[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF54367.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2c4mC.bssp"
#ERROR : Can't open dsspfile "2c4mB.bssp"
#ERROR : Can't open dsspfile "2c4mA.bssp"
#ERROR : Can't open dsspfile "2zb2B.bssp"
#ERROR : Can't open dsspfile "2zb2A.bssp"
#ERROR : Can't open dsspfile "1xoiA.bssp"
#ERROR : Can't open dsspfile "2qllA.bssp"
#ERROR : Can't open dsspfile "1l7xB.bssp"
#ERROR : Can't open dsspfile "1l5sB.bssp"
#ERROR : Can't open dsspfile "1l5sA.bssp"
#ERROR : Can't open dsspfile "1l5qB.bssp"
#ERROR : Can't open dsspfile "1l5qA.bssp"
#ERROR : Can't open dsspfile "1fc0B.bssp"
#ERROR : Can't open dsspfile "1fc0A.bssp"
#ERROR : Can't open dsspfile "1fa9A.bssp"
#ERROR : Can't open dsspfile "1exvA.bssp"
#ERROR : Can't open dsspfile "1em6A.bssp"
#ERROR : Can't open dsspfile "3ddwB.bssp"
#ERROR : Can't open dsspfile "3ddsB.bssp"
#ERROR : Can't open dsspfile "3ddsA.bssp"
#ERROR : Can't open dsspfile "3dd1B.bssp"
#ERROR : Can't open dsspfile "3cejA.bssp"
#ERROR : Can't open dsspfile "3cehA.bssp"
#ERROR : Can't open dsspfile "2atiA.bssp"
#ERROR : Can't open dsspfile "1z62A.bssp"
#ERROR : Can't open dsspfile "1xc7A.bssp"
#ERROR : Can't open dsspfile "1ww3A.bssp"
#ERROR : Can't open dsspfile "1ww2A.bssp"
#ERROR : Can't open dsspfile "1wutA.bssp"
#ERROR : Can't open dsspfile "1uzuA.bssp"
#ERROR : Can't open dsspfile "1skc-.bssp"
#ERROR : Can't open dsspfile "2qn9A.bssp"
#ERROR : Can't open dsspfile "2qn8A.bssp"
#ERROR : Can't open dsspfile "1pygB.bssp"
#ERROR : Can't open dsspfile "1pygA.bssp"
#ERROR : Can't open dsspfile "1p4gA.bssp"
#ERROR : Can't open dsspfile "1p2dA.bssp"
#ERROR : Can't open dsspfile "1p2bA.bssp"
#ERROR : Can't open dsspfile "1p29A.bssp"
#ERROR : Can't open dsspfile "1nojA.bssp"
#ERROR : Can't open dsspfile "1noiA.bssp"
#ERROR : Can't open dsspfile "1lwnA.bssp"
#ERROR : Can't open dsspfile "1l7xA.bssp"
#ERROR : Can't open dsspfile "1l5rA.bssp"
#ERROR : Can't open dsspfile "1ktiA.bssp"
#ERROR : Can't open dsspfile "1k08A.bssp"
#ERROR : Can't open dsspfile "1k06A.bssp"
#ERROR : Can't open dsspfile "2ieiA.bssp"
#ERROR : Can't open dsspfile "2iegB.bssp"
#ERROR : Can't open dsspfile "2iegA.bssp"
#ERROR : Can't open dsspfile "1h5uA.bssp"
#ERROR : Can't open dsspfile "8gpbA.bssp"
#ERROR : Can't open dsspfile "6gpbA.bssp"
#ERROR : Can't open dsspfile "3gpbA.bssp"
#ERROR : Can't open dsspfile "2gpbA.bssp"
#ERROR : Can't open dsspfile "2gpaA.bssp"
#ERROR : Can't open dsspfile "1gpyA.bssp"
#ERROR : Can't open dsspfile "1gpbA.bssp"
#ERROR : Can't open dsspfile "1gpaB.bssp"
#ERROR : Can't open dsspfile "1gpaA.bssp"
#ERROR : Can't open dsspfile "2gm9A.bssp"
#ERROR : Can't open dsspfile "2gj4A.bssp"
#ERROR : Can't open dsspfile "1gfzA.bssp"
#ERROR : Can't open dsspfile "2fetA.bssp"
#ERROR : Can't open dsspfile "1e1yA.bssp"
#ERROR : Can't open dsspfile "1c8lA.bssp"
#ERROR : Can't open dsspfile "1c8kA.bssp"
#ERROR : Can't open dsspfile "1bx3A.bssp"
#ERROR : Can't open dsspfile "1b4dA.bssp"
#ERROR : Can't open dsspfile "1axrA.bssp"
#ERROR : Can't open dsspfile "2amvA.bssp"
#ERROR : Can't open dsspfile "1abbA.bssp"
#ERROR : Can't open dsspfile "2ieiB.bssp"
#ERROR : Can't open dsspfile "1z8dA.bssp"
#ERROR : Can't open dsspfile "2qrpA.bssp"
#ERROR : Can't open dsspfile "2qrgA.bssp"
#ERROR : Can't open dsspfile "2qnbA.bssp"
#ERROR : Can't open dsspfile "2qn3A.bssp"
#ERROR : Can't open dsspfile "2qn1A.bssp"
#ERROR : Can't open dsspfile "2pyiA.bssp"
#ERROR : Can't open dsspfile "2pydA.bssp"
#ERROR : Can't open dsspfile "2gpnA.bssp"
#ERROR : Can't open dsspfile "2g9vA.bssp"
#ERROR : Can't open dsspfile "2g9uA.bssp"
#ERROR : Can't open dsspfile "2g9qA.bssp"
#ERROR : Can't open dsspfile "3e3oD.bssp"
#ERROR : Can't open dsspfile "3e3oC.bssp"
#ERROR : Can't open dsspfile "3e3oB.bssp"
#ERROR : Can't open dsspfile "3e3oA.bssp"
#ERROR : Can't open dsspfile "3e3nH.bssp"
#ERROR : Can't open dsspfile "3e3nF.bssp"
#ERROR : Can't open dsspfile "3e3nE.bssp"
#ERROR : Can't open dsspfile "3e3nD.bssp"
#ERROR : Can't open dsspfile "3e3nC.bssp"
#ERROR : Can't open dsspfile "3e3nB.bssp"
#ERROR : Can't open dsspfile "3e3nA.bssp"
#ERROR : Can't open dsspfile "3e3lD.bssp"
#ERROR : Can't open dsspfile "3e3lC.bssp"
#ERROR : Can't open dsspfile "3e3lB.bssp"
#ERROR : Can't open dsspfile "3e3lA.bssp"
#ERROR : Can't open dsspfile "3cuvA.bssp"
#ERROR : Can't open dsspfile "1a8iA.bssp"
#ERROR : Can't open dsspfile "1l5wA.bssp"
#ERROR : Can't open dsspfile "1e4oA.bssp"
#ERROR : Can't open dsspfile "2ecpA.bssp"
#ERROR : Can't open dsspfile "1ahpA.bssp"
#ERROR : Can't open dsspfile "1ygpA.bssp"

## Summary of PDB Search
:185
    e-106  98%  2c4mC  [x.x.x] GLYCOGEN PHOSPHORYLASE
    e-105  98%  2c4mB  [x.x.x] GLYCOGEN PHOSPHORYLASE
    e-105  98%  2c4mA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    2e-44  49%  2zb2B  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  2zb2A  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  1xoiA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  2qllA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  1l7xB  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  1l5sB  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  1l5sA  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  1l5qB  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  1l5qA  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  1fc0B  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  1fc0A  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  1fa9A  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  1exvA  [c.87.1] LIVER GLYCOGEN PHOSPHORYLASE
    2e-44  49%  1em6A  [c.87.1] LIVER GLYCOGEN PHOSPHORYLASE
    2e-44  49%  3ddwB  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  3ddsB  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  3ddsA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  3dd1B  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  3cejA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  3cehA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-44  49%  2atiA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    3e-44  50%  1z62A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  1xc7A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  1ww3A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  1ww2A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  1wutA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  1uzuA  [c.87.1] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  1skc-  [x.x.x] PYRIDOXAL PHOSPHORYLASE B
    3e-44  50%  2qn9A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  2qn8A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  1pygB  [c.87.1] GLYCOGEN PHOSPHORYLASE B
    3e-44  50%  1pygA  [c.87.1] GLYCOGEN PHOSPHORYLASE B
    3e-44  50%  1p4gA  [c.87.1] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  1p2dA  [c.87.1] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  1p2bA  [c.87.1] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  1p29A  [c.87.1] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  1nojA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    3e-44  50%  1noiA  [c.87.1] GLYCOGEN PHOSPHORYLASE
    3e-44  50%  1lwnA  [c.87.1] GLYCOGEN PHOSPHORYLASE
    3e-44  49%  1l7xA  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    3e-44  49%  1l5rA  [c.87.1] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    3e-44  50%  1ktiA  [c.87.1] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  1k08A  [c.87.1] GLYCOGEN PHOSPHORYLASE
    3e-44  50%  1k06A  [c.87.1] GLYCOGEN PHOSPHORYLASE
    3e-44  50%  2ieiA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  2iegB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  2iegA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  1h5uA  [c.87.1] GLYCOGEN PHOSPHORYLASE
    3e-44  50%  8gpbA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    3e-44  50%  6gpbA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    3e-44  50%  3gpbA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    3e-44  50%  2gpbA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    3e-44  50%  2gpaA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    3e-44  50%  1gpyA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    3e-44  50%  1gpbA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    3e-44  50%  1gpaB  [c.87.1] GLYCOGEN PHOSPHORYLASE A
    3e-44  50%  1gpaA  [c.87.1] GLYCOGEN PHOSPHORYLASE A
    3e-44  50%  2gm9A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  2gj4A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  1gfzA  [c.87.1] GLYCOGEN PHOSPHORYLASE
    3e-44  50%  2fetA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-44  50%  1e1yA  [c.87.1] GLYCOGEN PHOSPHORYLASE
    3e-44  50%  1c8lA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    3e-44  50%  1c8kA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    3e-44  50%  1bx3A  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)
    3e-44  50%  1b4dA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)
    3e-44  50%  1axrA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    3e-44  50%  2amvA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    3e-44  50%  1abbA  [c.87.1] GLYCOGEN PHOSPHORYLASE B
    4e-43  50%  2ieiB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    2e-42  49%  1z8dA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  2qrpA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  2qrgA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  2qnbA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  2qn3A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  2qn1A  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  2pyiA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  2pydA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  2gpnA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    3e-42  49%  2g9vA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  2g9uA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  2g9qA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  3e3oD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  3e3oC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  3e3oB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  3e3oA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  3e3nH  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  3e3nF  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  3e3nE  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  3e3nD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  3e3nC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  3e3nB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  3e3nA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  3e3lD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  3e3lC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  3e3lB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  3e3lA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  3cuvA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-42  49%  1a8iA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    1e-40  49%  1l5wA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
    1e-40  49%  1e4oA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
    1e-39  49%  2ecpA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
    1e-39  49%  1ahpA  [c.87.1] E.COLI MALTODEXTRIN PHOSPHORYLASE
    8e-31  41%  1ygpA  [c.87.1] YEAST GLYCOGEN PHOSPHORYLASE
:185

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPASDVSEQISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIFGARVEELPALRESYQ
2c4mC           LPASDVSEQISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIFGARVEELPALRESYK
2c4mB           LPASDVSEQISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIFGARVEELPALRESYK
2c4mA           LPASDVSEQISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIFGARVEELPALRESYK
2zb2B           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
2zb2A           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
1xoiA           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
2qllA           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
1l7xB           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
1l5sB           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
1l5sA           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
1l5qB           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
1l5qA           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
1fc0B           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
1fc0A           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
1fa9A           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
1exvA           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
1em6A           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
3ddwB           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
3ddsB           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
3ddsA           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
3dd1B           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
3cejA           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
3cehA           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
2atiA           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
1z62A           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1xc7A           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1ww3A           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1ww2A           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1wutA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1uzuA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1skc-           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2qn9A           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2qn8A           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1pygB           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1pygA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1p4gA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1p2dA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1p2bA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1p29A           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1nojA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1noiA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1lwnA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1l7xA           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
1l5rA           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
1ktiA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1k08A           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1k06A           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2ieiA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2iegB           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2iegA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1h5uA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
8gpbA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
6gpbA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3gpbA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2gpbA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2gpaA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1gpyA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1gpbA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1gpaB           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1gpaA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2gm9A           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2gj4A           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1gfzA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2fetA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1e1yA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1c8lA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1c8kA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1bx3A           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1b4dA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1axrA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2amvA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1abbA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2ieiB           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDNA--
1z8dA           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDKLQRGYN
2qrpA           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2qrgA           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2qnbA           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2qn3A           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2qn1A           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2pyiA           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2pydA           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2gpnA           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2g9vA           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2g9uA           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
2g9qA           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3oD           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3oC           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3oB           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3oA           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3nH           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3nF           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3nE           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3nD           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3nC           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3nB           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3nA           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3lD           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3lC           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3lB           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3lA           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3cuvA           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1a8iA           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
1l5wA           IPAADISEQISTAGKEASGTGNMKLALNGALTVGTLDGANVEIAEKVGEENIFIFGHTVEQVKALAKGYD
1e4oA           IPAADISEQISTAGKEASGTGNMKLALNGALTVGTLDGANVEIAEKVGEENIFIFGHTVEQVKALAKGYD
2ecpA           IPAADISEQISTAGKEASGTGNMKLALNGALTVGTLDGANVEIAEKVGEENIFIFGHTVKQVKALAKGYD
1ahpA           IPAADISEQISTAGKEASGTGNMKLALNGALTVGTLDGANVEIAEKVGEENIFIFGHTVKQVKALAKGYD
1ygpA           IPASDLSEHISTAGTEASGTSNMKFVMNGGLIIGTVDGANVEITREIGEDNVFLFGNLSENVEELRYNHQ


                         .         .         *         .         .         .         .:140
query           PYELYETVPGLKRALDALDNGTLNDNNSGLFYDLKHSLIHGYGKDASDTYYVLGDFADYRETRDRMAADY
2c4mC           PYELYETVPGLKRALDALDNGTLNDNNSGLFYDLKHSLIHGYGKDASDTYYVLGDFADYRETRDRMAADY
2c4mB           PYELYETVPGLKRALDALDNGTLNDNNSGLFYDLKHSLIHGYGKDASDTYYVLGDFADYRETRDRMAADY
2c4mA           PYELYETVPGLKRALDALDNGTLNDNNSGLFYDLKHSLIHGYGKDASDTYYVLGDFADYRETRDRMAADY
2zb2B           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
2zb2A           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
1xoiA           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
2qllA           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
1l7xB           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
1l5sB           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
1l5sA           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
1l5qB           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
1l5qA           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
1fc0B           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
1fc0A           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
1fa9A           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
1exvA           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
1em6A           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
3ddwB           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
3ddsB           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
3ddsA           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
3dd1B           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
3cejA           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
3cehA           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
2atiA           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
1z62A           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1xc7A           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1ww3A           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1ww2A           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1wutA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1uzuA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1skc-           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2qn9A           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2qn8A           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1pygB           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1pygA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1p4gA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1p2dA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1p2bA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1p29A           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1nojA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1noiA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1lwnA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1l7xA           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
1l5rA           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
1ktiA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1k08A           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1k06A           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2ieiA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2iegB           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2iegA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1h5uA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
8gpbA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
6gpbA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
3gpbA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2gpbA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2gpaA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1gpyA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1gpbA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1gpaB           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1gpaA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2gm9A           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2gj4A           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1gfzA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2fetA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1e1yA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1c8lA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1c8kA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1bx3A           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1b4dA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1axrA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2amvA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1abbA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2ieiB           -QEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1z8dA           AQEYYDRIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEDYIKCQEKVSALY
2qrpA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2qrgA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2qnbA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2qn3A           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2qn1A           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2pyiA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2pydA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2gpnA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2g9vA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2g9uA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
2g9qA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
3e3oD           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
3e3oC           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
3e3oB           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
3e3oA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
3e3nH           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
3e3nF           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
3e3nE           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
3e3nD           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
3e3nC           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
3e3nB           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
3e3nA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
3e3lD           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
3e3lC           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
3e3lB           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
3e3lA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
3cuvA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1a8iA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
1l5wA           PVKWRKKDKVLDAVLKELESGKYSDGDKHAFDQMLHSI----GKQGGDPYLVMADFAAYVEAQKQVDVLY
1e4oA           PVKWRKKDKVLDAVLKELESGKYSDGDKHAFDQMLHSI----GKQGGDPYLVMADFAAYVEAQKQVDVLY
2ecpA           PVKWRKKDKVLDAVLKELESGKYSDGDKHAFDQMLHSI----GKQGGDPYLVMADFAAYVEAQKQVDVLY
1ahpA           PVKWRKKDKVLDAVLKELESGKYSDGDKHAFDQMLHSI----GKQGGDPYLVMADFAAYVEAQKQVDVLY
1ygpA           -YHPQDLPSSLDSVLSYIEQ--FSPENPNEFKPLVDSI-----KYHGDYYLVSDDFESYLATHELVDQEF


                         +         .         .         .         .         *         .:210
query           ASDPLGWARMAWINICESGRFSSDRTIRDYATEIWKLKPTPAVKx
2c4mC           ASDPLGWARMAWINICESGRFSSDRTIRDYATEIWKLEPTPAVK-
2c4mB           ASDPLGWARMAWINICESGRFSSDRTIRDYATEIWKLEPTPAV--
2c4mA           ASDPLGWARMAWINICESGRFSSDRTIRDYATEIWKLEPTPA---
2zb2B           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
2zb2A           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
1xoiA           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
2qllA           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
1l7xB           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
1l5sB           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
1l5sA           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
1l5qB           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
1l5qA           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
1fc0B           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
1fc0A           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
1fa9A           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
1exvA           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
1em6A           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
3ddwB           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
3ddsB           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
3ddsA           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
3dd1B           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
3cejA           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
3cehA           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
2atiA           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
1z62A           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1xc7A           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1ww3A           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1ww2A           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1wutA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1uzuA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1skc-           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2qn9A           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2qn8A           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1pygB           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1pygA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1p4gA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1p2dA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1p2bA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1p29A           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1nojA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1noiA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1lwnA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1l7xA           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEP------
1l5rA           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEP------
1ktiA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1k08A           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1k06A           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2ieiA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2iegB           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2iegA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1h5uA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
8gpbA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
6gpbA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
3gpbA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2gpbA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2gpaA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1gpyA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1gpbA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1gpaB           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1gpaA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2gm9A           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2gj4A           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1gfzA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2fetA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1e1yA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1c8lA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1c8kA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1bx3A           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1b4dA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1axrA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2amvA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1abbA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2ieiB           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1z8dA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2qrpA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2qrgA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2qnbA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2qn3A           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2qn1A           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2pyiA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2pydA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2gpnA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2g9vA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2g9uA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
2g9qA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
3e3oD           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
3e3oC           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
3e3oB           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
3e3oA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
3e3nH           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
3e3nF           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
3e3nE           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
3e3nD           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
3e3nC           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
3e3nB           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
3e3nA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
3e3lD           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
3e3lC           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
3e3lB           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
3e3lA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
3cuvA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1a8iA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
1l5wA           -RDQEAWTRAAILNTARCGMFSSDRSIRDYQARIWQAK-------
1e4oA           -RDQEAWTRAAILNTARCGMFSSDRSIRDYQARIWQAK-------
2ecpA           -RDQEAWTRAAILNTARCGMFSSDRSIRDYQARIWQ---------
1ahpA           -RDQEAWTRAAILNTARCGMFSSDRSIRDYQARIWQ---------
1ygpA           HNQRSEWLKKSVLSLANVGFFSSDRCIEEYSDTIWNVEP------