXXXXXXKLSV--IPIRRGSLATKTTGKCGSVTVRLIPAPRGSGIVA


                         +         .         .         .         .         *         .:210
query           GGAARPVLECAGIQDILSKSLGSDNAINVVHATVDGLKQLVRPEEVAARRGKTIEEVxxxxxxxxxxxxx
1vs5E           GGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGK------------------
2gy9E           GGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKR--------------------
1i94E           GAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLR--------------------
1fkaE           GAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLR--------------------
2j00E           GAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLR--------------------
3d5aE           GAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLR--------------------
1pkpA           GGPARAVLELAGISDILSKSIGSNTPINMVRATFDGLKQL------------------------------
3bbnE           GGAVRTVLEMAGVENALGKQLGSNNALNNARATIVAVQTMRQFSDVARDRGIPMEEL-------------
2zkqe           APVPKKLLMMAGIDDCYTSARGCTATLNFAKATFDAISK-------------------------------
1s1hE           SPAVKKLLQLAGVEDVYTQSNGKTRTL-------------------------------------------


                         .         .         .         +         .         .         .:280
query           x
1vs5E           -
2gy9E           -
1i94E           -
1fkaE           -
2j00E           -
3d5aE           -
1pkpA           -
3bbnE           -
2zkqe           -
1s1hE           -