[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF54336.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2g29A.bssp"
#ERROR : Can't open dsspfile "2i4bA.bssp"
#ERROR : Can't open dsspfile "2i49A.bssp"
#ERROR : Can't open dsspfile "2i48A.bssp"

## Summary of PDB Search
:391
    3e-25  29%  2g29A  [x.x.x] NITRATE TRANSPORT PROTEIN NRTA
    9e-24  29%  2i4bA  [x.x.x] BICARBONATE TRANSPORTER
    9e-24  29%  2i49A  [x.x.x] BICARBONATE TRANSPORTER
    9e-24  29%  2i48A  [x.x.x] BICARBONATE TRANSPORTER
:391

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTPLTIGYVPIACSAPIAIANALGLFKKH
2g29A           ------------------------------------------TTAKLGFIALTDAAPLIIAKEKGFYAKY
2i4bA           --------------------------------------------IKLGYIPIVEAAPLIIAQEKGFFAKY
2i49A           --------------------------------------------IKLGYIPIVEAAPLIIAQEKGFFAKY
2i48A           --------------------------------------------IKLGYIPIVEAAPLIIAQEKGFFAKY


                         .         .         *         .         .         .         .:140
query           GVNVTLKKYSGWSDLWTAYATEQLDVAHMLSPMTVAINAGVTNASRPMELSFTQNTNGQAITLASKHYGS
2g29A           GMDVEVLKQASWGNLVLGSASGGIDGAHILTPMPYLITMGTVTDGKPMYILARLNVNGQGIQLGNKDLKV
2i4bA           GMTVEVSKQANWANVTXXXXXXXXXXXXWQMPMPHLITEGITNGNKPMYVLAQLITQGNGIAVAPMHEGK
2i49A           GMTVEVSKQANWANVTXXXXXXXXXXXXWQMPMPHLITEGITNGNKPMYVLAQLITQGNGIAVAPMHEGK
2i48A           GMTVEVSKQANWANVTXXXXXXXXXXXXWQMPMPHLITEGITNGNKPMYVLAQLITQGNGIAVAPMHEGK


                         +         .         .         .         .         *         .:210
query           VNSAADLKGMVLGIPFEYSVHALLLRDYLASNAVDPIADLKLRLLPPADMVAQLTVEGIAGFIGPEPFNE
2g29A           GTDAAPLKEAFVAMTFPGGTHDMWIRYWLAAGGMEPGKDFSTIVVPPAQMVANVKVNAMESFCVGEPWPL
2i4bA           ITKAADIKGFTNGRKFK-AAHTFWIRYWFAAGGVDPDTDIDLLAVPPAETVQGMRNGTMDAFSTGDPWPY
2i49A           ITKAADIKGFTNGRKFK-AAHTFWIRYWFAAGGVDPDTDIDLLAVPPAETVQGMRNGTMDAFSTGDPWPY
2i48A           ITKAADIKGFTNGRKFK-AAHTFWIRYWFAAGGVDPDTDIDLLAVPPAETVQGMRNGTMDAFSTGDPWPY


                         .         .         .         +         .         .         .:280
query           RAISNGSGRIWLLTKQVWDKHPCCAVAKAKEWKAEHPTAAQGVLNALEEVSAILSNPAQFDSSARTLSQE
2g29A           QTVNQGVGYQALTTGQLWKDHPEKAFGMRADWVDQNPKAAKALLMAVMEAQQWCDQAENKEEMCQILSKR
2i4bA           RIVTENIGYMAGLTAQIWPYHPEEYLAIRADWVDKNPKATKALLKGIMEAQQWIDDPKNRPEVVQIVSGR
2i49A           RIVTENIGYMAGLTAQIWPYHPEEYLAIRADWVDKNPKATKALLKGIMEAQQWIDDPKNRPEVVQIVSGR
2i48A           RIVTENIGYMAGLTAQIWPYHPEEYLAIRADWVDKNPKATKALLKGIMEAQQWIDDPKNRPEVVQIVSGR


                         .         *         .         .         .         .         +:350
query           KYLNQPAALLDGPFSGMYQDWHGQTHTDHERMSFGDPTDPTAIIWMATQIARWGxxxxxxxxxxxxxxxx
2g29A           EWFKVPFEDIIDRSKGIYNFGNGQTFEDQEIMQVDNASYPSHDQWFLTENIRWG----------------
2i4bA           NYFNVPTTILESPFKGQYTMGDGQPAIDYWKDGIGNVSYPSHDLWFLTESIRWG----------------
2i49A           NYFNVPTTILESPFKGQYTMGDGQPAIDYWKDGIGNVSYPSHDLWFLTESIRWG----------------
2i48A           NYFNVPTTILESPFKGQYTMGDGQPAIDYWKDGIGNVSYPSHDLWFLTESIRWG----------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2g29A           -----------------------------------------
2i4bA           -----------------------------------------
2i49A           -----------------------------------------
2i48A           -----------------------------------------