[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF54563.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1lk0A.bssp"
#ERROR : Can't open dsspfile "2cd7A.bssp"
#ERROR : Can't open dsspfile "1ljlA.bssp"
#ERROR : Can't open dsspfile "1rxeA.bssp"
#ERROR : Can't open dsspfile "2fxiA.bssp"
#ERROR : Can't open dsspfile "1jf8A.bssp"
#ERROR : Can't open dsspfile "1z2dA.bssp"
#ERROR : Can't open dsspfile "1jl3A.bssp"
#ERROR : Can't open dsspfile "2ipaB.bssp"
#ERROR : Can't open dsspfile "1jl3D.bssp"
#ERROR : Can't open dsspfile "1jfvA.bssp"
#ERROR : Can't open dsspfile "1jl3C.bssp"

## Summary of PDB Search
:140
    2e-10  31%  1lk0A  [c.44.1] ARSENATE REDUCTASE
    4e-10  30%  2cd7A  [x.x.x] PROTEIN ARSC
    5e-10  31%  1ljlA  [c.44.1] ARSENATE REDUCTASE
    1e-09  30%  1rxeA  [c.44.1] ARSENATE REDUCTASE
    2e-09  30%  2fxiA  [x.x.x] PROTEIN ARSC
    3e-09  30%  1jf8A  [c.44.1] ARSENATE REDUCTASE
    3e-08  29%  1z2dA  [x.x.x] ARSENATE REDUCTASE
    3e-08  29%  1jl3A  [c.44.1] ARSENATE REDUCTASE
    7e-08  28%  2ipaB  [x.x.x] PROTEIN ARSC
    1e-06  31%  1jl3D  [c.44.1] ARSENATE REDUCTASE
    7e-06  29%  1jfvA  [c.44.1] ARSENATE REDUCTASE
    1e-05  30%  1jl3C  [c.44.1] ARSENATE REDUCTASE
:140

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIDQPSVLFVCVGNGGKSQMXXXXXXXXXXXXXEIHSAGTKPGTKLNQQSLESIAEVGADMSQGFPKGID
1lk0A           --DKKTIYFICTGNSCRSQMAEGWGKEILGEGWNVYSAGIETHG-VNPKAIEAMKEVDIDISNHTSDLID
2cd7A           -MDKKTIYFICTGNSCRSQMAEGWGKEILGEGWNVYSAGIET-HGVNPKAIEAMKEVDIDISNQTSDLID
1ljlA           --DKKTIYFICTGNSCRSQMAEGWGKEILGEGWNVYSAGIET-HGVNPKAIEAMKEVDIDISNHTSDLID
1rxeA           -MDKKTIYFISTGNSARSQMAEGWGKEILGEGWNVYSAGIET-HGVNPKAIEAMKEVDIDISNHTSDLID
2fxiA           -MDKKTIYFISTGNSARSQMAEGWGKEILGEGWNVYSAGIET-HGVNPKAIEAMKEVDIDISNHTSDLID
1jf8A           --DKKTIYFISTGNSARSQMAEGWGKEILGEGWNVYSAGIET-HGVNPKAIEAMKEVDIDISNHTSDLID
1z2dA           ------IYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIE-AHGLNPNAVKAMKEVGIDISNQTSDIID
1jl3A           ------IYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIE-AHGLNPNAVKAMKEVGIDISNQTSDIID
2ipaB           ------IYFLSTGNSARSQMAEGWAKQYLGDEWKVYSAGIE-AHGLNPNAVKAMKEVGIDISNQTSDIID
1jl3D           ------IYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIE-AHGLNPNAVKAMKEVGIDISNQTSDIID
1jfvA           -MDKKTIYFISTGNSARSQ-AEGWGKEILGEGWNVYSAGIET-HGVNPKAIEA-KEVDIDISNHTSDLID
1jl3C           ------IYFLCTGNSCRSQMAEGWAKQYLEW--KVYSAGIE-AHGLNPNAVKAMKEVGIDISNQTSDIID


                         .         .         *         .         .         .         .:140
query           LDLIRRVDRVIILGAEAQLEMPINANGTLQRWLTDEPSERGIEGMERMRLVRDDIDARVQxxxxxxxxxx
1lk0A           NDILKQSDLVVTLCSDADNNLPIPPNVKKEHWGFDDPA--GKEWSEFQR-VRDEIKLAIE----------
2cd7A           NDILKQSDLVVTLCSDADNNCPIPPNVKKEHWGFDDPA--GKEWSEFQR-VRDEIKLAIE----------
1ljlA           NDILKQSDLVVTLCSDADNNCPIPPNVKKEHWGFDDPA--GKEWSEFQR-VRDEIKLAIE----------
1rxeA           NDILKQSDLVVTLSSDADNNCPIPPNVKKEHWGFDDPA--GKEWSEFQR-VRDEIKLAIE----------
2fxiA           NDILKQSDLVVTLCSDADNNCPIPPNVKKEHWGFDDPA--GKEWSEFQR-VRDEIKLAIE----------
1jf8A           NDILKQSDLVVTLCSDADNNCPIPPNVKKEHWGFDDPA--GKEWSEFQR-VRDEIKLAIE----------
1z2dA           SDILNNADLVVTLCGDAADKCPMTPHVKREHWGFDDPAR--AQGTEEFQRVRDEIGNRLK----------
1jl3A           SDILNNADLVVTLCGDAADKCPMTPHVKREHWGFDDPAR--AQGTEEFQRVRDEIGNRLK----------
2ipaB           SDILNNADLVVTLSGDAADKCPMTPHVKREHWGFDDPAR--AQGTEEFQRVRDEIGNRLK----------
1jl3D           SDILNNADLVVTLGVKREFDDPARAQGT------------------------------------------
1jfvA           NDILKQSDLVVTLCSDADNNCPIPPNVKKEHWGFDDPA--GKEWSEFQR-VRDEIKLAIE----------
1jl3C           SDILNNADLVVTLCVKREFDDPARAQGT------------------------------------------