[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF53649.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2b69A.bssp"
#ERROR : Can't open dsspfile "1r66A.bssp"
#ERROR : Can't open dsspfile "1r6dA.bssp"
#ERROR : Can't open dsspfile "1z7bA.bssp"
#ERROR : Can't open dsspfile "2bllA.bssp"
#ERROR : Can't open dsspfile "1z75A.bssp"
#ERROR : Can't open dsspfile "2p5yA.bssp"
#ERROR : Can't open dsspfile "1u9jA.bssp"
#ERROR : Can't open dsspfile "1z7eD.bssp"
#ERROR : Can't open dsspfile "1z7eA.bssp"
#ERROR : Can't open dsspfile "1z73A.bssp"
#ERROR : Can't open dsspfile "2c5eB.bssp"
#ERROR : Can't open dsspfile "2c5eA.bssp"
#ERROR : Can't open dsspfile "2c59B.bssp"
#ERROR : Can't open dsspfile "2c59A.bssp"
#ERROR : Can't open dsspfile "2c54B.bssp"
#ERROR : Can't open dsspfile "2c54A.bssp"
#ERROR : Can't open dsspfile "1z74A.bssp"
#ERROR : Can't open dsspfile "2c5aB.bssp"
#ERROR : Can't open dsspfile "2c5aA.bssp"
#ERROR : Can't open dsspfile "1kewA.bssp"
#ERROR : Can't open dsspfile "1g1aA.bssp"
#ERROR : Can't open dsspfile "3eheA.bssp"
#ERROR : Can't open dsspfile "2hunB.bssp"
#ERROR : Can't open dsspfile "1bxkB.bssp"
#ERROR : Can't open dsspfile "1kvsA.bssp"
#ERROR : Can't open dsspfile "1udcA.bssp"
#ERROR : Can't open dsspfile "1lrjA.bssp"
#ERROR : Can't open dsspfile "1kvrA.bssp"
#ERROR : Can't open dsspfile "1lrkA.bssp"
#ERROR : Can't open dsspfile "1kvtA.bssp"
#ERROR : Can't open dsspfile "1kvqA.bssp"
#ERROR : Can't open dsspfile "2c20A.bssp"
#ERROR : Can't open dsspfile "1bxkA.bssp"
#ERROR : Can't open dsspfile "1kvuA.bssp"
#ERROR : Can't open dsspfile "1a9yA.bssp"
#ERROR : Can't open dsspfile "1a9zA.bssp"
#ERROR : Can't open dsspfile "1orrA.bssp"
#ERROR : Can't open dsspfile "1sb9A.bssp"
#ERROR : Can't open dsspfile "1sb8A.bssp"
#ERROR : Can't open dsspfile "2hunA.bssp"
#ERROR : Can't open dsspfile "1kerB.bssp"
#ERROR : Can't open dsspfile "1kepB.bssp"
#ERROR : Can't open dsspfile "1kepA.bssp"
#ERROR : Can't open dsspfile "1orrD.bssp"
#ERROR : Can't open dsspfile "1orrC.bssp"
#ERROR : Can't open dsspfile "1ek6B.bssp"
#ERROR : Can't open dsspfile "1ek5A.bssp"
#ERROR : Can't open dsspfile "1i3kB.bssp"
#ERROR : Can't open dsspfile "1i3kA.bssp"
#ERROR : Can't open dsspfile "1hzjA.bssp"
#ERROR : Can't open dsspfile "2q1uB.bssp"
#ERROR : Can't open dsspfile "2q1uA.bssp"
#ERROR : Can't open dsspfile "2q1sA.bssp"
#ERROR : Can't open dsspfile "1db3A.bssp"
#ERROR : Can't open dsspfile "2cnbB.bssp"
#ERROR : Can't open dsspfile "1t2aD.bssp"
#ERROR : Can't open dsspfile "1t2aA.bssp"
#ERROR : Can't open dsspfile "2pk3A.bssp"
#ERROR : Can't open dsspfile "1gy8D.bssp"
#ERROR : Can't open dsspfile "1gy8B.bssp"
#ERROR : Can't open dsspfile "1gy8C.bssp"
#ERROR : Can't open dsspfile "2pzjA.bssp"
#ERROR : Can't open dsspfile "2q1tA.bssp"
#ERROR : Can't open dsspfile "2cnbC.bssp"
#ERROR : Can't open dsspfile "1gy8A.bssp"
#ERROR : Can't open dsspfile "2cnbA.bssp"
#ERROR : Can't open dsspfile "2pzmB.bssp"
#ERROR : Can't open dsspfile "2pzmA.bssp"
#ERROR : Can't open dsspfile "2pzlB.bssp"
#ERROR : Can't open dsspfile "2pzkB.bssp"
#ERROR : Can't open dsspfile "2pzkA.bssp"
#ERROR : Can't open dsspfile "1bwsA.bssp"
#ERROR : Can't open dsspfile "1bsvA.bssp"
#ERROR : Can't open dsspfile "1z45A.bssp"
#ERROR : Can't open dsspfile "1n7gA.bssp"
#ERROR : Can't open dsspfile "1e7sA.bssp"
#ERROR : Can't open dsspfile "1e7rA.bssp"
#ERROR : Can't open dsspfile "1e7qA.bssp"
#ERROR : Can't open dsspfile "1e6uA.bssp"
#ERROR : Can't open dsspfile "1n7gB.bssp"
#ERROR : Can't open dsspfile "1n7hB.bssp"
#ERROR : Can't open dsspfile "1n7hA.bssp"
#ERROR : Can't open dsspfile "2z1mB.bssp"
#ERROR : Can't open dsspfile "1n7gD.bssp"
#ERROR : Can't open dsspfile "2z1mC.bssp"
#ERROR : Can't open dsspfile "3enkB.bssp"
#ERROR : Can't open dsspfile "3enkA.bssp"
#ERROR : Can't open dsspfile "2z95D.bssp"
#ERROR : Can't open dsspfile "2z95B.bssp"
#ERROR : Can't open dsspfile "2z95A.bssp"
#ERROR : Can't open dsspfile "2z1mA.bssp"
#ERROR : Can't open dsspfile "1rpnC.bssp"
#ERROR : Can't open dsspfile "1rpnA.bssp"
#ERROR : Can't open dsspfile "1eq2D.bssp"
#ERROR : Can't open dsspfile "1eq2H.bssp"
#ERROR : Can't open dsspfile "1eq2B.bssp"
#ERROR : Can't open dsspfile "2q1wC.bssp"
#ERROR : Can't open dsspfile "2q1wB.bssp"
#ERROR : Can't open dsspfile "2q1wA.bssp"
#ERROR : Can't open dsspfile "1eq2C.bssp"
#ERROR : Can't open dsspfile "1eq2A.bssp"
#ERROR : Can't open dsspfile "2rh8A.bssp"
#ERROR : Can't open dsspfile "3hfsB.bssp"
#ERROR : Can't open dsspfile "3hfsA.bssp"
#ERROR : Can't open dsspfile "1qrrA.bssp"
#ERROR : Can't open dsspfile "1i2bA.bssp"
#ERROR : Can't open dsspfile "1i24A.bssp"

## Summary of PDB Search
:317
    2e-76  54%  2b69A  [x.x.x] UDP-GLUCURONATE DECARBOXYLASE 1
    2e-25  33%  1r66A  [c.2.1] TDP-GLUCOSE-4,6-DEHYDRATASE
    4e-25  33%  1r6dA  [c.2.1] TDP-GLUCOSE-4,6-DEHYDRATASE
    2e-21  27%  1z7bA  [x.x.x] PROTEIN ARNA
    2e-21  27%  2bllA  [x.x.x] PROTEIN YFBG
    3e-21  27%  1z75A  [x.x.x] PROTEIN ARNA
    5e-21  30%  2p5yA  [x.x.x] UDP-GLUCOSE 4-EPIMERASE
    1e-20  27%  1u9jA  [c.2.1] HYPOTHETICAL PROTEIN YFBG
    2e-20  27%  1z7eD  [x.x.x] PROTEIN ARNA
    2e-20  27%  1z7eA  [x.x.x] PROTEIN ARNA
    2e-20  26%  1z73A  [x.x.x] PROTEIN ARNA
    5e-20  28%  2c5eB  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    5e-20  28%  2c5eA  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    5e-20  28%  2c59B  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    5e-20  28%  2c59A  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    1e-19  27%  2c54B  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    1e-19  27%  2c54A  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    1e-19  27%  1z74A  [x.x.x] PROTEIN ARNA
    1e-19  27%  2c5aB  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    1e-19  27%  2c5aA  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    3e-19  29%  1kewA  [c.2.1] DTDP-D-GLUCOSE 4,6-DEHYDRATASE
    3e-19  29%  1g1aA  [c.2.1] DTDP-D-GLUCOSE 4,6-DEHYDRATASE
    3e-18  29%  3eheA  [x.x.x] UDP-GLUCOSE 4-EPIMERASE (GALE-1)
    4e-18  31%  2hunB  [x.x.x] 336AA LONG HYPOTHETICAL DTDP-GLUCOSE 4,6-
    1e-17  27%  1bxkB  [c.2.1] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    2e-17  27%  1kvsA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    4e-17  26%  1udcA  [c.2.1 (2udpA)] UDP-GALACTOSE-4-EPIMERASE
    5e-17  26%  1lrjA  [c.2.1] UDP-GLUCOSE 4-EPIMERASE
    5e-17  26%  1kvrA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    7e-17  26%  1lrkA  [c.2.1] UDP-GLUCOSE 4-EPIMERASE
    7e-17  26%  1kvtA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    7e-17  26%  1kvqA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    7e-17  29%  2c20A  [x.x.x] UDP-GLUCOSE 4-EPIMERASE
    7e-17  28%  1bxkA  [c.2.1] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    1e-16  26%  1kvuA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    2e-16  26%  1a9yA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    2e-16  26%  1a9zA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    3e-16  26%  1orrA  [c.2.1] CDP-TYVELOSE-2-EPIMERASE
    4e-16  29%  1sb9A  [c.2.1] WBPP
    4e-16  29%  1sb8A  [c.2.1] WBPP
    8e-16  31%  2hunA  [x.x.x] 336AA LONG HYPOTHETICAL DTDP-GLUCOSE 4,6-
    1e-15  27%  1kerB  [c.2.1] DTDP-D-GLUCOSE 4,6-DEHYDRATASE
    1e-15  27%  1kepB  [c.2.1] DTDP-D-GLUCOSE 4,6-DEHYDRATASE
    1e-15  27%  1kepA  [c.2.1] DTDP-D-GLUCOSE 4,6-DEHYDRATASE
    2e-15  26%  1orrD  [c.2.1] CDP-TYVELOSE-2-EPIMERASE
    4e-15  26%  1orrC  [c.2.1] CDP-TYVELOSE-2-EPIMERASE
    1e-14  29%  1ek6B  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    1e-14  29%  1ek5A  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    3e-14  29%  1i3kB  [c.2.1] UDP-GLUCOSE 4-EPIMERASE
    3e-14  29%  1i3kA  [c.2.1] UDP-GLUCOSE 4-EPIMERASE
    3e-14  29%  1hzjA  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    2e-13  28%  2q1uB  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    2e-13  28%  2q1uA  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    2e-13  28%  2q1sA  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    4e-13  30%  1db3A  [c.2.1] GDP-MANNOSE 4,6-DEHYDRATASE
    4e-13  31%  2cnbB  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    5e-13  31%  1t2aD  [c.2.1] GDP-MANNOSE 4,6 DEHYDRATASE
    5e-13  31%  1t2aA  [c.2.1] GDP-MANNOSE 4,6 DEHYDRATASE
    6e-13  27%  2pk3A  [x.x.x] GDP-6-DEOXY-D-LYXO-4-HEXULOSE REDUCTASE
    6e-13  30%  1gy8D  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    1e-12  31%  1gy8B  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    2e-12  30%  1gy8C  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    4e-12  28%  2pzjA  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    5e-12  28%  2q1tA  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    1e-11  31%  2cnbC  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    2e-11  30%  1gy8A  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    2e-11  30%  2cnbA  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    3e-11  32%  2pzmB  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    3e-11  32%  2pzmA  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    3e-11  32%  2pzlB  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    3e-11  32%  2pzkB  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    3e-11  32%  2pzkA  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    4e-11  26%  1bwsA  [c.2.1] PROTEIN (GDP-4-KETO-6-DEOXY-D-MANNOSE
    4e-11  26%  1bsvA  [c.2.1] PROTEIN (GDP-FUCOSE SYNTHETASE)
    6e-11  25%  1z45A  [x.x.x] GAL10 BIFUNCTIONAL PROTEIN
    6e-11  27%  1n7gA  [c.2.1] GDP-D-MANNOSE-4,6-DEHYDRATASE
    6e-11  28%  1e7sA  [c.2.1] GDP-FUCOSE SYNTHETASE
    6e-11  28%  1e7rA  [c.2.1] GDP-FUCOSE SYNTHETASE
    6e-11  28%  1e7qA  [c.2.1] GDP-FUCOSE SYNTHETASE
    7e-11  25%  1e6uA  [c.2.1] GDP-FUCOSE SYNTHETASE
    3e-10  28%  1n7gB  [c.2.1] GDP-D-MANNOSE-4,6-DEHYDRATASE
    5e-10  27%  1n7hB  [c.2.1] GDP-D-MANNOSE-4,6-DEHYDRATASE
    5e-10  27%  1n7hA  [c.2.1] GDP-D-MANNOSE-4,6-DEHYDRATASE
    2e-09  27%  2z1mB  [x.x.x] GDP-D-MANNOSE DEHYDRATASE
    4e-09  27%  1n7gD  [c.2.1] GDP-D-MANNOSE-4,6-DEHYDRATASE
    7e-09  28%  2z1mC  [x.x.x] GDP-D-MANNOSE DEHYDRATASE
    7e-09  24%  3enkB  [x.x.x] UDP-GLUCOSE 4-EPIMERASE
    7e-09  24%  3enkA  [x.x.x] UDP-GLUCOSE 4-EPIMERASE
    2e-08  29%  2z95D  [x.x.x] GDP-D-MANNOSE DEHYDRATASE
    2e-08  28%  2z95B  [x.x.x] GDP-D-MANNOSE DEHYDRATASE
    2e-08  28%  2z95A  [x.x.x] GDP-D-MANNOSE DEHYDRATASE
    2e-08  27%  2z1mA  [x.x.x] GDP-D-MANNOSE DEHYDRATASE
    4e-08  28%  1rpnC  [c.2.1] GDP-MANNOSE 4,6-DEHYDRATASE
    4e-08  28%  1rpnA  [c.2.1] GDP-MANNOSE 4,6-DEHYDRATASE
    4e-06  26%  1eq2D  [c.2.1] ADP-L-GLYCERO-D-MANNOHEPTOSE 6-EPIMERASE
    5e-06  28%  1eq2H  [c.2.1] ADP-L-GLYCERO-D-MANNOHEPTOSE 6-EPIMERASE
    5e-06  28%  1eq2B  [c.2.1] ADP-L-GLYCERO-D-MANNOHEPTOSE 6-EPIMERASE
    9e-06  30%  2q1wC  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    9e-06  30%  2q1wB  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    9e-06  30%  2q1wA  [x.x.x] PUTATIVE NUCLEOTIDE SUGAR EPIMERASE/ DEHYDRATASE
    8e-05  26%  1eq2C  [c.2.1] ADP-L-GLYCERO-D-MANNOHEPTOSE 6-EPIMERASE
    8e-05  28%  1eq2A  [c.2.1] ADP-L-GLYCERO-D-MANNOHEPTOSE 6-EPIMERASE
    3e-04  34%  2rh8A  [x.x.x] ANTHOCYANIDIN REDUCTASE
    3e-04  34%  3hfsB  [x.x.x] ANTHOCYANIDIN REDUCTASE
    3e-04  34%  3hfsA  [x.x.x] ANTHOCYANIDIN REDUCTASE
    4e-04  39%  1qrrA  [c.2.1] SULFOLIPID BIOSYNTHESIS (SQD1) PROTEIN
    4e-04  39%  1i2bA  [c.2.1] SULFOLIPID BIOSYNTHESIS PROTEIN SQD1
    4e-04  39%  1i24A  [c.2.1] SULFOLIPID BIOSYNTHESIS PROTEIN SQD1
:317

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRCVITGGAGFLGSHLTDLILNQGHEVIVLDDLSTGSLSNLFHQISNPRLQIKTVDVRKKFEIDGPVDIV
2b69A           -RILITGGAGFVGSHLTDKL--DGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIE--VDQI
1r66A           MRLLVTGGAGFIGSHFVRQLLAGAYEVIVLDSLTAGNRANLAPVDADPRLRFVHGDIRDAGELRG-VDAI
1r6dA           MRLLVTGGAGFIGSHFVRQLLAGAYEVIVLDSLTAGNRANLAPVDADPRLRFVHGDIRDAGELRG-VDAI
1z7bA           -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
2bllA           MRVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
1z75A           -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
2p5yA           MRVLVTGGAGFIGSHIVEDLLARGLEVAVLDNLATGKRENVPKGVPFFRVDLRDKEVERAFREFRPTH-V
1u9jA           -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
1z7eD           -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
1z7eA           -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
1z73A           -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
2c5eB           LKISITGAGGFIASHIARRLKHEGHYVIASDHMTEDMFCDEFHLVD---LRV----MENCLKVTEGVDHV
2c5eA           LKISITGAGGFIASHIARRLKHEGHYVIASDHMTEDMFCDEFHLVD---LRV----MENCLKVTEGVDHV
2c59B           LKISITGAGGFIASHIARRLKHEGHYVIASDHMTEDMFCDEFHLVD---LRV----MENCLKVTEGVDHV
2c59A           LKISITGAGGFIASHIARRLKHEGHYVIASDHMTEDMFCDEFHLVD---LRV----MENCLKVTEGVDHV
2c54B           LKISITGAGGFIASHIARRLKHEGHYVIASDHMTEDMFCDEFHLVD---LRV----MENCLKVTEGVDHV
2c54A           LKISITGAGGFIASHIARRLKHEGHYVIASDHMTEDMFCDEFHLVD---LRV----MENCLKVTEGVDHV
1z74A           -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
2c5aB           LKISITGAGGFIASHIARRLKHEGHYVIASDHMTEDMFCDEFHLVD---LRV----MENCLKVTEGVDHV
2c5aA           LKISITGAGGFIASHIARRLKHEGHYVIASDHMTEDMFCDEFHLVD---LRV----MENCLKVTEGVDHV
1kewA           MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTGNLESLSDISESNRYNFEHADICDSAEITRQPDAV
1g1aA           MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTGNLESLSDISESNRYNFEHADICDSAEITRQPDAV
3eheA           ---VVTGGAGFIGSHVVDK-LSESNEIVVIDNLSSGNEEFVNEAARLVKADLAADDIKDYLK---GAEEV
2hunB           MKLLVTGGMGFIGSNFIRYILEKDWEVINIDKLGYGSPANLKDLEDDPRVKGDVADYELVKELVRKVDGV
1bxkB           -KILITGGAGFIGSALVRYIINETSDAVVVVDKLTGNLMSLAPVAQSERFAFEKVDICDRAELEHQPDCV
1kvsA           MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLSKRSVLPVIERLGGKHPTFVEGDIRNEALMDHAIDTV
1udcA           MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLSKRSVLPVIERLGGKHPTFVEGDIRNEALMDHAIDTV
1lrjA           MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLSKRSVLPVIERLGGKHPTFVEGDIRNEALMDHAIDTV
1kvrA           MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLSKRSVLPVIERLGGKHPTFVEGDIRNEALMDHAIDTV
1lrkA           MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLSKRSVLPVIERLGGKHPTFVEGDIRNEALMDHAIDTV
1kvtA           MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLSKRSVLPVIERLGGKHPTFVEGDIRNEALMDHAIDTV
1kvqA           MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLSKRSVLPVIERLGGKHPTFVEGDIRNEALMDHAIDTV
2c20A           ---LICGGAGYIGSHAVKKLVDEGLSVVVVDNLQTGHEDAITEKFYNGDLRDKAF-LRDVFTQEN-IEAV
1bxkA           -KILITGGAGFIGSALVRYIINETSDAVVVVDKLTGNLMSLAPVAQSERFAFEKVDICDRAELEHQPDCV
1kvuA           MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLSKRSVLPVIERLGGKHPTFVEGDIRNEALMDHAIDTV
1a9yA           MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLSKRSVLPVIERLGGKHPTFVEGDIRNEALMDHAIDTV
1a9zA           MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLSKRSVLPVIERLGGKHPTFVEGDIRNEALMDHAIDTV
1orrA           -KLLITGGCGFLGSNLASFALSQGIDLIVFDNLSKGATDNLHWLSSLGNFEFVHGDIRNKNDVTRLIDSC
1sb9A           ---LITGVAGFIGSNLLETLLKLDQKVVGLDNFATGHQRNLDEQWSN--FKFIQGDIRNLDDCNNAVDYV
1sb8A           ---LITGVAGFIGSNLLETLLKLDQKVVGLDNFATGHQRNLDEQWSN--FKFIQGDIRNLDDCNNAVDYV
2hunA           MKLLVTGGMGFIGSNFIRYILEKDWEVINIDKLGYGSPANLKDLEDDPRVKGDVADYELVKELVRKVDGV
1kerB           ---IVTGGAGFIGSNFVHYVYNNHPDVTVLDKLTAGNKANL-EAILGDRVELVVGDIADAELVDAKADAI
1kepB           ---IVTGGAGFIGSNFVHYVYNNHPDVTVLDKLTAGNKANL-EAILGDRVELVVGDIADAELVDAKADAI
1kepA           ---IVTGGAGFIGSNFVHYVYNNHPDVTVLDKLTAGNKANL-EAILGDRVELVVGDIADAELVDAKADAI
1orrD           -KLLITGGCGFLGSNLASFALSQGIDLIVFDNLSKGATDNLHWLSSLGNFEFVHGDIRNKNDVTRLIDSC
1orrC           -KLLITGGCGFLGSNLASFALSQGIDLIVFDNLSKGATDNLHWLSSLGNFEFVHGDIRNKNDVTRLIDSC
1ek6B           -KVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNGSLPESLQELTGRSVEFEEMDILKKYSFMA----V
1ek5A           -KVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNGSLPESLQELTGRSVEFEEMDILKKYSFMA----V
1i3kB           -KVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNGSLPESLQELTGRSVEFEEMDILKKYSFMA----V
1i3kA           -KVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNGSLPESLQELTGRSVEFEEMDILKKYSFMA----V
1hzjA           -KVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNGSLPESLQELTGRSVEFEEMDILKKYSFMA----V
2q1uB           ---MVVGGAGFVGSNLVKRLLELGNQVHVVDNLLSAEKINVPDHPAVRFSETSITDDALLASLQDEYDYV
2q1uA           ---MVVGGAGFVGSNLVKRLLELGNQVHVVDNLLSAEKINVPDHPAVRFSETSITDDALLASLQDEYDYV
2q1sA           ---MVVGGAGFVGSNLVKRLLELGNQVHVVDNLLSAEKINVPDHPAVRFSETSITDDALLASLQDEYDYV
1db3A           ---LITGVTGQDGSYLAEFLLEKGYEV---------------HGIKRPKFHLHYGDLSDTSNLEVQPDEV
2cnbB           MRVLVCGGAGYIGSHFVRALLDTNHSVVIVDSLTRENVARKLQQSDGPKAALEVGDVRNEFTRHGPIDAV
1t2aD           ---LITGITGQDGSYLAEFLLEKGYEVHGISSFNTGRIEHLYNDLTDSTCLVKIINEVKPTEIQSHVKIS
1t2aA           ---LITGITGQDGSYLAEFLLEKGYEVHGISSFNTGRIEHLYNDLTDSTCLVKIINEVKPTEIQSHVKIS
2pk3A           MRALITGVAGFVGKYLANHLTEQNVEVFGTSRNNEAKLPNV-EMIS---LDIMDSQRVKKVISDIKPDYI
1gy8D           MRVLVCGGAGYIGSHFVRALLDTNHSVVIVDSLTRENVARKLQQSDGPKAALEVGDVRNEFTRHGPIDAV
1gy8B           MRVLVCGGAGYIGSHFVRALLDTNHSVVIVDSLTRENVARKLQQSDGPKAALEVGDVRNEFTRHGPIDAV
1gy8C           MRVLVCGGAGYIGSHFVRALLDTNHSVVIVDSLTRENVARKLQQSDGPKAALEVGDVRNEFTRHGPIDAV
2pzjA           ---MVVGGAGFVGSNLVKRLLELGNQVHVVDNLLSAEKINVPDHPAVRFSETSITDDALLASLQDEYDYV
2q1tA           ---MVVGGAGFVGSNLVKRLLELGNQVHVVDNLLSAEKINVPDHPAVRFSETSITDDALLASLQDEYDYV
2cnbC           MRVLVCGGAGYIGSHFVRALLDTNHSVVIVDSLTRENVARKLQQSDGPKAALEVGDVRNEFTRHGPIDAV
1gy8A           MRVLVCGGAGYIGSHFVRALLDTNHSVVIVDSLTRENVARKLQQSDGPKAALEVGDVRNEFTRHGPIDAV
2cnbA           MRVLVCGGAGYIGSHFVRALLDTNHSVVIVDSLTRENVARKLQQSDGPKAALEVGDVRNEFTRHGPIDAV
2pzmB           MRILITGGAGCLGSNLIEHWLPQGHEILVIDNFATGKREVLPPVAGLSVIEGSVTDLERAFDSFKPTHVV
2pzmA           MRILITGGAGCLGSNLIEHWLPQGHEILVIDNFATGKREVLPPVAGLSVIEGSVTDLERAFDSFKPTHVV
2pzlB           MRILITGGAGCLGSNLIEHWLPQGHEILVIDNFATGKREVLPPVAGLSVIEGSVTDLERAFDSFKPTHVV
2pzkB           MRILITGGAGCLGSNLIEHWLPQGHEILVIDNFATGKREVLPPVAGLSVIEGSVTDLERAFDSFKPTHVV
2pzkA           MRILITGGAGCLGSNLIEHWLPQGHEILVIDNFATGKREVLPPVAGLSVIEGSVTDLERAFDSFKPTHVV
1bwsA           ----------------------------------------------------------------------
1bsvA           ----------------------------------------------------------------------
1z45A           ---LVTGGAGYIGSHTVVELIENGYDCVVADNLSNSTYDSVLEVLTKHHIPFYEVDLRKGLEKEYKIDSV
1n7gA           ---LITGITGQDGSYLTEFLLGKGYEVHGLIRRSSNFNTQRINHIYKALMKLHYADLTDASSLRRWIDVV
1e7sA           ----------------------------------------------------------------------
1e7rA           ----------------------------------------------------------------------
1e7qA           ----------------------------------------------------------------------
1e6uA           ----------------------------------------------------------------------
1n7gB           ---LITGITGQDGSYLTEFLLGKGYEVHGLSNFNTQRINHIYIDKALMKLHYADLSLRRWIDVIKP-DEV
1n7hB           ---LITGITGQDGSYLTEFLLGKGYEVHGLIRRSSNNTQRINHIYIKALMKLHYADLTDASSLRRWIDVV
1n7hA           ---LITGITGQDGSYLTEFLLGKGYEVHGLSNFNTQRINHIYALMKLHYADLTDASLRRWIDVIKP-DEV
2z1mB           -RALITGIRGQDGAYLAKLLLEKGYEVYGADSLKELGIENDVKIIHMDLLEFSNI-IRTIEKVQ--PDEV
1n7gD           ---LITGITGQDGSYLTEFLLGKGYEVHGLSNFNTQRINHIYILMKLHYADLTDASLRRWIDVIKP-DEV
2z1mC           -RALITGIRGQDGAYLAKLLLEKGYEVYGADSLKELGIENDVKIIHMDLLEFSNI-IRTIEKVQ--PDEV
3enkB           ---LVTGGAGYIGSHTAVELLAHGYDVVIADNLVNSKREAIFHEVSDERALARIFDAH-------PITAA
3enkA           ---LVTGGAGYIGSHTAVELLAHGYDVVIADNLVNSKREAIFHEVSDERALARIFDAH-------PITAA
2z95D           -RALITGIRGQDGAYLAKLLLEKGYEVYGADEFASWRLKEL--GIEND-VKIIHMDLLEFSNIIRTIDEV
2z95B           -RALITGIRGQDGAYLAKLLLEKGYEVYGADRLKELGIENDVKIIHMDLLEFSNI-IRTIEKVQ--PDEV
2z95A           -RALITGIRGQDGAYLAKLLLEKGYEVYGADRLKELGIENDVKIIHMDLLEFSNI-IRTIEKVQ--PDEV
2z1mA           -RALITGIRGQDGAYLAKLLLEKGYEVYGADRRSGEFASWRLKELGENDVKIIHMDLLEFSNIIRTIDEV
1rpnC           ----------------------------------------------------------------------
1rpnA           ----------------------------------------------------------------------
1eq2D           ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGTKF-----VNLVDLNIADYMDKEDFLIQGDVEAI
1eq2H           ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGTKF-----VNLVDLNIADYMDKEDFLIQGDVEAI
1eq2B           ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGTKF-----VNLVDLNIADYMDKEDFLIQGDVEAI
2q1wC           ----ITGICGQIGSHIAELLLERGDKVVGIDNFATGRREHLKDHPNLTFVEGSIADHALVNQLIGPDAVV
2q1wB           ----ITGICGQIGSHIAELLLERGDKVVGIDNFATGRREHLKDHPNLTFVEGSIADHALVNQLIGPDAVV
2q1wA           ----ITGICGQIGSHIAELLLERGDKVVGIDNFATGRREHLKDHPNLTFVEGSIADHALVNQLIGPDAVV
1eq2C           ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGTKF-----VNLVDLNIADYMDKEDFLIQGDVEAI
1eq2A           ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGTKF-----VNLVDLNIADYMDKEDFLIQGDVEAI
2rh8A           --CVV-GGTGFVASLLVKLLLQKGYAVTVRDPDNQKKVSHLLELQELGDLKIFRADLTDELSFEAPIDFV
3hfsB           --CVV-GGTGFVASLLVKLLLQKGYAVTVRDPDNQKKVSHLLELQELGDLKIFRADLTDELSFEAPIDFV
3hfsA           --CVV-GGTGFVASLLVKLLLQKGYAVTVRDPDNQKKVSHLLELQELGDLKIFRADLTDELSFEAPIDFV
1qrrA           ----------------------------------------------------------------------
1i2bA           ----------------------------------------------------------------------
1i24A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FNLASPASPPVYTQRRVECLLINSEAVLQVAEFALEKGARLVQASTSEVYGDPLSHPQLEHHWGNVNPIG
2b69A           YHLASPASPPNY-YNPIKTLKTNTIGTLNLG-LAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIG
1r66A           VHFASIAGASVFTETNVQ----GTQTLLQCA---VDAGVRVVHVSTDEVYGSIDSGS-----WTESSPLE
1r6dA           VHFASIAGASVFTETNVQ----GTQTLLQCA---VDAGVRVVHVSTNQVYGSIDSGS-----WTESSPLE
1z7bA           LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
2bllA           LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
1z75A           LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
2p5yA           SHQAAQASVKVSVEDPVLDFEVXXXXXXXXXEACRQYGVKLVFASTGAIYGEVPEGERAEETW----PPR
1u9jA           LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
1z7eD           LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
1z7eA           LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
1z73A           LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTAEVYG-MCSDKYFDEDHSNVGPVN
2c5eB           FNLAADMGGMGFIQSNHSVIMYNNTMIFNMIEAARINGIRFFYASSACIYPEQLETTNVSLKESDAWPAE
2c5eA           FNLAADMGGMGFIQSNHSVIMYNNTMIFNMIEAARINGIRFFYASSACIYPEQLETTNVSLKESDAWPAE
2c59B           FNLAADMGGMGFIQSNHSVIMYNNTMIFNMIEAARINGIRFFYASSACIYPEQLETTNVSLKESDAWPAE
2c59A           FNLAADMGGMGFIQSNHSVIMYNNTMIFNMIEAARINGIRFFYASSACIYPEQLETTNVSLKESDAWPAE
2c54B           FNLAADMGGMGFIQSNHSVIMYNNTMIFNMIEAARINGIRFFYASSACIYPEQLETTNVSLKESDAWPAE
2c54A           FNLAADMGGMGFIQSNHSVIMYNNTMIFNMIEAARINGIRFFYASSACIYPEQLETTNVSLKESDAWPAE
1z74A           LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
2c5aB           FNLAADMGGMGFIQSNHSVIMYNNTMIFNMIEAARINGIRFFYASSACIYPEQLETTNVSLKESDAWPAE
2c5aA           FNLAADMGGMGFIQSNHSVIMYNNTMIFNMIEAARINGIRFFYASSACIYPEQLETTNVSLKESDAWPAE
1kewA           MHLAAESGPAAF----IETNIVGTYALLEVARSALKNNFRFHHISTDEVYGD-LPHPEVENSFTETTXXX
1g1aA           MHLAAESGPAAF----IETNIVGTYALLEVARSALKNNFRFHHISTDEVYGD-LPHPEVENSFTETTXXX
3eheA           WHIA--ANPDVRAENPDEIYRNNVLATYRLLEAMRKAGSRIVFTSTSTVYGEAKVIPTPEDY-----PTH
2hunB           VHLASISSPEIFLHSNV----IGTYTLLESIR-RENPEVRFVHVSTDEVYGDILKGSFTEN-----DRLM
1bxkB           MHLAAESGPAAFIETNIVTLLEAARAYWNALTEDKKSAFRFHHISTDEVYGDLHS---TDDFFTETTXXX
1kvsA           IHFAGLKAVGESVQKPLEYYDNNVNGTLRISAMRAANVKNFIFSSTATVYGDNPKIPYVESF-----PTG
1udcA           IHFAGLKAVGESVQKPLEYYDNNVNGTLRISAMRAANVKNFIFSSSATVYGDQPKIPYVESF-----PTG
1lrjA           IHFAGLKAVGESVQKPLEYYDNNVNGTLRISAMRAANVKNFIFSSSATVYGDNPKIPYVESF-----PTG
1kvrA           IHFAGLKAVGESVQKPLEYYDNNVNGTLRISAMRAANVKNFIFSSAATVYGDQPKIPYVESF-----PTG
1lrkA           IHFAGLKAVGESVQKPLEYYDNNVNGTLRISAMRAANVKNFIFSSSATVYGDNPKIPYVESF-----PTG
1kvtA           IHFAGLKAVGESVQKPLEYYDNNVNGTLRISAMRAANVKNFIFSSVATVYGDNPKIPYVESF-----PTG
1kvqA           IHFAGLKAVGESVQKPLEYYDNNVNGTLRISAMRAANVKNFIFSSAATVYGDNPKIPYVESF-----PTG
2c20A           MHFAADSLVGVSMEKPLQYYNNNVYGALCLLEVMDEKVDKFIFSSTAATYGEVDVDLITEETMTNPT---
1bxkA           MHLAAESGPAAFIETNIVTLLEAARAYWNALTEDKKSAFRFHHISTDEVYGDLHS---TDDFFTETTXXX
1kvuA           IHFAGLKAVGESVQKPLEYYDNNVNGTLRISAMRAANVKNFIFSSSATVYGDQPKIPYVESF-----PTG
1a9yA           IHFAGLKAVGESVQKPLEYYDNNVNGTLRISAMRAANVKNFIFSSAATVYGDQPKIPYVESF-----PTG
1a9zA           IHFAGLKAVGESVQKPLEYYDNNVNGTLRISAMRAANVKNFIFSSAATVYGDNPKIPYVESF-----PTG
1orrA           FHLAGQVAMTTSIDNPCMDFEINVGGTLNLLEAVRQSNCNIIYSSTNKVYGDLEQYKYNENGYDESTQLD
1sb9A           LHQAALGSVPRSINDPITSNATNIDGFLNMLIAARDKVQSFTYAASSSTYGDHPGLPKVEDTIG--KPL-
1sb8A           LHQAALGSVPRSINDPITSNATNIDGFLNMLIAARDKVQSFTYAASSSTYGDHPGLPKVEDTIG--KPL-
2hunA           VHLASISSPEIFLHSNV----IGTYTLLESIR-RENPEVRFVHVSTDEVYGDILKGSFTEN-----DRLM
1kerB           VHYAAESHNDNSLNDPSPFIHTNFIGTYTLLEAARKYDIRFHHVSTDEVYGDPLREDLPGHGEGNYNP--
1kepB           VHYAAESHNDNSLNDPSPFIHTNFIGTYTLLEAARKYDIRFHHVSTDEVYGDPLREDLPGHGEGNYNP--
1kepA           VHYAAESHNDNSLNDPSPFIHTNFIGTYTLLEAARKYDIRFHHVSTDEVYGDPLREDLPGHGEGNYNP--
1orrD           FHLAGQVAMTTSIDNPCMDFEINVGGTLNLLEAVRQSNCNIIYSSTNKVYGDLEQYKYNENGYDESTQLD
1orrC           FHLAGQVAMTTSIDNPCMDFEINVGGTLNLLEAVRQSNCNIIYSSTNKVYGDLEQYKYNENGYDESTQLD
1ek6B           IHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKLVFSSSATVYGNPQYLPLDEAHGGCTNPYG
1ek5A           IHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKLVFSSSATVYGNPQYLPLDEAHGGCTNPYG
1i3kB           IHFAGLKAMGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKLVFSSSATVYGNPQYLPLDEAHGGCTNPYG
1i3kA           IHFAGLKAMGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKLVFSSSATVYGNPQYLPLDEAHGGCTNPYG
1hzjA           IHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKLVFSSSATVYGNPQYLPLDEAHGGCTNPYG
2q1uB           FHLATYHGNQSSIHDPLADHENNTLTTLKLYE-RLKHFKRLKKV----VYSAAGEETDIVSLHNNDSP--
2q1uA           FHLATYHGNQSSIHDPLADHENNTLTTLKLYE-RLKHFKRLKKV----VYSAAGEETDIVSLHNNDSP--
2q1sA           FHLATYHGNQSSIHDPLADHENNTLTTLKLYE-RLKHFKRLKKV----VYSAAGEETDIVSLHNNDSP--
1db3A           YNLGAMSHVAVSFESPEYTADVDAMGTLRLLELGLEKKTRFYQASTSELYGLVQEIPQKE-----TTPFY
2cnbB           VHMCSVRDPLKYYDNNVVGILRLLQAML------LHKCDKIIFSSSAAIFGNPTAEPI------DINKKS
1t2aD           FDLAEYTADGVGTLRLLDCGLINS--------------VKFYQASTSELYGKVQEIPQKE-----TTPFY
1t2aA           FDLAEYTADGVGTLRLLDCGLINS--------------VKFYQASTSELYGKVQEIPQKE-----TTPFY
2pk3A           FHLAAKSSVKDSWLNKKGTFSTNVFGTLHVLDAVRDSNCRILTIGSSEEYGMILPE---ESPVSEENQLR
1gy8D           VHMCSVRDPLKYYDNNVVGILRLLQAML------LHKCDKIIFSSSAAIFGNPTNAEPIDIN-AKKSP--
1gy8B           VHMCSVRDPLKYYDNNVVGILRLLQAML------LHKCDKIIFSSSAAIFGNPT--------MTNAEPIS
1gy8C           VHMCSVRDPLKYYDNNVVGILRLLQAML------LHKCDKIIFSSSAAIFGNPTMNAEPIDINAKKSP--
2pzjA           FHLATYHGNQSSIHDPLADHENNTLTTLKLYE-RLKHFKRLKKV----VYSAAGEETDIVSLHNNDSP--
2q1tA           FHLATYHGNQSSIHDPLADHENNTLTTLKLYE-RLKHFKRLKKV----VYSAAGEETDIVSLHNNDSP--
2cnbC           VHMCSVRDPLKYYDNNVVGILRLLQAML------LHKCDKIIFSSSAAIFGNPTAEPI------DINKKS
1gy8A           VHMCSVRDPLKYYDNNVVGILRLLQAML------LHKCDKIIFSSSAAIFGNPTMNAEPIDINAKKSP--
2cnbA           VHMCSVRDPLKYYDNNVVGILRLLQAML------LHKCDKIIFSSSAAIFGNPTNAEPIDIN-AKKSP--
2pzmB           HSAAAYKDPDDW----AEDAATNVQGSINVAKAASKAGVRLLNFQTALCYGRPATVPPID------SPTA
2pzmA           HSAAAYKDPDDW----AEDAATNVQGSINVAKAASKAGVRLLNFQTALCYGRPATVPPID------SPTA
2pzlB           HSAAAYKDPDDW----AEDAATNVQGSINVAKAASKAGVRLLNFQTALCYGRPATVPPID------SPTA
2pzkB           HSAAAYKDPDDW----AEDAATNVQGSINVAKAASKAGVRLLNFQTALCYGRPATVPPID------SPTA
2pzkA           HSAAAYKDPDDW----AEDAATNVQGSINVAKAASKAGVRLLNFQTALCYGRPATVPPID------SPTA
1bwsA           ---------------------------------------KLLFLGSSCIYPKLAKQPMAESELGTLEPTN
1bsvA           ---------------------------------------KLLFLGSSCIYPKLAKQPMAESELGTLEPTN
1z45A           IHFAGLKAVGESTQIPLRYYHNNILGTVVLLELMQQYNSKFVFSSSATVYGDATRFPNM-IPIPEECPLG
1n7gA           YNLAAQSHVPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGST-PPPQSE-----TTPFH
1e7sA           ----------------------------------------------------------------------
1e7rA           ----------------------------------------------------------------------
1e7qA           ----------------------------------------------------------------------
1e6uA           ---------------------------------------KLLFLGSSCIYPKLAKQPMAESELGTLEPTN
1n7gB           YNLAAQSHVPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGST-PPPQSE-----TTPFH
1n7hB           YNLAAQSHVPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGST-PPPQSE-----TTPFH
1n7hA           YNLAAQSHVPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGST-PPPQSE-----TTPFH
2z1mB           YNLAAQSFVGVSFEQPILTAEVDAIGVLRILEATVKPDTKFYQASTSEMFGKVQEIPQTEK-----TPFY
1n7gD           YNLAAQSHVPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGST-PPPQSE-----TTPFH
2z1mC           YNLAAQSFVGVSFEQPILTAEVDAIGVLRILEATVKPDTKFYQASTSEMFGKVQEIPQTEK-----TPFY
3enkB           IHFAALKAVGESVAKPIEXXXXXXXXXXXXXXVMRERAVRIVFSSSATVYGVPERSPIDE-----TFPLS
3enkA           IHFAALKAVGESVAKPIEXXXXXXXXXXXXXXVMRERAVRIVFSSSATVYGVPERSPIDE-----TFPLS
2z95D           YNLAAQSFVGVSFEQPILTAEVDAIGVLRILEATVKPDTKFYQASTSEMFGKVQEIPQTEK-----TPFY
2z95B           YNLAAQSFVGVSFEQPILTAEVDAIGVLRILEATVKPDTKFYQASTSEMFGKVQEIPQTEK-----TPFY
2z95A           YNLAAQSFVGVSFEQPILTAEVDAIGVLRILEATVKPDTKFYQASTSEMFGKVQEIPQTEK-----TPFY
2z1mA           YNLAAQSFVGVSFEQPILTAEVDAIGVLRILEATVKPDTKFYQASTSEMFGKVQEIPQTEK-----TPFY
1rpnC           ---------------------------------------RFYQASTSEMFGLIQAERQDEN-----TPFY
1rpnA           ---------------------------------------RFYQASTSEMFGLIQAERQDEN-----TPFY
1eq2D           FHEGASST----TEWDGKYMMDNNQYSKELLHYCLEREIPFLYASSAATYGGRTSDIESREYEKPLNVYG
1eq2H           FHEGASST----TEWDGKYMMDNNQYSKELLHYCLEREIPFLYASSAATYGGRTSDIESREYEKPLNVYG
1eq2B           FHEGASST----TEWDGKYMMDNNQYSKELLHYCLEREIPFLYASSAATYGGRTSDIESREYEKPLNVYG
2q1wC           HTAASYKDPDWYNDTLTNC--VGGSNVVQAAK--KNNVGRFVYFQTALCYGKPIQQPRLDHPRNPAN---
2q1wB           HTAASYKDPDWYNDTLTNC--VGGSNVVQAAK--KNNVGRFVYFQTALCYGKPIQQPRLDHPRNPAN---
2q1wA           HTAASYKDPDWYNDTLTNC--VGGSNVVQAAK--KNNVGRFVYFQTALCYGKPIQQPRLDHPRNPAN---
1eq2C           FHEGASST----TEWDGKYMMDNNQYSKELLHYCLEREIPFLYASSAATYGGRTSDIESREYEKPLNVYG
1eq2A           FHEGASST----TEWDGKYMMDNNQYSKELLHYCLEREIPFLYASSAATYGGRTSDIESREYEKPLNVYG
2rh8A           FHVATP----------------------------------------------------------------
3hfsB           FHVATP----------------------------------------------------------------
3hfsA           FHVATP----------------------------------------------------------------
1qrrA           ----------------------------------------------------------------------
1i2bA           ----------------------------------------------------------------------
1i24A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ERSCYDEGKRFAEALLSAMRLEQGLNAGIIRIFNTYGPRMHPFDGRVISGFVRQALANEPLTVFGDGSQT
2b69A           PRACYDEGKRVAETCYAYK--QEGVEVRVARIFNTFGPRHN--DGRVVSNFILQALQGEPLTVYGSGSQT
1r66A           PNSPYAASKAGSDLVARAYHRTYGLDVRITRCCNNYGPYQHP--EKLIPLFVTNLLDGGTLPLYGDGANV
1r6dA           PNSPYAASKAGSDLVARAYHRTYGLDVRITRCCNNYGPYQHP--EKLIPLFVTNLLDGGTLPLYGDGANV
1z7bA           KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
2bllA           KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
1z75A           KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
2p5yA           PKSPYAASKAAFEHYLSVYGQSYGLKWVSLRYGNVYGPRQDPHEAGVVAIFAERVLKGLPVTLYGDEGCV
1u9jA           KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
1z7eD           KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
1z7eA           KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
1z73A           KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
2c5eB           PQDAYGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREAAAFCRKATSTDRFEMWGDGLQT
2c5eA           PQDAYGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREAAAFCRKATSTDRFEMWGDGLQT
2c59B           PQDAYGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGRAPAAFCRKATSTDRFEMWGDGLQT
2c59A           PQDAYGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGRAPAAFCRKATSTDRFEMWGDGLQT
2c54B           PQDAYGLERLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGRAPAAFCRKATSTDRFEMWGDGLQT
2c54A           PQDAYGLERLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGRAPAAFCRKATSTDRFEMWGDGLQT
1z74A           KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLI--GKQK
2c5aB           PQDAFGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGRAPAAFCRKATSTDRFEMWGDGLQT
2c5aA           PQDAFGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGRAPAAFCRKATSTDRFEMWGDGLQT
1kewA           XXXXXXXXXXXXDHLVRAWRRTYGLPTIVTNCSNNYGP--YHFPEKLIPLVILNALEGKPLPIYGKGDQI
1g1aA           XXXXXXXXXXXXDHLVRAWRRTYGLPTIVTNCSNNYGP--YHFPEKLIPLVILNALEGKPLPIYGKGDQI
3eheA           PISLYGASKLACEALIESYCHTFDMQAWIYRFANVIGRRS---THGVIYDFIMKLKRNEELEILGNGEQN
2hunB           PSSPYSATKAASDMLVLGWTRTYNLNASITRCTNNYGP--YQFPEKLIPKTIIRASLGLKIPIYGTGKNV
1bxkB           XXXXXXXXXXXXDHLVRAWLRTYGLPTLITNCSNNYGP--YHFPEKLIPLMILNALAGKSLPVYGNGQQI
1kvsA           PQSPYGKSKLMVEQILTDLQKAQDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMRRDSLAIFGDGTGV
1udcA           PQSPYGKSKLMVEQILTDLQKAQDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMRRDSLAIFGDGTGV
1lrjA           PQSPYGKSKLMVEQILTDLQKAQDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMRRDSLAIFGDGTGV
1kvrA           PQSPYGKSKLMVEQILTDLQKAQDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMRRDSLAIFGDGTGV
1lrkA           PQSPYGKSKLMVEQILTDLQKAQDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMRRDSLAIFGDGTGV
1kvtA           PQSPYGKSKLMVEQILTDLQKAQDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMRRDSLAIFGDGTGV
1kvqA           PQSPYGKSKLMVEQILTDLQKAQDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMRRDSLAIFGDGTGV
2c20A           --NTYGETKLAIEKMLHWYSQASNLRYKIFRYFNVAGATPNGIIGELIPLVLQVALGQEKIMMFGDGTCI
1bxkA           XXXXXXXXXXXXDHLVRAWLRTYGLPTLITNCSNNYGP--YHFPEKLIPLMILNALAGKSLPVYGNGQQI
1kvuA           PQSPFGKSKLMVEQILTDLQKAQDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMRRDSLAIFGDGTGV
1a9yA           PQSPFGKSKLMVEQILTDLQKAQDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMRRDSLAIFGDGTGV
1a9zA           PQSPFGKSKLMVEQILTDLQKAQDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMRRDSLAIFGDGTGV
1orrA           FHSPYGCSKGAADQYMLDYARIFGLNTVVFRHSSMYGGRQFTYDQGWVGWFCQKAVINKPFTISGNGKQV
1sb9A           --SPYAVTKYVNELYADVFSRCYGFSTIGLRYFNVFGRRQDPNGAAVIPKWTSSMIQGDDVYINGDGETS
1sb8A           --SPYAVTKYVNELYADVFSRCYGFSTIGLRYFNVFGRRQDPNGAAVIPKWTSSMIQGDDVYINGDGETS
2hunA           PSSPYSATKAASDMLVLGWTRTYNLNASITRCTNNYGP--YQFPEKLIPKTIIRASLGLKIPIYG---TV
1kerB           -SSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQH--IEKFIPRQITNILAGIKPKLYGEGKNV
1kepB           -SSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQH--IEKFIPRQITNILAGIKPKLYGEGKNV
1kepA           -SSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQH--IEKFIPRQITNILAGIKPKLYGEGKNV
1orrD           FHSPYGCSKGAADQYMLDYARIFGLNTVVFRHSSMYGGRQFTYDQGWVGWFCQKAVEIKPFTISGNGKQV
1orrC           FHSPYGCSKGAADQYMLDYARIFGLNTVVFRHSSMYGGRQFTYDQGWVGWFCQKAVEIKPFTISGNGKQV
1ek6B           KSKFFIE-----EMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMRREALNVFGDGTGV
1ek5A           KSKFFIE-----EMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMRREALNVFGDGTGV
1i3kB           KSKFFIE-----EMIRDLCQADKTWNVVLLRYFNPTGAHASGCIGEDPQGIPNNLMRREALNVFGDGTGV
1i3kA           KSKFFIE-----EMIRDLCQADKTWNVVLLRYFNPTGAHASGCIGEDPQGIPNNLMRREALNVFGDGTGV
1hzjA           KSKFFIE-----EMIRDLCQADKTWNVVLLRYFNPTGAHASGCIGEDPQGIPNNLMRREALNVFGDGTGV
2q1uB           ----YSMSKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRVTPTFIYKALKGMPLPLENGGVAT
2q1uA           ----YSMSKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRVTPTFIYKALKGMPLPLENGGVAT
2q1sA           ----YSMSKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRVTPTFIYKALKGMPLPLENGGVAT
1db3A           PRSPYAVAKLYAYWITVNYRESYGMYACNGILFNHESPRR---GETFVTRKITRAIANESCLYLGNMDSL
2cnbB           PESPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDIGEIILGRVMSDIADKRMPIFGDGTCV
1t2aD           PRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGAFVTRKISRSVAKILGQLECFSLGNLDAK
1t2aA           PRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGAFVTRKISRSVAKILGQLECFSLGNLDAK
2pk3A           PMSPYGVSKASVGMLARQYVKAYGMDIIHTRTFNHIGPGQSL--GFVTQDFAKQIVKQEPIIKVGNLEAV
1gy8D           -ESPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDIGEIILGRVMSDIADKRMPIFGDGTCV
1gy8B           PESPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDIGEIILGRVMSDIADKRMPIFGDGTCV
1gy8C           -ESPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHIPIILGRVMSDIAPDASTDKRMPIFGDGTCV
2pzjA           ----YSMSKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRVTPTFIYKALKGMPLPLENGGVAT
2q1tA           ----YSMSKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRVTPTFIYKALKGMPLPLENGGVAT
2cnbC           PESPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDIGEIILGRVMSDIADKRMPIFGDGTCV
1gy8A           -ESPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDIGEIILGRVMSDIADKRMPIFGDGTCV
2cnbA           -ESPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDIGEIILGRVMSDIADKRMPIFGDGTCV
2pzmB           PFTSYGISKTAGEAFL----MMSDVPVVSLRLANVTGPR----------------LAIGPIPTFYKRLKA
2pzmA           PFTSYGISKTAGEAFL----MMSDVPVVSLRLANVTGPR----------------LAIGPIPTFYKRLKA
2pzlB           PFTSYGISKTAGEAFL----MMSDVPVVSLRLANVTGPR----------------LAIGPIPTFYKRLKA
2pzkB           PFTSYGISKTAGEAFL----MMSDVPVVSLRLANVTGPR----------------LAIGPIPTFYKRLKA
2pzkA           PFTSYGISKTAGEAFL----MMSDVPVVSLRLANVTGPR----------------LAIGPIPTFYKRLKA
1bwsA           EP--YAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHFHPSNSHVIPALLRRTAQNAPVVVWGSGTPM
1bsvA           EP--YAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHFHPSNSHVIPALLRRTAQNAPVVVWGSGTPM
1z45A           PTNPYGHTKYAIENILNDLSDKKSWKFAILRYFNPIGAHPSGLIGEDPLGIPNNLLRREKLYIFRDGTPI
1n7gA           PRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRENFVTRKITRALGRIKVGLQTKLFGNLQAS
1e7sA           ---------------------------------NLYGPHFHPSNSHVIPALLRRAQSAPDVVVWGSGTPM
1e7rA           ---------------------------------NLYGPHFHPSNSHVIPALLRRAQSAPDVVVWGSGTPM
1e7qA           ---------------------------------NLYGPHFHPSNSHVIPALLRRAQSAPDVVVWGSGTPM
1e6uA           EP--YAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHFHPSNSHVIPALLRRAQKAPDVVVWGSGTPM
1n7gB           PRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRENFVTRKITRALGRIKVGLQTKLFGNLQAS
1n7hB           PRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRENFVTRKITRALGRIKVGLQTKLFGNLQAS
1n7hA           PRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRENFVTRKITRALGRIKVGLQTKLFGNLQAS
2z1mB           PRSPYAVAKLFGHWITVNYREAYNMFACSGILFNHESPRGIEFVTRKITSLARIKYGLQDKLVLGNLNAK
1n7gD           PRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRGE---NFVTRKITRALGRIKVGLQTKLFAS
2z1mC           PRSPYAVAKLFGHWITVNYREAYNMFACSGILFNHESPRGIEFVTRKITSLARIKYGLQDKLVLGNLNAK
3enkB           ATNPYGQTKLMAEQILRDVEADPSWRVATLRYFNPVGAHESGLIGEDPAGYVAQVAVGEKLRVFGDGTGV
3enkA           ATNPYGQTKLMAEQILRDVEADPSWRVATLRYFNPVGAHESGLIGEDPAGYVAQVAVGEKLRVFGDGTGV
2z95D           PRSPYAVAKLFGHWITVNYREAYNMFACSGILFNHESPRGIEFVTRKITSLARIKYGLQDKLVLGNLNAK
2z95B           PRSPYAVAKLFGHWITVNYREAYNMFACSGILFNHESPRGIEFVTRKITSLARIKYGLQDKLVLGNLNAK
2z95A           PRSPYAVAKLFGHWITVNYREAYNMFACSGILFNHESPRGIEFVTRKITSLARIKYGLQDKLVLGNLNAK
2z1mA           PRSPYAVAKLFGHWITVNYREAYNMFACSGILFNHESPRGIEFVTRKITSLARIKYGLQDKLVLGNLNAK
1rpnC           PRSPYGVAKLYGHWITVNYRESFGLHASSGILFNHESPRGIEFVTRKVTDAVRIKLGKQQELRLGNVDAK
1rpnA           PRSPYGVAKLYGHWITVNYRESFGLHASSGILFNHESPRGIEFVTRKVTDAVRIKLGKQQELRLGNVDAK
1eq2D           SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
1eq2H           SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
1eq2B           SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
2q1wC           --SSYAISKSANEDYLE----YSGLDFVTFRLANVVGPR-------------------------------
2q1wB           --SSYAISKSANEDYLE----YSGLDFVTFRLANVVGPR-------------------------------
2q1wA           --SSYAISKSANEDYLE----YSGLDFVTFRLANVVGPR-------------------------------
1eq2C           SKFLFDEYVR---------QILPEANSQIVRYFNVYGPR----EGH------KGSMASVAFHLNTQLNFK
1eq2A           SKFLFDEYVR---------QILPEANSQIVRYFNVYGPR----EGH------KGSMASVAFHLNTQLNNK
2rh8A           ----------------------------------------------------------------------
3hfsB           ----------------------------------------------------------------------
3hfsA           ----------------------------------------------------------------------
1qrrA           ------------------------LNQGVVYGVKTDETEMHEYDGTALNRFCVQAAVGHPLTVYGKGGQT
1i2bA           ------------------------LNQGVVYGVKTDETEMHEYDGTALNRFCVQAAVGHPLTVYGKGGQT
1i24A           ------------------------LNQGVVYGVKTDETEMHEYDGTALNRFCVQAAVGHPLTVYGKGGQT


                         .         .         .         +         .         .         .:280
query           RSFCYVSDLVRGLWLMGNSNQPGPINLGNPIEQTVLSMAHLIKESTNSESSITFEPLPSDDPVRRRPDIS
2b69A           RAFQYVSDLVNGLVAL-NSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIK
1r66A           REWVHTDDHCRGIALVLAGGRAGEIHIGGGLELTNRELTGILLDSLGADSSVRKVADRKGHDLRYSLDGG
1r6dA           REWVHTDDHCRGIALVLAGGRAGEIHIGGGLELTNRELTGILLDSLGADSSVRKVADRKGHDLRYSLDGG
1z7bA           RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHPFAGFRVVESQDVEHEKPSIR
2bllA           RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHPRHHFPPFAGFRVVHRKPSIR
1z75A           RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHPFAGFRVVESQDVEHMKPSIR
2p5yA           RDYVYVGDVAEAHALALFSLE-GIYNVGTGEGHTTREVLMAVAEAAGKAPEV--QPAPPRPGDLERSVLS
1u9jA           RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHPRHHFPPFAGESVEHRKPSIR
1z7eD           RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
1z7eA           RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
1z73A           RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHPRHHFPPFAGESVEHRKPSIR
2c5eB           RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMV--LSFEEKKLPIHHIPGPEGVRRNSDNN
2c5eA           RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMV--LSFEEKKLPIHHIPGPEGVRRNSDNN
2c59B           RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMV--LSFEEKKLPIHHIPGPEGVRRNSDNN
2c59A           RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMV--LSFEEKKLPIHHIPGPEGVRRNSDNN
2c54B           RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMV--LSFEEKKLPIHHIPGPEGVRRNSDNN
2c54A           RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMV--LSFEEKKLPIHHIPGPEGVRRNSDNN
1z74A           RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHPRHHFPPFAGFRVEHYKPSIR
2c5aB           RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMV--LSFEEKKLPIHHIPGPEGVRRNSDNN
2c5aA           RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMV--LSFEEKKLPIHHIPGPEGVRRNSDNN
1kewA           RDWLYVEDHARALHMVVTEGKAGTYNIGGHNEKKNLDVVEIVPKATSYREQITYVADRPGHDRRYAIDAG
1g1aA           RDWLYVEDHARALHMVVTEGKAGTYNIGGHNEKKNLDVVEIVPKATSYREQITYVADRPGHDRRYAIDAG
3eheA           KSYIYISDCVDALFGLRGDERVNIFNIGSEDQIKVKRIAEIVCEELGLSPRFRFTMLLSIEKLKR-----
2hunB           RDWLYVEDHVRAIELVGESREIYNISAGE--EKTNLEVVKIILRGKGEELIELVEDRPGHD-LRYSLDSW
1bxkB           RDWLYVEDHARALYCVATTGKVGTYNIGGHNERKNLDVVETICEAPNKPHGVAYRDLITFVALRYAIDAS
1kvsA           RDYIHVMDLADGVAMEKLANKPGVYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADAS
1udcA           RDYIHVMDLADGVAMEKLANKPGVYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADAS
1lrjA           RDYIHVMDLADGVAMEKLANKPGVYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADAS
1kvrA           RDYIHVMDLADGVAMEKLANKPGVYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADAS
1lrkA           RDYIHVMDLADGVAMEKLANKPGVYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPACWADAS
1kvtA           RDYIHVMDLADGVAMEKLANKPGVYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADAS
1kvqA           RDYIHVMDLADGVAMEKLANKPGVYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADAS
2c20A           RDYIHVEDLVAGLKDLQNGGESDFYNLGNGNGFSVKEIVDAVREVTNHEIPAEVAPRRAGDPARLVASSQ
1bxkA           RDWLYVEDHARALYCVATTGKVGTYNIGGHNERKNLDVVETICE--------LLEELAPNKPFRYAIDAS
1kvuA           RDYIHVMDLADGVAMEKLANKPGVYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADAS
1a9yA           RDYIHVMDLADGVAMEKLANKPGVYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADAS
1a9zA           RDYIHVMDLADGVAMEKLANKPGVYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADAS
1orrA           RDVLHAEDMI-SLYFTALANRGNAFNIGGTIVNXXXXXXXXXXXXDYCNIDMRFTNLPVRESDQRVADIK
1sb9A           RDFCYIENTVQANLLAATANQVYNIAVGG---RTSLNQLFFALRDGLAENGVSYEPVYRDDVRHSLADIS
1sb8A           RDFCYIENTVQANLLAATANQVYNIAVGG---RTSLNQLFFALRDGLAENGVSYEPVYRDDVRHSLADIS
2hunA           RDWLYVEDHVRAIELVGESREIYNISAGE--EKTNLEVVKIILRGKGEELIELVEDRPGHD-LRYSLDSW
1kerB           RDWIHTNDHSTGVWAILTKGRMGETYLGEKNNKEVLEL--ILEKMGQPKDAYDHVTDRAGHDLRYAIDAS
1kepB           RDWIHTNDHSTGVWAILTKGRMGETYLGEKNNKEVLEL--ILEKMGQPKDAYDHVTDRAGHDLRYAIDAS
1kepA           RDWIHTNDHSTGVWAILTKGRMGETYLGEKNNKEVLEL--ILEKMGQPKDAYDHVTDRAGHDLRYAIDAS
1orrD           RDVLHAEDMI-SLYFTALANRGNAFNIGGTIVNXXXXXXXXXXXXDYCNIDMRFTNLPVRESDQRVADIK
1orrC           RDVLHAEDMI-SLYFTALANRGNAFNIGGTIVNXXXXXXXXXXXXDYCNIDMRFTNLPREDQRVFVADIK
1ek6B           RDYIHVVDLAKGAALRKLKEQCGIYNLGTGTGYSVLQMVQAMEKASGKK-------IPYKVVARREGDVS
1ek5A           RDYIHVVDLAKGAALRKLKEQCGIYNLGTGTGYSVLQMVQAMEKASGKK-------IPYKVVARREGDVS
1i3kB           RDYIHVVDLAKGAALRKLKEQCGIYNLGTGTGYSVLQMVQAMEKASGKK-------IPYKVVARREGDVS
1i3kA           RDYIHVVDLAKGAALRKLKEQCGIYNLGTGTGYSVLQMVQAMEKASGKK-------IPYKVVARREGDVS
1hzjA           RDYIHVVDLAKGAALRKLKEQCGIYNLGTGTGYSVLQMVQAMEKASGKK-------IPYKVVARREGDVS
2q1uB           RDFIFVEDVANGLIACAADGTPGGVNIASGKETSIADLATKINEITGNNTELDRLPRPWDNSGKRFGSPE
2q1uA           RDFIFVEDVANGLIACAADGTPGGVNIASGKETSIADLATKINEITGNNTELDRLPRPWDNSGKRFGSPE
2q1sA           RDFIFVEDVANGLIACAADGTPGGVNIASGKETSIADLATKINEITGNNTELDRLPKRPWDNSKRFGSPE
1db3A           RDWGHAKDYVKMQWMMLQQEQPEDFVIATGVQYSVRQFVEMAAEGTGVEESVTGHDAPAVDPRYFRPDPT
2cnbB           RDYVHVCDLVEKLGPNDKSKYFSVFNLGT-------SRGYSVREVIEVARKTTGHPIPVRECGRREGDSD
1t2aD           RDWGHAKDYVEAMWLMLQNDEPEDFVIATGVEKSFLHIGKTIVWEGKNENEVTGKVHVTVDLKYYRPDCT
1t2aA           RDWGHAKDYVEAMWLMLQNDEPEDFVIATGVEKSFLHIGKTIVWEGKNENEVTGKVHVTVDLKYYRPDCT
2pk3A           RDFTDVRDIVQAYWLLSQYGKTGDVNVCSGIGTRIQDVLDLLLAMANVKIDTELNPLPSEVPTLIGSN-K
1gy8D           RDYVHVCDLVEKLGPNDKSKYFSVFNLGT-------SRGYSVREVIEVARKTTGHPIPVRECGRREGDSD
1gy8B           RDYVHVCDLVEKLGPNDKSKYFSVFNLGT-------SRGYSVREVIEVARKTTGHPIPVRECGRREGDSD
1gy8C           RDYVHVCDLVEKLGPNDKSKYFSVFNLGT-------SRGYSVREVIEVARKTTGHPIPVRECGRREGDSD
2pzjA           RDFIFVEDVANGLIACAADGTPGGVNIASGKETSIADLATKINEITGNNTEL--DRLPK-RPWDNSGSPE
2q1tA           RDFIFVEDVANGLIACAADGTPGGVNIASGKETSIADLATKINEITGNNTEL--------DRLPKRPSPE
2cnbC           RDYVHVCDLVEKLGPNDKSKYFSVFNLGT-------SRGYSVREVIEVARKTTGHPIPVRECGRREGDSD
1gy8A           RDYVHVCDLVEKLGPNDKSKYFSVFNLGT-------SRGYSVREVIEVARKTTGHPIPVRECGRREGDSD
2cnbA           RDYVHVCDLVEKLGPNDKSKYFSVFNLGT-------SRGYSVREVIEVARKTTGHPIPVRECGRREGDSD
2pzmB           GQKCFCSDTVR-----------------------------------------------------------
2pzmA           GQKCFCSDTVR-----------------------------------------------------------
2pzlB           GQKCFCSDTVR-----------------------------------------------------------
2pzkB           GQKCFCSDTVR-----------------------------------------------------------
2pzkA           GQKCFCSDTVR-----------------------------------------------------------
1bwsA           REFLHVDDLAHEVWLENTQPMLSHINVGTGVDCTIRDLAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVT
1bsvA           REFLHVDDLAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVT
1z45A           RDYIHVVDLAKGQYLEAYNENEGEWNLGSGKGSTVFEVYHAFCKASGID-------LPYVLNLTAKPD--
1n7gA           RDWGFAGDYVEAMWLMLQQEKPDDYVVGHTVEEFLVSFGYLWKDYVEIDQRY-FRPAEVDN---LQGDAS
1e7sA           REFLHVDDLAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVT
1e7rA           REFLHVDDLAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVT
1e7qA           REFLHVDDLAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVT
1e6uA           REFLHVDDLAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVT
1n7gB           RDWGFAGDYVEAMWLMLQQEKPDDYVVGHTVEEFLVSFGYLWKDYVEIDQRY-FRPAEVDN---LQGDAS
1n7hB           RDWGFAGDYVEAMWLMLQQEKPDDYVVGHTVEEFLVSFGYLWKDYVEIDQRY-FRPAEVDN---LQGDAS
1n7hA           RDWGFAGDYVEAMWLMLQQEKPDDYVVGHTVEEFLVSFGYLWKDYVEIDQRY-FRPAEVDN---LQGDAS
2z1mB           RDWGYAPEYVEAMWLMMQQPEPDDYVIATGETHTVREFVEKAAKIAGFDIEWVGEGINEKGIDRNRPDIE
1n7gD           RDWGFAGDYVEAMWLMLQQEKPDDYVVGHTVEEFLVSFGYL---GLNWKDYVEI-----DDNLQG--DAS
2z1mC           RDWGYAPEYVEAMWLMMQQPEP------------------------------------------------
3enkB           RDYIHVVDLARGLDALERRDASLTVNLGTGRGYSVLEVVRAFEKASGRAVPYELVARRPGDVXXXXXXXX
3enkA           RDYIHVVDLARGLDALERRDASLTVNLGTGRGYSVLEVVRAFEKASGRAVPYELVARRPGDVXXXXXXXX
2z95D           RDWGYAPEYVEAMWLMMQQPEP------------------------------------------------
2z95B           RDWGYAPEYVEAMWLMMQQPEP------------------------------------------------
2z95A           RDWGYAPEYVEAMWLMMQQPEP------------------------------------------------
2z1mA           RDWGYAPEYVEAMWLMMQQPEP------------------------------------------------
1rpnC           RDWGFAGDYVEAMWLMLQQDKADDYVVATGVTTTVRDMCQIAFEHVG----LDYRDFLKIDPAFFRPNPA
1rpnA           RDWGFAGDYVEAMWLMLQQDKADDYVVATGVTTTVRDMCQIAFEHVG----LDYRDFLKIDPAFFRPNPA
1eq2D           RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
1eq2H           RDFVYVGDVADNLWFLEN-GVSGIFNLG------------------------------------------
1eq2B           RDFVYVGDVADNLWFLEN-GVSGIFNLG------------------------------------------
2q1wC           ----------------------------------------------------------------------
2q1wB           ----------------------------------------------------------------------
2q1wA           ----------------------------------------------------------------------
1eq2C           RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADAYQAFTQAD---------------------
1eq2A           RDFVYVGDVADNLWFLEN-GVSGIFNLG------------------------------------------
2rh8A           ----------------------------------------------------------------------
3hfsB           ----------------------------------------------------------------------
3hfsA           ----------------------------------------------------------------------
1qrrA           RGYLDIRDTVQ-----------------------------------------------------------
1i2bA           RGYLDIRDTVQ-----------------------------------------------------------
1i24A           RGYLDIRDTVQ-----------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KAKELLGWEPLVGIDVGLREVINWQIETQRTYAEKIS
2b69A           KAK-LLGWEPVVPLEEGLNKAIHY-------------
1r66A           KIERELGYRPQVSFADGLARTVRWYRENR--------
1r6dA           KIERELGYRPQVSFADGLARTVRWYRENR--------
1z7bA           NAHRCLDWEPKIDMQETIDETLDFFLRT---------
2bllA           NAHRCLDWEPKIDMQETIDETLDFFLRT---------
1z75A           NAHRCLDWEPKIDMQETIDETLDFFLRT---------
2p5yA           PLKLMAGWRPKVGFQEGIRLTVD--------------
1u9jA           NAHRCLDWEPKIDMQETIDETLDFFLRT---------
1z7eD           NAHRCLDWEPKIDMQETIDETLDFFLRT---------
1z7eA           NAHRCLDWEPKIDMQETIDETLDFFLRT---------
1z73A           NAHRCLDWEPKIDMQETIDETLDFFLRT---------
2c5eB           LIKEKLGWAPNMRLKEGLRITYFWQIEKEKAKGSDVS
2c5eA           LIKEKLGWAPNMRLKEGLRITYFWQIEKEKAKGSDVS
2c59B           LIKEKLGWAPNMRLKEGLRITYFWQIEKEKAKGSDVS
2c59A           LIKEKLGWAPNMRLKEGLRITYFWQIEKEKAKGSDVS
2c54B           LIKEKLGWAPNMRLKEGLRITYFWQIEKEKAKGSDVS
2c54A           LIKEKLGWAPNMRLKEGLRITYFWQIEKEKAKGSDVS
1z74A           NAHRCLDWEPKIDMQETIDETLDFFLRT---------
2c5aB           LIKEKLGWAPNMRLKEGLRITYFWQIEKEKAKGSDVS
2c5aA           LIKEKLGWAPNMRLKEGLRITYFWQIEKEKAKGSDVS
1kewA           KISRELGWKPLETFESGIRKTVEWYL-----------
1g1aA           KISRELGWKPLETFESGIRKTVEWYL-----------
3eheA           -----LGWKPRYNSEEAVRMAVRDLVE----------
2hunB           KITRDLKWRPKYTFDEGIKKTIDWYLKNE--------
1bxkB           KIARELGCVPQETFESGMRKTVQWYLANE--------
1kvsA           KADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD---
1udcA           KADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD---
1lrjA           KADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD---
1kvrA           KADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD---
1lrkA           KADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD---
1kvtA           KADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD---
1kvqA           KADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD---
2c20A           KAKEKLGWDPYVNVKTIIEHAWNWHQKQPNGY-----
1bxkA           KIARELGCVPQETFESGMRKTVQWYLANE--------
1kvuA           KADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD---
1a9yA           KADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD---
1a9zA           KADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD---
1orrA           KITNAIDWSPKVSAKDGVQKMYDW-------------
1sb9A           KAAKLLGYAPKYDVSAGVALAMPWYI-----------
1sb8A           KAAKLLGYAPKYDVSAGVALAMPWYI-----------
2hunA           KITRDLKWRPKYTFDEGIKKTIDWYLKNE--------
1kerB           KLRDELGWTPFTDFSEGLEETIQWYTDNQ--------
1kepB           KLRDELGWTPFTDFSEGLEETIQWYTDNQ--------
1kepA           KLRDELGWTPFTDFSEGLEETIQWYTDNQ--------
1orrD           KITNAIDWSPKVSAKDGVQKMYDW-------------
1orrC           KITNAIDWSPKVSAKDGVQKMYDW-------------
1ek6B           LAQEELGWTAALGLDRMCEDLWRWQ------------
1ek5A           LAQEELGWTAALGLDRMCEDLWRWQ------------
1i3kB           LAQEELGWTAALGLDRMCEDLWRWQ------------
1i3kA           LAQEELGWTAALGLDRMCEDLWRWQ------------
1hzjA           LAQEELGWTAALGLDRMCEDLWRWQ------------
2q1uB           KARRELGFSADVSIDDGLRKTIEW-------------
2q1uA           KARRELGFSADVSIDDGLRKTIEW-------------
2q1sA           KARRELGFSADVSIDDGLRKTIEW-------------
1db3A           KAHEKLGWKP----EITLREMVSEMVANDLEAAKKHS
2cnbB           KAREVLGWKP---------------------------
1t2aD           KAKQKLNWKPRVAFDELVREMVHADVELMRT------
1t2aA           KAKQKLNWKPRVAFDELVREMVHADVELMRT------
2pk3A           RLKDSTGWKPRIPLEKSLFEIL---------------
1gy8D           KAREVLGWKP---------------------------
1gy8B           KAREVLGWKP---------------------------
1gy8C           KAREVLGWKP---------------------------
2pzjA           KARRELGFSADVSIDDGLRKTIEW-------------
2q1tA           KARRELGFSADVSIDDGLRKTIEW-------------
2cnbC           KAREVLGWKP---------------------------
1gy8A           KAREVLGWKP---------------------------
2cnbA           KAREVLGWKP---------------------------
2pzmB           -------------------------------------
2pzmA           -------------------------------------
2pzlB           -------------------------------------
2pzkB           -------------------------------------
2pzkA           -------------------------------------
1bwsA           RLHQ-LGWYHEISLEAGLASTYQWFLENQ--------
1bsvA           RLHQ-LGWYHEISLEAGLASTYQWFLENQ--------
1z45A           RAKRELKWQTELQVEDSCKDLWKWTTENPFGY-----
1n7gA           KAKEVLGWKPQVGFEKLVKMMVDEDLE----------
1e7sA           RLHQ-LGWYHEISLEAGLASTYQWFLENQ--------
1e7rA           RLHQ-LGWYHEISLEAGLASTYQWFLENQ--------
1e7qA           RLHQ-LGWYHEISLEAGLASTYQWFLENQ--------
1e6uA           RLHQ-LGWYHEISLEAGLASTYQWFLENQ--------
1n7gB           KAKEVLGWKPQVGFEKLVKMMVDEDLE----------
1n7hB           KAKEVLGWKPQVGFEKLVKMMVDEDLE----------
1n7hA           KAKEVLGWKPQVGFEKLVKMMVDEDLE----------
2z1mB           KAMKKLGWKPRTTFD----------------------
1n7gD           KAKEVLGWKPQVGFEKLVKMMVDEDLE----------
2z1mC           -------------------------------------
3enkB           XXXETIGWKAERDLERMCADHWRWQENNPRGF-----
3enkA           XXXETIGWKAERDLERMCADHWRWQENNPRGF-----
2z95D           -------------------------------------
2z95B           -------------------------------------
2z95A           -------------------------------------
2z1mA           -------------------------------------
1rpnC           KAQRVLGWKPRTSLDELIRMMV---------------
1rpnA           KAQRVLGWKPRTSLDELIRMMV---------------
1eq2D           -------------------------------------
1eq2H           -------------------------------------
1eq2B           -------------------------------------
2q1wC           -------------------------------------
2q1wB           -------------------------------------
2q1wA           -------------------------------------
1eq2C           -------------------------------------
1eq2A           -------------------------------------
2rh8A           -------------------------------------
3hfsB           -------------------------------------
3hfsA           -------------------------------------
1qrrA           -------------------------------------
1i2bA           -------------------------------------
1i24A           -------------------------------------