[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF54269.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2qe7G.bssp"
#ERROR : Can't open dsspfile "1fs0G.bssp"
#ERROR : Can't open dsspfile "3fksG.bssp"
#ERROR : Can't open dsspfile "1e79G.bssp"
#ERROR : Can't open dsspfile "2hldG.bssp"
#ERROR : Can't open dsspfile "2v7qG.bssp"
#ERROR : Can't open dsspfile "1w0jG.bssp"
#ERROR : Can't open dsspfile "1ohhG.bssp"
#ERROR : Can't open dsspfile "2jj1G.bssp"
#ERROR : Can't open dsspfile "2jdiG.bssp"
#ERROR : Can't open dsspfile "1h8eG.bssp"
#ERROR : Can't open dsspfile "1bmfG.bssp"
#ERROR : Can't open dsspfile "1mabG.bssp"
#ERROR : Can't open dsspfile "2f43G.bssp"
#ERROR : Can't open dsspfile "2ck3G.bssp"
#ERROR : Can't open dsspfile "2hldP.bssp"
#ERROR : Can't open dsspfile "3fksY.bssp"
#ERROR : Can't open dsspfile "3fksP.bssp"
#ERROR : Can't open dsspfile "2hldY.bssp"

## Summary of PDB Search
:325
    2e-28  37%  2qe7G  [x.x.x] ATP SYNTHASE SUBUNIT GAMMA
    1e-22  34%  1fs0G  [c.49.2] ATP SYNTHASE GAMMA SUBUNIT
    9e-09  21%  3fksG  [x.x.x] ATP SYNTHASE SUBUNIT GAMMA, MITOCHONDRIAL
    1e-07  24%  1e79G  [c.49.2] ATP SYNTHASE GAMMA CHAIN
    1e-07  21%  2hldG  [x.x.x] ATP SYNTHASE GAMMA CHAIN, MITOCHONDRIAL
    3e-07  24%  2v7qG  [x.x.x] ATP SYNTHASE GAMMA CHAIN MOLECULE: ATP SYNTHASE
    9e-07  38%  1w0jG  [c.49.2] ATP SYNTHASE GAMMA CHAIN, MITOCHONDRIAL
    9e-07  50%  1ohhG  [c.49.2] ATP SYNTHASE GAMMA CHAIN, MITOCHONDRIAL
    9e-07  38%  2jj1G  [x.x.x] ATP SYNTHASE GAMMA CHAIN
    9e-07  38%  2jdiG  [x.x.x] ATP SYNTHASE GAMMA CHAIN
    9e-07  36%  1h8eG  [c.49.2] BOVINE MITOCHONDRIAL F1-ATPASE
    9e-07  38%  1bmfG  [c.49.2] BOVINE MITOCHONDRIAL F1-ATPASE
    2e-06  48%  1mabG  [c.49.2] PROTEIN (F1-ATPASE GAMMA CHAIN)
    2e-06  48%  2f43G  [x.x.x] ATP SYNTHASE GAMMA CHAIN, MITOCHONDRIAL
    7e-06  37%  2ck3G  [x.x.x] ATP SYNTHASE GAMMA CHAIN
    2e-05  25%  2hldP  [x.x.x] ATP SYNTHASE GAMMA CHAIN, MITOCHONDRIAL
    5e-05  40%  3fksY  [x.x.x] ATP SYNTHASE SUBUNIT GAMMA, MITOCHONDRIAL
    5e-05  40%  3fksP  [x.x.x] ATP SYNTHASE SUBUNIT GAMMA, MITOCHONDRIAL
    6e-05  42%  2hldY  [x.x.x] ATP SYNTHASE GAMMA CHAIN, MITOCHONDRIAL
:325

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xATIRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQRVLERLASASSLDHPMLRER
2qe7G           ---MREIKRRIRSVKNTRQITKAMKMVAAAKLRRAQETAENARPYADKIS-------------HPMLEAR
1fs0G           ------------------KITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLA---HYKHPYLEDR
3fksG           -ATLKEVEMRLKSIKNIEKITKTMKIVASTRLXXXXXXXXXXXXM-DEAEQLFYKNAETKNLDPKEL---
1e79G           -ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGVGSLALYEK----ADIKTPEL---
2hldG           -ATLKEVEMRLKSIKNIEKITKTMKIVASTRLXXXXXXXXXXXXMDEAEQL--------------FYKNA
2v7qG           -ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGVGSLALYEKADIKT----------
1w0jG           -ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVY-------------------------
1ohhG           ----------------------------------------------------------------------
2jj1G           -ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVY-------------------------
2jdiG           -ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVY-------------------------
1h8eG           -ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYG------VGSLALYEKAD-------
1bmfG           -ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVY-------------------------
1mabG           ----------------------------------------------------------------------
2f43G           ----------------------------------------------------------------------
2ck3G           -ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVY-------------------------
2hldP           ----------------------------------------------------------------------
3fksY           ----------------------------------------------------------------------
3fksP           ----------------------------------------------------------------------
2hldY           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EGGKRAAVLVVTSDRGMAGGYNHNVXXXXXXXXXXXXXSGYEVVRYVTGKKGVDYYKFRAEDVAGAWTGF
2qe7G           PV-KKTGYMVITSDRGLAGPYNANILRLVSKTIEERHQSKDEYVIFAVGRKGRDFFKKRGYPVVEEVTGI
1fs0G           D-VKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVTGM
3fksG           -------IVAITSDKGLCGSIHSQLAKAVRRHLNDQPNAD---IVTIGDKIKMQLLRTHPNNIKLSINGI
1e79G           -------IIGVSSDRGLCGAIHSSVAKQMKSEAANLKEVKIDKIRSILHRTHSDQFLVTFKEVG------
2hldG           ETKNKELIVAITSDKGLCGSIHSQLAKAVRRHLNDQPNAD---IVTIGDKIKMQLLRTHPNNIKLSINGI
2v7qG           ----KHLIIGVSSDRGLCGAIHSSVAKQMKSEAANLKEVKIDKIRSILHRTHSDQFLVTFKEVG------
1w0jG           ----------------------------------------------------------------------
1ohhG           ----------------------------------------------------------------------
2jj1G           ----------------------------------------------------------------------
2jdiG           ----------------------------------------------------------------------
1h8eG           -----ILIIGVSSDRGLCGAIHSSV---------------------------------------------
1bmfG           ----------------------------------------------------------------------
1mabG           ----------------------------------------------------------------------
2f43G           ----------------------------------------------------------------------
2ck3G           ----------------------------------------------------------------------
2hldP           ----------------------------------------------------------------------
3fksY           ----------------------------------------------------------------------
3fksP           ----------------------------------------------------------------------
2hldY           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SQDPDWAATHNVRRHLIDGFTASSEGEAAWREGLNLSEGQDIQGFDQVHVVYTEFISMLTQNPVVHQLLP
2qe7G           SDTPSLTEIQDIAQSAIGMFADET--------------------FDKLTIFYNEFVSPIVQRPVEKQLLP
1fs0G           GDNPSLSELIGPVKVMLQAY----------------DEGR----LDKLYIVSNKFINTMSQVPTISQLLP
3fksG           GKDPTFQESALIADKLLSVMKAGT--------------------YPKISIFYNDPVSSLSFEPSEKPIFN
1e79G           RRPPTFGDASVIALELLN-------------SGYEFDEGS---------IIFNRFRSVISYKTEEKPIFS
2hldG           GKDPTFQESALIADKLLSVMKAGT--------------------YPKISIFYNDPVSSLSFEPSEKPIFN
2v7qG           RRPPTFGDASVIALELLN-------------SGYEFDEGS---------IIFNRFRSVISYKTEEKPIFS
1w0jG           ----------------------------------------------------------------------
1ohhG           ----------------------------------------------------------------------
2jj1G           ----------------------------------------------------------------------
2jdiG           ----------------------------------------------------------------------
1h8eG           ----------------------------------------------------------------------
1bmfG           ----------------------------------------------------------------------
1mabG           ----------------------------------------------------------------------
2f43G           ----------------------------------------------------------------------
2ck3G           ----------------------------------------------------------------------
2hldP           -----------VRRHLNDQPNADTIGDKIKMHPIKLSIGKDAPTFQESALIADKLLSVMKGTYPKISIFY
3fksY           ----------------------------------------------------------------------
3fksP           ----------------------------------------------------------------------
2hldY           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VEPVIEDEIFEKGEDLLSSSGDVEPDYEFEPDADTLLEALLPQYVSRRLFSIFLXXXXXXXXXXXNAMKS
2qe7G           ------------------------------------LTSLLPKYAETLIYSALLDAKASEFGARMTAMGN
1fs0G           LPK------------------HKSWDYLYEPDPKALLDTLLRRYVESQVY--------------------
3fksG           AKTIEQSPSFGKFE--IDTDANVPRDLFEYTLANQMLTAMAQGYAAE-------------ISARRNAMDN
1e79G           LDTISSAESMSIYDDI---------------DAD-----VLRNYQEYSLANIIYYSLKESTTSEQSARMT
2hldG           AKTIEQSPSFGKFE--IDTDANVPRDLFEYTLANQMLTAMAQGYAAE-------------ISARRNAMDN
2v7qG           LDTISSAESMSIYDDI---------------DAD-----VLRNYQEYSLANIIYYSLKESTTSEQSARMT
1w0jG           ------------------------------------------------------------------AMDN
1ohhG           ------------------------------------------------------------------AMDN
2jj1G           ------------------------------------------------------------------AMDN
2jdiG           ------------------------------------------------------------------AMDN
1h8eG           ------------------------------------------------------------------AMDN
1bmfG           ------------------------------------------------------------------AMDN
1mabG           ------------------------------------------------------------------AMDN
2f43G           ------------------------------------------------------------------AMDN
2ck3G           ------------------------------------------------------------------AMDN
2hldP           NDPVSS---FEPSEKPIFNAKTIDTDANVPRD-------LFEYTLANQMLTAMAQGYAAEISARRNAMDN
3fksY           -----------------------------------------------------------------NAMDN
3fksP           -----------------------------------------------------------------NAMDN
2hldY           -----------------------------------------------------------------NAMDN


                         .         *         .         .         .         .         +:350
query           ATDNASELVKDLSRVANQARQAQITQEITEIVGGAGALxxxxxxx
2qe7G           ATDNATEMLETLTLQFNRA--------------------------
1fs0G           ---------------------------------------------
3fksG           ASKNAGDMINRYSILYNRTRQAVITNELVDIITGASS--------
1e79G           AMDNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL-------
2hldG           ASKNAGDMINRYSILYNRTRQAVITNELVDIITGASS--------
2v7qG           AMDNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL-------
1w0jG           ASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL-------
1ohhG           ASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL-------
2jj1G           ASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL-------
2jdiG           ASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL-------
1h8eG           ASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL-------
1bmfG           ASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL-------
1mabG           ASKNASDMIDKLTLTFNRTRQAVITKELIEIISGAAAL-------
2f43G           ASKNASDMIDKLTLTFNRTRQAVITKELIEIISGAAAL-------
2ck3G           ASKNASEMIDKLTLTFNRTRQAVITKELIEIISGA----------
2hldP           ASKNAGDMINRYSILYNRTRQAVITNELVDIITGASS--------
3fksY           ASKNAGDMINRYSILYNRTRQAVITNELVDIITGASS--------
3fksP           ASKNAGDMINRYSILYNRTRQAVITNELVDIITGASS--------
2hldY           ASKNAGDMINRYSILYNRTRQAVITNELVDIITGA----------