[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF54079.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1t0iA.bssp"
#ERROR : Can't open dsspfile "1t0iB.bssp"
#ERROR : Can't open dsspfile "1rttA.bssp"

## Summary of PDB Search
:188
    4e-17  37%  1t0iA  [c.23.5] YLR011WP
    7e-17  35%  1t0iB  [c.23.5] YLR011WP
    3e-04  30%  1rttA  [c.23.5] CONSERVED HYPOTHETICAL PROTEIN
:188

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxKIAIITGSTRPGRVNIDVANWVLERAQERNDAQYELVDIADFNFPVLDEAMPAGYGQYANEHTKAWAA
1t0iA           --KVGIIMGSVRAKRVCPEIAAYVIENSEELIDQKLKIVDLQQIALPLYDELIPASVDEYADSKTRSWSR
1t0iB           --KVGIIMGSVRAKRVCPEIAAYVKRTIE---NSKIQVVDLQQIALPLYDELIPASVDEYADSKTRSWSR
1rttA           --KVLGISGSLRSGSYNSAALQEAIGLVPP--GMSIELADIS--GIPLYNEDV---YALGFPPAVERFRE


                         .         .         *         .         .         .         .:140
query           KIAEFDGFIFVTGEYNHSVPAALTNALSYLSAEWNNKAAGIVSYGSAMGVRAAEHLRGILSELQIAHVQK
1t0iA           IVNALDIIVFVTPQYNWGYPAALKNAIDRLYHEWHGKPALVVSYGGHGGSKCNDQLQEVLHGLKM-----
1t0iB           IVNALDIIVFVTPQYNWGYPAALKNAIDRLYHEWHGKPALVVSYGGHGGSKCNDQLQEVLHGLKM-----
1rttA           QIRAADALLFATPEYNYSMAGVLKNAIDWASQPFSGKPAAILSAGRFGTARAQYHLRQTLVFLDVHPLNK


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1t0iA           ------------------------------------------------
1t0iB           ------------------------------------------------
1rttA           ------------------------------------------------