[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF54313.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ogdA.bssp"
#ERROR : Can't open dsspfile "3e7nB.bssp"
#ERROR : Can't open dsspfile "3e7nG.bssp"
#ERROR : Can't open dsspfile "3e7nA.bssp"

## Summary of PDB Search
:123
    5e-13  35%  1ogdA  [c.133.1] HIGH AFFINITY RIBOSE TRANSPORT PROTEIN RBSD
    6e-11  46%  3e7nB  [x.x.x] D-RIBOSE HIGH-AFFINITY TRANSPORT SYSTEM
    3e-10  46%  3e7nG  [x.x.x] D-RIBOSE HIGH-AFFINITY TRANSPORT SYSTEM
    3e-10  46%  3e7nA  [x.x.x] D-RIBOSE HIGH-AFFINITY TRANSPORT SYSTEM
:123

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKSGLLNPDLCYAIARLGHTDTWAVADCGLPIPEHVEIIDLALVFGIPTFEQVLNALKPXXXXXXXXXX
1ogdA           MKKHGILNSHLAKILADLGHTDKIVIADAGLPVPDGVLKIDLSLKPGLPAFQDTAAVLAEEMAVEKVIAA
3e7nB           -KKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSTARID-ALTQGVPSFEQVEAAIQQNPXXXXXXXX
3e7nG           -KKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSTARID-ALTQGVPSFEQVEAAIQQNPXXXXXXXX
3e7nA           -KKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSTARID-ALTQGVPSFEQVEAAIQQNPXXXXXXXX


                         .         .         *         .         .         .         .:140
query           XXTPERIRXXXXXXXXXXXXXXLKAQLAECAFVIRTGETTAYANVIFKSGVAF
1ogdA           AEIKASNQENAKFLENLFSEQEIKLLTKDAKAVIRTGEFTPYANCILQAGVLF
3e7nB           XXXXXXXXXGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGVTF
3e7nG           XXXXXXXXXGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGV--
3e7nA           XXXXXXXXXGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGV--