[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF54728.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1snfC.bssp"
#ERROR : Can't open dsspfile "1snfB.bssp"
#ERROR : Can't open dsspfile "1smcB.bssp"
#ERROR : Can't open dsspfile "1smcA.bssp"
#ERROR : Can't open dsspfile "1sm8B.bssp"
#ERROR : Can't open dsspfile "1slhC.bssp"
#ERROR : Can't open dsspfile "1slhB.bssp"
#ERROR : Can't open dsspfile "1slhA.bssp"
#ERROR : Can't open dsspfile "1sjnC.bssp"
#ERROR : Can't open dsspfile "1sjnB.bssp"
#ERROR : Can't open dsspfile "1sjnA.bssp"
#ERROR : Can't open dsspfile "1sixA.bssp"
#ERROR : Can't open dsspfile "2py4A.bssp"
#ERROR : Can't open dsspfile "1mq7A.bssp"
#ERROR : Can't open dsspfile "3ehwB.bssp"
#ERROR : Can't open dsspfile "3ehwA.bssp"
#ERROR : Can't open dsspfile "3c3iB.bssp"
#ERROR : Can't open dsspfile "2hquA.bssp"
#ERROR : Can't open dsspfile "1q5hC.bssp"
#ERROR : Can't open dsspfile "1q5hB.bssp"
#ERROR : Can't open dsspfile "3c3iD.bssp"
#ERROR : Can't open dsspfile "3c3iA.bssp"
#ERROR : Can't open dsspfile "3ca9B.bssp"
#ERROR : Can't open dsspfile "3ca9A.bssp"
#ERROR : Can't open dsspfile "3c2tB.bssp"
#ERROR : Can't open dsspfile "3c2tA.bssp"
#ERROR : Can't open dsspfile "1q5uZ.bssp"
#ERROR : Can't open dsspfile "1q5uY.bssp"
#ERROR : Can't open dsspfile "1q5uX.bssp"
#ERROR : Can't open dsspfile "1q5hA.bssp"
#ERROR : Can't open dsspfile "2hquC.bssp"
#ERROR : Can't open dsspfile "3hhqW.bssp"
#ERROR : Can't open dsspfile "3hhqM.bssp"
#ERROR : Can't open dsspfile "3hhqL.bssp"
#ERROR : Can't open dsspfile "3hhqG.bssp"
#ERROR : Can't open dsspfile "3hhqF.bssp"
#ERROR : Can't open dsspfile "3hhqC.bssp"
#ERROR : Can't open dsspfile "3f4fC.bssp"
#ERROR : Can't open dsspfile "3f4fA.bssp"
#ERROR : Can't open dsspfile "3hhqK.bssp"
#ERROR : Can't open dsspfile "3hhqI.bssp"
#ERROR : Can't open dsspfile "3hhqD.bssp"
#ERROR : Can't open dsspfile "3hhqB.bssp"
#ERROR : Can't open dsspfile "3hhqA.bssp"
#ERROR : Can't open dsspfile "1f7rA.bssp"
#ERROR : Can't open dsspfile "2p9oC.bssp"
#ERROR : Can't open dsspfile "2p9oB.bssp"
#ERROR : Can't open dsspfile "2p9oA.bssp"
#ERROR : Can't open dsspfile "1sehA.bssp"
#ERROR : Can't open dsspfile "1rn8A.bssp"
#ERROR : Can't open dsspfile "2hr6A.bssp"
#ERROR : Can't open dsspfile "1dupA.bssp"
#ERROR : Can't open dsspfile "1sylA.bssp"
#ERROR : Can't open dsspfile "1rnjA.bssp"
#ERROR : Can't open dsspfile "2ol1C.bssp"
#ERROR : Can't open dsspfile "2ol1A.bssp"
#ERROR : Can't open dsspfile "2okdB.bssp"
#ERROR : Can't open dsspfile "2okdA.bssp"
#ERROR : Can't open dsspfile "1f7oC.bssp"
#ERROR : Can't open dsspfile "1f7oA.bssp"
#ERROR : Can't open dsspfile "1f7dA.bssp"
#ERROR : Can't open dsspfile "1dutA.bssp"
#ERROR : Can't open dsspfile "2okbA.bssp"
#ERROR : Can't open dsspfile "2d4nA.bssp"
#ERROR : Can't open dsspfile "3ecyA.bssp"
#ERROR : Can't open dsspfile "2d4mA.bssp"
#ERROR : Can't open dsspfile "2d4lA.bssp"
#ERROR : Can't open dsspfile "1vyqB.bssp"
#ERROR : Can't open dsspfile "2bazA.bssp"
#ERROR : Can't open dsspfile "1vyqA.bssp"
#ERROR : Can't open dsspfile "1vyqC.bssp"
#ERROR : Can't open dsspfile "2hxdA.bssp"
#ERROR : Can't open dsspfile "3gf0A.bssp"

## Summary of PDB Search
:149
    7e-41  70%  1snfC  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    7e-41  70%  1snfB  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    7e-41  70%  1smcB  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    7e-41  70%  1smcA  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    7e-41  70%  1sm8B  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    7e-41  70%  1slhC  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    7e-41  70%  1slhB  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    7e-41  70%  1slhA  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    7e-41  70%  1sjnC  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    7e-41  70%  1sjnB  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    7e-41  70%  1sjnA  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    7e-41  70%  1sixA  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    7e-41  70%  2py4A  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    7e-41  70%  1mq7A  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    1e-22  41%  3ehwB  [x.x.x] DUTP PYROPHOSPHATASE
    1e-22  41%  3ehwA  [x.x.x] DUTP PYROPHOSPHATASE
    1e-21  39%  3c3iB  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    2e-21  41%  2hquA  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    2e-20  39%  1q5hC  [b.85.4] DUTP PYROPHOSPHATASE
    2e-20  39%  1q5hB  [b.85.4] DUTP PYROPHOSPHATASE
    5e-20  43%  3c3iD  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    5e-20  43%  3c3iA  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    3e-19  40%  3ca9B  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    3e-19  40%  3ca9A  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    3e-19  40%  3c2tB  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    3e-19  40%  3c2tA  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    8e-19  42%  1q5uZ  [b.85.4] DUTP PYROPHOSPHATASE
    8e-19  42%  1q5uY  [b.85.4] DUTP PYROPHOSPHATASE
    8e-19  42%  1q5uX  [b.85.4] DUTP PYROPHOSPHATASE
    8e-19  42%  1q5hA  [b.85.4] DUTP PYROPHOSPHATASE
    8e-19  42%  2hquC  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    2e-17  38%  3hhqW  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    2e-17  38%  3hhqM  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    2e-17  38%  3hhqL  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    2e-17  38%  3hhqG  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    2e-17  38%  3hhqF  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    2e-17  38%  3hhqC  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    2e-17  38%  3f4fC  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    2e-17  38%  3f4fA  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    9e-17  43%  3hhqK  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    9e-17  43%  3hhqI  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    9e-17  43%  3hhqD  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    9e-17  43%  3hhqB  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    9e-17  43%  3hhqA  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    3e-16  39%  1f7rA  [b.85.4] POL POLYPROTEIN
    4e-16  37%  2p9oC  [x.x.x] DUTP PYROPHOSPHATASE-LIKE PROTEIN
    4e-16  37%  2p9oB  [x.x.x] DUTP PYROPHOSPHATASE-LIKE PROTEIN
    4e-16  37%  2p9oA  [x.x.x] DUTP PYROPHOSPHATASE-LIKE PROTEIN
    3e-15  42%  1sehA  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    3e-15  42%  1rn8A  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    3e-15  42%  2hr6A  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    3e-15  42%  1dupA  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    1e-14  41%  1sylA  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    1e-14  41%  1rnjA  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    2e-13  35%  2ol1C  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    2e-13  35%  2ol1A  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    2e-13  35%  2okdB  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    2e-13  35%  2okdA  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    2e-12  41%  1f7oC  [b.85.4] POL POLYPROTEIN
    2e-12  41%  1f7oA  [b.85.4] POL POLYPROTEIN
    2e-12  41%  1f7dA  [b.85.4] POL POLYPROTEIN
    2e-12  41%  1dutA  [b.85.4] DUTP PYROPHOSPHATASE
    3e-12  38%  2okbA  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    5e-11  41%  2d4nA  [x.x.x] DU
    4e-10  34%  3ecyA  [x.x.x] CG4584-PA, ISOFORM A (BCDNA.LD08534)
    5e-10  41%  2d4mA  [x.x.x] DU
    5e-10  41%  2d4lA  [x.x.x] DU
    7e-10  42%  1vyqB  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    1e-09  33%  2bazA  [x.x.x] HYPOTHETICAL PROTEIN BSU20020
    3e-09  39%  1vyqA  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    9e-09  39%  1vyqC  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    4e-04  34%  2hxdA  [x.x.x] DCTP DEAMINASE, DUMP-FORMING
    0.001  34%  3gf0A  [x.x.x] DCTP DEAMINASE, DUMP-FORMING
:149

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLA
1snfC           ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
1snfB           ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
1smcB           ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
1smcA           ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
1sm8B           ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
1slhC           ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
1slhB           ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
1slhA           ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
1sjnC           ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
1sjnB           ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
1sjnA           ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
1sixA           ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
2py4A           ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
1mq7A           ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
3ehwB           ------LRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLA
3ehwA           ------LRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLA
3c3iB           --------VKKLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLA
2hquA           ------LRFARLSEHATAPTRRA---AGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLA
1q5hC           ------LRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLA
1q5hB           ------LRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLA
3c3iD           --------VKKLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLA
3c3iA           --------VKKLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLA
3ca9B           ---MSSLLVKKLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLA
3ca9A           ---MSSLLVKKLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLA
3c2tB           ---MSSLLVKKLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLA
3c2tA           ---MSSLLVKKLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLA
1q5uZ           ------LRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLA
1q5uY           ------LRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLA
1q5uX           ------LRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLA
1q5hA           ------LRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLA
2hquC           ------LRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLA
3hhqW           ------LKIQLRSASATVPTKGSATAAGYDIYASQDITIPAMGQGMVSTDISFTVPVGTYGRIAPRSGLA
3hhqM           ------LKIQLRSASATVPTKGSATAAGYDIYASQDITIPAMGQGMVSTDISFTVPVGTYGRIAPRSGLA
3hhqL           ------LKIQLRSASATVPTKGSATAAGYDIYASQDITIPAMGQGMVSTDISFTVPVGTYGRIAPRSGLA
3hhqG           ------LKIQLRSASATVPTKGSATAAGYDIYASQDITIPAMGQGMVSTDISFTVPVGTYGRIAPRSGLA
3hhqF           ------LKIQLRSASATVPTKGSATAAGYDIYASQDITIPAMGQGMVSTDISFTVPVGTYGRIAPRSGLA
3hhqC           ------LKIQLRSASATVPTKGSATAAGYDIYASQDITIPAMGQGMVSTDISFTVPVGTYGRIAPRSGLA
3f4fC           ------LKIQLRSASATVPTKGSATAAGYDIYASQDITIPAMGQGMVSTDISFTVPVGTYGRIAPRSGLA
3f4fA           ------LKIQLRSASATVPTKGSATAAGYDIYASQDITIPAMGQGMVSTDISFTVPVGTYGRIAPRSGLA
3hhqK           --------------------------AGYDIYASQDITIPAMGQGMVSTDISFTVPVGTYGRIAPRSGLA
3hhqI           --------------------------AGYDIYASQDITIPAMGQGMVSTDISFTVPVGTYGRIAPRSGLA
3hhqD           --------------------------AGYDIYASQDITIPAMGQGMVSTDISFTVPVGTYGRIAPRSGLA
3hhqB           --------------------------AGYDIYASQDITIPAMGQGMVSTDISFTVPVGTYGRIAPRSGLA
3hhqA           --------------------------AGYDIYASQDITIPAMGQGMVSTDISFTVPVGTYGRIAPRSGLA
1f7rA           -----------------LDKRSE--DAGYDLLAAKEIHLLPGEVKVIPTGVKLMLPKGYWGLIIGKSSIG
2p9oC           -------KVKKLSEKAVIPTRGSPLSAGYDLSSAVDSKVPARGKALIPTDLSIAVPEGTYARIAPRSGLA
2p9oB           -------KVKKLSEKAVIPTRGSPLSAGYDLSSAVDSKVPARGKALIPTDLSIAVPEGTYARIAPRSGLA
2p9oA           -------KVKKLSEKAVIPTRGSPLSAGYDLSSAVDSKVPARGKALIPTDLSIAVPEGTYARIAPRSGLA
1sehA           ----------RVGKEFPLPTYATSGSAGLDLRACNDAVLAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
1rn8A           ----------RVGKEFPLPTYATSGSAGLDLRACNDAVLAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
2hr6A           ----------RVGKEFPLPTYATSGSAGLDLRACNDAVLAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
1dupA           ----------RVGKEFPLPTYATSGSAGLDLRACNDAVLAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
1sylA           ----------RVGKEFPLPTYATSGSAGLDLRACNDAVLAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
1rnjA           ----------RVGKEFPLPTYATSGSAGLDLRACNDAVLAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
2ol1C           ----SPVRFVKETNRAKSPTRQSPGAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLS
2ol1A           ----SPVRFVKETNRAKSPTRQSPGAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLS
2okdB           -----PVRFVKETNRAKSPTRQSPGAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLS
2okdA           -----PVRFVKETNRAKSPTRQSPGAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLS
1f7oC           -----------------LDKRSE--DAGYDLLAAKEIHLLPGEVKVIPTGVKLMLPKGYWGLIIGKSSIG
1f7oA           -----------------LDKRSE--DAGYDLLAAKEIHLLPGEVKVIPTGVKLMLPKGYWGLIIGKSSIG
1f7dA           -----------------LDKRSE--DAGYDLLAAKEIHLLPGEVKVIPTGVKLMLPKGYWGLIIGKSSIG
1dutA           -----------------LDKRSE--DAGYDLLAAKEIHLLPGEVKVIPTGVKLMLPKGYWGLIIGKSSIG
2okbA           ------------------PTRQSPGAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLS
2d4nA           --------------------RATPGSAGLDLCSTSHTVLTPEMGQALSTGIYGPLPPNTFGLILGRSSIT
3ecyA           ------LRFAKLTENALEPVRGSAKAAGVDLRSAYDVVVPARGKAIVKTDLQVQVPEGSYGRVAPRF---
2d4mA           --------------------RATPGSAGLDL-STSHTVLTPEGPQALSTGIYGPLPPNTFGLILGRSSIT
2d4lA           --------------------RATPGSAGLDL-STSHTVLTPEGPQALSTGIYGPLPPNTFGLILGRSSIT
1vyqB           -------------------KTHHEGDSGLDLFIVKDEVLKPKSTTFVKLGIAIALQVNTSFLLFPRSSI-
2bazA           ------IKIKYLDETQTRINKMEQGD-WIDLRAAEDVAIKKDEFKLVPLGVAMELPEGYEAHVVPRSSTY
1vyqA           ------LKIVCLSDEVREMYKNHKTDSGLDLFIVKDEVLKPKSTTFVKLGIAIALQVNTSFLLFPRSSIS
1vyqC           ------LKIVCLSDEVREMYKNHKTDSGLDLFIVKDEVLKPKSTTFVKLGIAIALQVNTSFLLFPRSSIS
2hxdA           ----------------------------------------------------IELPNDISAQYQGRSSLG
3gf0A           ----------------------------------------------------IELPNDISAQYQGRSSLG


                         .         .         *         .         .         .         .:140
query           AREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGDQ
1snfC           TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
1snfB           TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
1smcB           TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
1smcA           TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
1sm8B           TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
1slhC           TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
1slhB           TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
1slhA           TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
1sjnC           TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
1sjnB           TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
1sjnA           TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
1sixA           TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
2py4A           TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
1mq7A           TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
3ehwB           AKHFIDV--GAGVIDEDYRGNVGVVLFNFGKEK-FEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSG
3ehwA           AKHFIDV--GAGVIDEDYRGNVGVVLFNFGKEK-FEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSG
3c3iB           YKYGIDVL--AGVIDSDYRGEVKVILYN-TTERDYIIKKGDRIAQLILEQIVTPGVAVVLDLSDTARGSG
2hquA           AKHFIDV--GAGVIDEDYRGNVGVVLFNFGKEK-FEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSG
1q5hC           AKHFIDV--GAGVIDEDYRGNVGVVLFNFGKEK-FEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSG
1q5hB           AKHFIDV--GAGVIDEDYRGNVGVVLFNFGKEK-FEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSG
3c3iD           YKYGIDVL--AGVIDSDYRGEVKVILYN-TTERDYIIKKGDRIAQLILEQ--------------------
3c3iA           YKYGIDVL--AGVIDSDYRGEVKVILYN-TTERDYIIKKGDRIAQLILEQ--------------------
3ca9B           YKYGIDVL--AGVIDEDYTGEVKVILYN-TTERDYIIKKGDRIAQLILEQ--------------------
3ca9A           YKYGIDVL--AGVIDEDYTGEVKVILYN-TTERDYIIKKGDRIAQLILEQ--------------------
3c2tB           YKYGIDVL--AGVIDEDYTGEVKVILYN-TTERDYIIKKGDRIAQLILEQ--------------------
3c2tA           YKYGIDVL--AGVIDEDYTGEVKVILYN-TTERDYIIKKGDRIAQLILEQ--------------------
1q5uZ           AKHFIDV--GAGVIDEDYRGNVGVVLFNFGKEK-FEVKKGDRIAQLICER--------------------
1q5uY           AKHFIDV--GAGVIDEDYRGNVGVVLFNFGKEK-FEVKKGDRIAQLICER--------------------
1q5uX           AKHFIDV--GAGVIDEDYRGNVGVVLFNFGKEK-FEVKKGDRIAQLICER--------------------
1q5hA           AKHFIDV--GAGVIDEDYRGNVGVVLFNFGKEK-FEVKKGDRIAQLICER--------------------
2hquC           AKHFIDV--GAGVIDEDYRGNVGVVLFNFGKEK-FEVKKGDRIAQLICER--------------------
3hhqW           VKNG--IQTGAGVVDRDYTGEVKVVLFN-HSQRDFAIKKGDRVAQLILEK--------------------
3hhqM           VKNG--IQTGAGVVDRDYTGEVKVVLFN-HSQRDFAIKKGDRVAQLILEK--------------------
3hhqL           VKNG--IQTGAGVVDRDYTGEVKVVLFN-HSQRDFAIKKGDRVAQLILEK--------------------
3hhqG           VKNG--IQTGAGVVDRDYTGEVKVVLFN-HSQRDFAIKKGDRVAQLILEK--------------------
3hhqF           VKNG--IQTGAGVVDRDYTGEVKVVLFN-HSQRDFAIKKGDRVAQLILEK--------------------
3hhqC           VKNG--IQTGAGVVDRDYTGEVKVVLFN-HSQRDFAIKKGDRVAQLILEK--------------------
3f4fC           VKNG--IQTGAGVVDRDYTGEVKVVLFN-HSQRDFAIKKGDRVAQLILEK--------------------
3f4fA           VKNG--IQTGAGVVDRDYTGEVKVVLFN-HSQRDFAIKKGDRVAQLILEK--------------------
3hhqK           VKNG--IQTGAGVVDRDYTGEVKVVLFN-HSQRDFAIKKGDRVAQLILEK--------------------
3hhqI           VKNG--IQTGAGVVDRDYTGEVKVVLFN-HSQRDFAIKKGDRVAQLILEK--------------------
3hhqD           VKNG--IQTGAGVVDRDYTGEVKVVLFN-HSQRDFAIKKGDRVAQLILEK--------------------
3hhqB           VKNG--IQTGAGVVDRDYTGEVKVVLFN-HSQRDFAIKKGDRVAQLILEK--------------------
3hhqA           VKNG--IQTGAGVVDRDYTGEVKVVLFN-HSQRDFAIKKGDRVAQLILEK--------------------
1f7rA           SK-GLDVLG--GVIDEGYRGEIGVIMINVS-RKSITLMERQKIAQLIILPCKHEVLEQGKVVMDSERGDN
2p9oC           WKHSIDV--GAGVIDADYRGPVGVILFN-HSDADFEVKFGDRIAQLIIEK--------------------
2p9oB           WKHSIDV--GAGVIDADYRGPVGVILFN-HSDADFEVKFGDRIAQLIIEK--------------------
2p9oA           WKHSIDV--GAGVIDADYRGPVGVILFN-HSDADFEVKFGDRIAQLIIEK--------------------
1sehA           HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMI-----------------------
1rn8A           HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMI-----------------------
2hr6A           HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMI-----------------------
1dupA           HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMI-----------------------
1sylA           HKHGIVLGNLVGLINSDYQGQLMISVWNRGQDS-FTIQPGERIAQMI-----------------------
1rnjA           HKHGIVLGNLVGLINSDYQGQLMISVWNRGQDS-FTIQPGERIAQMI-----------------------
2ol1C           LK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQR--------------------
2ol1A           LK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQR--------------------
2okdB           LK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQR--------------------
2okdA           LK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQR--------------------
1f7oC           SK-GLDVLG--GVIDEGYRGEIGVIMINVS-RKSITLMERQKIAQLII----------------------
1f7oA           SK-GLDVLG--GVIDEGYRGEIGVIMINVS-RKSITLMERQKIAQLII----------------------
1f7dA           SK-GLDVLG--GVIDEGYRGEIGVIMINVS-RKSITLMERQKIAQLII----------------------
1dutA           SK-GLDVLG--GVIDEGYRGEIGVIMINVS-RKSITLMERQKIAQLII----------------------
2okbA           LK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQR--------------------
2d4nA           MK-GLQVY--PGVIDNDYTGEIKIMAKAVN--NIVTVSQGNRIAQLIL----------------------
3ecyA           ------IDVGAGVVDEDYRGNLGVVLFN-HSDVDFEVKHGDRIAQFICER--------------------
2d4mA           MK-GLQVY--PGVIDNDYTGEIKIMAKAVN--NIVTVSQGNRIAQLIL----------------------
2d4lA           MK-GLQVY--PGVIDNDYTGEIKIMAKAVN--NIVTVSQGNRIAQLIL----------------------
1vyqB           SKTPLRLANSIGLIDAGYRGEIIAALDNTS-DQEYHIKKNDKLVQLV-----------------------
2bazA           KNFGVIQTNSMGVIDESYKGDNDFWFFPAYALRDTKIKKGDRICQFRIMK--------------------
1vyqA           -KTPLRLANSIGLIDAGYRGEIIAALDNTS-DQEYHIKKNDKLVQLV-----------------------
1vyqC           -KTPLRLANSIGLIDAGYRGEIIAALDNTS-DQEYHIKKNDKLVQLV-----------------------
2hxdA           -RVFLTSHQTAGWIDAGFKGKITLAIVAFD--KPVILYKNQRIGQLIFSK--------------------
3gf0A           -RVFLTSHQTAGWIDAGFKGKITLQIVAFD--KPVILYKNQRIGQLIFSK--------------------


                         +         .         .         .         .         *         .:210
query           GYGSTGKxx
1snfC           ---------
1snfB           ---------
1smcB           ---------
1smcA           ---------
1sm8B           ---------
1slhC           ---------
1slhB           ---------
1slhA           ---------
1sjnC           ---------
1sjnB           ---------
1sjnA           ---------
1sixA           ---------
2py4A           ---------
1mq7A           ---------
3ehwB           GFGSTGK--
3ehwA           GFGSTGK--
3c3iB           GFG------
2hquA           GFGSTGK--
1q5hC           GFG------
1q5hB           GFG------
3c3iD           ---------
3c3iA           ---------
3ca9B           ---------
3ca9A           ---------
3c2tB           ---------
3c2tA           ---------
1q5uZ           ---------
1q5uY           ---------
1q5uX           ---------
1q5hA           ---------
2hquC           ---------
3hhqW           ---------
3hhqM           ---------
3hhqL           ---------
3hhqG           ---------
3hhqF           ---------
3hhqC           ---------
3f4fC           ---------
3f4fA           ---------
3hhqK           ---------
3hhqI           ---------
3hhqD           ---------
3hhqB           ---------
3hhqA           ---------
1f7rA           GYGSTG---
2p9oC           ---------
2p9oB           ---------
2p9oA           ---------
1sehA           ---------
1rn8A           ---------
2hr6A           ---------
1dupA           ---------
1sylA           ---------
1rnjA           ---------
2ol1C           ---------
2ol1A           ---------
2okdB           ---------
2okdA           ---------
1f7oC           ---------
1f7oA           ---------
1f7dA           ---------
1dutA           ---------
2okbA           ---------
2d4nA           ---------
3ecyA           ---------
2d4mA           ---------
2d4lA           ---------
1vyqB           ---------
2bazA           ---------
1vyqA           ---------
1vyqC           ---------
2hxdA           ---------
3gf0A           ---------