[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF54084.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vp7E.bssp"
#ERROR : Can't open dsspfile "1vp7C.bssp"
#ERROR : Can't open dsspfile "1vp7B.bssp"
#ERROR : Can't open dsspfile "1vp7A.bssp"

## Summary of PDB Search
:81
    4e-04  38%  1vp7E  [a.7.13] EXODEOXYRIBONUCLEASE VII SMALL SUBUNIT
    4e-04  38%  1vp7C  [a.7.13] EXODEOXYRIBONUCLEASE VII SMALL SUBUNIT
    4e-04  38%  1vp7B  [a.7.13] EXODEOXYRIBONUCLEASE VII SMALL SUBUNIT
    4e-04  38%  1vp7A  [a.7.13] EXODEOXYRIBONUCLEASE VII SMALL SUBUNIT
:81

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxYERARDELVEIVKILELGQMGLDESLKYWERGEALAKRCEEHLAGAS
1vp7E           -----------------------FETALAELESLVSA-ENGTLPLEQSLSAYRRGVELARVCQDRLAQAE
1vp7C           -----------------------FETALAELESLVSA-ENGTLPLEQSLSAYRRGVELARVCQDRLAQAE
1vp7B           -----------------------FETALAELESLVSA-ENGTLPLEQSLSAYRRGVELARVCQDRLAQAE
1vp7A           -----------------------FETALAELESLVSA-ENGTLPLEQSLSAYRRGVELARVCQDRLAQAE


                         .         .         *         .         .         .         .:140
query           ARVExxxxxxx
1vp7E           QQVK-------
1vp7C           QQVK-------
1vp7B           QQVK-------
1vp7A           QQVK-------