[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF53991.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3eytD.bssp"
#ERROR : Can't open dsspfile "3eytC.bssp"
#ERROR : Can't open dsspfile "3eytA.bssp"
#ERROR : Can't open dsspfile "3eytB.bssp"
#ERROR : Can't open dsspfile "2hyxD.bssp"
#ERROR : Can't open dsspfile "2hyxB.bssp"
#ERROR : Can't open dsspfile "2hyxA.bssp"
#ERROR : Can't open dsspfile "3erwG.bssp"
#ERROR : Can't open dsspfile "3erwF.bssp"
#ERROR : Can't open dsspfile "3erwC.bssp"
#ERROR : Can't open dsspfile "3erwA.bssp"

## Summary of PDB Search
:160
    7e-32  53%  3eytD  [x.x.x] UNCHARACTERIZED PROTEIN SPOA0173
    7e-32  53%  3eytC  [x.x.x] UNCHARACTERIZED PROTEIN SPOA0173
    7e-32  53%  3eytA  [x.x.x] UNCHARACTERIZED PROTEIN SPOA0173
    2e-31  53%  3eytB  [x.x.x] UNCHARACTERIZED PROTEIN SPOA0173
    2e-09  29%  2hyxD  [x.x.x] PROTEIN DIPZ
    2e-09  29%  2hyxB  [x.x.x] PROTEIN DIPZ
    2e-09  29%  2hyxA  [x.x.x] PROTEIN DIPZ
    2e-04  23%  3erwG  [x.x.x] SPORULATION THIOL-DISULFIDE OXIDOREDUCTASE A
    2e-04  23%  3erwF  [x.x.x] SPORULATION THIOL-DISULFIDE OXIDOREDUCTASE A
    2e-04  23%  3erwC  [x.x.x] SPORULATION THIOL-DISULFIDE OXIDOREDUCTASE A
    2e-04  23%  3erwA  [x.x.x] SPORULATION THIOL-DISULFIDE OXIDOREDUCTASE A
:160

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSSLDNAPLLELDVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGL
3eytD           -----NAKAPELQIQQWFNSADLTLADLRGKVIVIEAFQ-LCPGCV-HGIPLAQKVRAAFPEDKVAVLGL
3eytC           -----NAKAPELQIQQWFNSADLTLADLRGKVIVIEAFQ-LCPGCV-HGIPLAQKVRAAFPEDKVAVLGL
3eytA           -----NAKAPELQIQQWFNSADLTLADLRGKVIVIEAFQ-LCPGCV-HGIPLAQKVRAAFPEDKVAVLGL
3eytB           ----------ELQIQQWFNSADLTLADLRGKVIVIEAFQ-LCPGCV-HGIPLAQKVRAAFPEDKVAVLGL
2hyxD           LESCGTAPDLK-GITGWLNTPGIDLKSLRGKVVLIDFWAYSCINC-QRAIPHVVGWYQAYKDSGLAVIGV
2hyxB           LESCGTAPDLK-GITGWLNTPGIDLKSLRGKVVLIDFWAYSCINC-QRAIPHVVGWYQAYKDSGLAVIGV
2hyxA           LESCGTAPDLK-GITGWLNTPGIDLKSLRGKVVLIDFWAYSCINC-QRAIPHVVGWYQAYKDSGLAVIGV
3erwG           ----------------------------KGQKTILHFWTSWCPPCKKE-LPQFQSFYDAHPSDSVKLVTV
3erwF           ----------------------------KGQKTILHFWTSWCPPCKKE-LPQFQSFYDAHPSDSVKLVTV
3erwC           ----------------------------KGQKTILHFWTSWCPPCKKE-LPQFQSFYDAHPSDSVKLVTV
3erwA           ----------------------------KGQKTILHFWTSWCPPCKKE-LPQFQSFYDAHPSDSVKLVTV


                         .         .         *         .         .         .         .:140
query           HSVFEHHDVMTPEALKVFISEFGIKFPVAVDMPREGQRIPSTMKKYRLEGTPSIILADRKGRIRQVQFGQ
3eytD           HTVFEHHEA-TPISLKAFLHEYRIKFPVGVDQPGDG--APRTAAYQR--GTPSLLLIDKAGDLRAHHFGD
3eytC           HTVFEHHEA-TPISLKAFLHEYRIKFPVGVDQPGDG--APRTAAYQR--GTPSLLLIDKAGDLRAHHFGD
3eytA           HTVFEHHEA-TPISLKAFLHEYRIKFPVGVDQPGDG--APRTAAYQR--GTPSLLLIDKAGDLRAHHFGD
3eytB           HTVFEHHEA-TPISLKAFLHEYRIKFPVGVDQPGDG--APRTAAYQR--GTPSLLLIDKAGDLRAHHFGD
2hyxD           HTP-EYAFEKVPGNVAKGAANLGISYPIALDNNY------ATWTNYRNRYWPAEYLIDATGTVRHIKFGE
2hyxB           HTP-EYAFEKVPGNVAKGAANLGISYPIALDNNY------ATWTNYRNRYWPAEYLIDATGTVRHIKFGE
2hyxA           HTP-EYAFEKVPGNVAKGAANLGISYPIALDNNY------ATWTNYRNRYWPAEYLIDATGTVRHIKFGE
3erwG           NLV---NSEQNQQVVEDFIKANKLTFPIVLDSKGE-------LKEYHIITIPTSFLLNEKGEIEKTKIG-
3erwF           NLV---NSEQNQQVVEDFIKANKLTFPIVLDSKGE-------LKEYHIITIPTSFLLNEKGEIEKTKIG-
3erwC           NLV---NSEQNQQVVEDFIKANKLTFPIVLDSKGE-------LKEYHIITIPTSFLLNEKGEIEKTKIG-
3erwA           NLV---NSEQNQQVVEDFIKANKLTFPIVLDSKGE-------LKEYHIITIPTSFLLNEKGEIEKTKIG-


                         +         .         .         .         .         *         .:210
query           VDDFVxxxxxxxxxxxxxxx
3eytD           VSELL---------------
3eytC           VSELL---------------
3eytA           VSELL---------------
3eytB           VSELL---------------
2hyxD           GD------------------
2hyxB           GD------------------
2hyxA           GD------------------
3erwG           --------------------
3erwF           --------------------
3erwC           --------------------
3erwA           --------------------