[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF54831.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1mwxB.bssp"
#ERROR : Can't open dsspfile "1vqqB.bssp"
#ERROR : Can't open dsspfile "1mwxA.bssp"
#ERROR : Can't open dsspfile "1vqqA.bssp"
#ERROR : Can't open dsspfile "1mwsB.bssp"
#ERROR : Can't open dsspfile "1mwuA.bssp"
#ERROR : Can't open dsspfile "1mwtB.bssp"
#ERROR : Can't open dsspfile "1mwsA.bssp"
#ERROR : Can't open dsspfile "1mwtA.bssp"
#ERROR : Can't open dsspfile "1mwrB.bssp"
#ERROR : Can't open dsspfile "1mwrA.bssp"
#ERROR : Can't open dsspfile "1mwuB.bssp"
#ERROR : Can't open dsspfile "1rp5B.bssp"
#ERROR : Can't open dsspfile "1rp5A.bssp"
#ERROR : Can't open dsspfile "2zc4E.bssp"
#ERROR : Can't open dsspfile "2z2mE.bssp"
#ERROR : Can't open dsspfile "2z2mB.bssp"
#ERROR : Can't open dsspfile "1pyyA.bssp"
#ERROR : Can't open dsspfile "2zc3B.bssp"
#ERROR : Can't open dsspfile "2z2lB.bssp"
#ERROR : Can't open dsspfile "1qmfA.bssp"
#ERROR : Can't open dsspfile "1qmeA.bssp"
#ERROR : Can't open dsspfile "1k25D.bssp"
#ERROR : Can't open dsspfile "1k25B.bssp"
#ERROR : Can't open dsspfile "3eqvA.bssp"
#ERROR : Can't open dsspfile "3equA.bssp"
#ERROR : Can't open dsspfile "3eqvB.bssp"
#ERROR : Can't open dsspfile "2hq8B.bssp"
#ERROR : Can't open dsspfile "2hq8A.bssp"
#ERROR : Can't open dsspfile "3equB.bssp"

## Summary of PDB Search
:622
    1e-18  23%  1mwxB  [x.x.x] PENICILLIN-BINDING PROTEIN MECA, LOW-AFFINITY
    1e-18  23%  1vqqB  [d.17.4 - d.175.1 - e.3.1] PENICILLIN-BINDING PROTEIN MECA,
    2e-18  23%  1mwxA  [x.x.x] PENICILLIN-BINDING PROTEIN MECA, LOW-AFFINITY
    3e-18  23%  1vqqA  [d.17.4 - d.175.1 - e.3.1] PENICILLIN-BINDING PROTEIN MECA,
    4e-16  24%  1mwsB  [d.17.4 - d.175.1 - e.3.1] PENICILLIN-BINDING PROTEIN 2A
    7e-16  24%  1mwuA  [d.17.4 - d.175.1 - e.3.1] PENICILLIN-BINDING PROTEIN 2A
    3e-15  24%  1mwtB  [d.17.4 - d.175.1 - e.3.1] PENICILLIN-BINDING PROTEIN 2A
    6e-15  23%  1mwsA  [d.17.4 - d.175.1 - e.3.1] PENICILLIN-BINDING PROTEIN 2A
    7e-15  23%  1mwtA  [d.17.4 - d.175.1 - e.3.1] PENICILLIN-BINDING PROTEIN 2A
    2e-14  23%  1mwrB  [d.17.4 - d.175.1 - e.3.1] PENICILLIN-BINDING PROTEIN 2A
    6e-14  24%  1mwrA  [d.17.4 - d.175.1 - e.3.1] PENICILLIN-BINDING PROTEIN 2A
    9e-13  24%  1mwuB  [d.17.4 - d.175.1 - e.3.1] PENICILLIN-BINDING PROTEIN 2A
    3e-10  24%  1rp5B  [d.175.1 - e.3.1 - d.11.1 - d.11.1] PENICILLIN-BINDING
    9e-10  25%  1rp5A  [d.175.1 - e.3.1 - d.11.1 - d.11.1] PENICILLIN-BINDING
    3e-07  27%  2zc4E  [x.x.x] PENICILLIN-BINDING PROTEIN 2X
    7e-07  27%  2z2mE  [x.x.x] PENICILLIN-BINDING PROTEIN 2X
    1e-06  27%  2z2mB  [x.x.x] PENICILLIN-BINDING PROTEIN 2X
    1e-06  28%  1pyyA  [d.175.1 - e.3.1 - d.11.1 - d.11.1] PENICILLIN-BINDING
    1e-06  28%  2zc3B  [x.x.x] PENICILLIN-BINDING PROTEIN 2X
    1e-06  28%  2z2lB  [x.x.x] PENICILLIN-BINDING PROTEIN 2X
    1e-06  28%  1qmfA  [d.175.1 - e.3.1 - d.11.1 - d.11.1] PENICILLIN-BINDING
    1e-06  28%  1qmeA  [d.175.1 - e.3.1 - d.11.1 - d.11.1] PENICILLIN-BINDING
    1e-06  25%  1k25D  [d.175.1 - e.3.1 - d.11.1 - d.11.1] LOW-AFFINITY
    1e-06  25%  1k25B  [d.175.1 - e.3.1 - d.11.1 - d.11.1] LOW-AFFINITY
    8e-06  31%  3eqvA  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    1e-05  34%  3equA  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    2e-05  34%  3eqvB  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    3e-05  38%  2hq8B  [x.x.x] COELENTERAZINE-BINDING PROTEIN CA-BOUND APO FORM
    3e-05  38%  2hq8A  [x.x.x] COELENTERAZINE-BINDING PROTEIN CA-BOUND APO FORM
    4e-05  37%  3equB  [x.x.x] PENICILLIN-BINDING PROTEIN 2
:622

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1mwxB           ----------------------------------------------------------------------
1vqqB           ----------------------------------------------------------------------
1mwxA           ----------------------------------------------------------------------
1vqqA           ----------------------------------------------------------------------
1mwsB           ----------------------------------------------------------------------
1mwuA           ----------------------------------------------------------------------
1mwtB           ----------------------------------------------------------------------
1mwsA           ----------------------------------------------------------------------
1mwtA           ----------------------------------------------------------------------
1mwrB           ----------------------------------------------------------------------
1mwrA           ----------------------------------------------------------------------
1mwuB           ----------------------------------------------------------------------
1rp5B           ----------------------------------------------------------------------
1rp5A           ----------------------------------------------------------------------
2zc4E           ----------------------------------------------------------------------
2z2mE           ----------------------------------------------------------------------
2z2mB           ----------------------------------------------------------------------
1pyyA           ----------------------------------------------------------------------
2zc3B           ----------------------------------------------------------------------
2z2lB           ----------------------------------------------------------------------
1qmfA           ----------------------------------------------------------------------
1qmeA           ----------------------------------------------------------------------
1k25D           ----------------------------------------------------------------------
1k25B           ----------------------------------------------------------------------
3eqvA           ----------------------------------------------------------------------
3equA           ----------------------------------------------------------------------
3eqvB           ----------------------------------------------------------------------
2hq8B           ----------------------------------------------------------------------
2hq8A           ----------------------------------------------------------------------
3equB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDREVSYDSSMTLTKMRNEWTVRWEPSLVHPKLGANQ
1mwxB           ----------------------------------DRNVQFN----FVKEDGMWKLDWDHSVIIPGMQKDQ
1vqqB           ----------------------------------DRNVQFN----FVKEDGMWKLDWDHSVIIPGMQKDQ
1mwxA           ----------------------------------DRNVQFN----FVKEDGMWKLDWDHSVIIPGMQKDQ
1vqqA           ----------------------------------DRNVQFN----FVKEDGMWKLDWDHSVIIPGMQKDQ
1mwsB           ----------------------------------DRNVQFN----FVKEDGMWKLDWDHSVIIPGMQKDQ
1mwuA           ----------------------------------DRNVQFN----FVKEDGMWKLDWDHSVIIPGMQKDQ
1mwtB           ----------------------------------DRNVQFN----FVKEDGMWKLDWDHSVIIPGMQKDQ
1mwsA           ----------------------------------DRNVQFN----FVKEDGMWKLDWDHSVIIPGMQKDQ
1mwtA           ----------------------------------DRNVQFN----FVKEDGMWKLDWDHSVIIPGMQKDQ
1mwrB           ----------------------------------------------------WKLDWDHSVIIPGQ-KDQ
1mwrA           ----------------------------------------------------WKLDWDHSVIIPGQ-KDQ
1mwuB           ----------------------------------DRNVQFN----FVKEDGMWKLDWDHSVIIPGMQKDQ
1rp5B           ----------------------------------------------------------------------
1rp5A           ----------------------------------------------------------------------
2zc4E           ----------------------------------------------------------------------
2z2mE           ----------------------------------------------------------------------
2z2mB           ----------------------------------------------------------------------
1pyyA           ----------------------------------------------------------------------
2zc3B           ----------------------------------------------------------------------
2z2lB           ----------------------------------------------------------------------
1qmfA           ----------------------------------------------------------------------
1qmeA           ----------------------------------------------------------------------
1k25D           ----------------------------------------------------------------------
1k25B           ----------------------------------------------------------------------
3eqvA           ----------------------------------------------------------------------
3equA           ----------------------------------------------------------------------
3eqvB           ----------------------------------------------------------------------
2hq8B           ----------------------------------------------------------------------
2hq8A           ----------------------------------------------------------------------
3equB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           HLELRAIEAQRANVISSDGAPVLAPGSIYRVLADPSAGDADVVVKRVADYLNEAHATDENVNTLDVEDIM
1mwxB           SIHIENLKSERGKILDRNNVELANTGTAYEIGIVPSKKDYKAIAKELSDYIKQ--QMDQNKTVKKMDEYL
1vqqB           SIHIENLKSERGKILDRNNVELANTGTAYEIGIVPSKKDYKAIAKELSDYIKQ--QMDQNKTVKKMDEYL
1mwxA           SIHIENLKSERGKILDRNNVELANTGTAYEIGIVPSKKDYKAIAKELSDYIKQ--QMDQNKTVKKMDEYL
1vqqA           SIHIENLKSERGKILDRNNVELANTGTAYEIGIVPSKKDYKAIAKELSDYIKQ--QMDQNKTVKKMDEYL
1mwsB           SIHIENLKSERGKILDRNNVELANTGTAYEIGIVPSKKDYKAIAKELSDYIKQ--QMDQNKTVKKMDEYL
1mwuA           SIHIENLKSERGKILDRNNVELANTGTAYEIGIVPSKKDYKAIAKELSDYIKQ--QMDQNKTVKKMDEYL
1mwtB           SIHIENLKSERGKILDRNNVELANTGTAYEIGIVPSKKDYKAIAKELSDYIKQ--QMDQNKTVKKMDEYL
1mwsA           SIHIENLKSERGKILDRNNVELANTGTAYEIGIVPSKKDYKAIAKELSDYIKQ--QMDQNKTVKKMDEYL
1mwtA           SIHIENLKSERGKILDRNNVELANTGTAYEIGIVPSKKDYKAIAKELSDYIKQ--QMDQNKTVKKMDEYL
1mwrB           SIHIENLKSERGKILDRNNVELANTGTAYEIGIVPSKKDYKAIAKELSDYIKQQ---DQNLKTVKKDEYL
1mwrA           SIHIENLKSERGKILDRNNVELANTGTAYEIGIVPSKKDYKAIAKELSDYIKQQ---DQNLKTVKKDEYL
1mwuB           SIHIENLKSERGKILDRNNVELANTGTAYEIGIVPSKKDYKAIAKELSDYIKQ--QMDQNKTVKKMDEYL
1rp5B           HQTTRTVPAKRGTIYDRNGVPIAEDATSYNVYAKSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQL
1rp5A           HQTTRTVPAKRGTIYDRNGVPIAEDATSYNVYAKSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQL
2zc4E           ----------------------------------------------------------------------
2z2mE           ----------------------------------------------------------------------
2z2mB           ----------------------------------------------------------------------
1pyyA           ----------------------------------------------------------------------
2zc3B           ----------------------------------------------------------------------
2z2lB           ----------------------------------------------------------------------
1qmfA           ----------------------------------------------------------------------
1qmeA           ----------------------------------------------------------------------
1k25D           HQITRTVPAKRGTIYDRNGVPIAEDATSYNVYAVISFGSKGNGI----TYAN-MMAIKKELETAEVKGI-
1k25B           HQITRTVPAKRGTIYDRNGVPIAEDATSYNVYAVISFGSKGNGI----TYAN-MMAIKKELETAEVKGI-
3eqvA           ----------------------------------------------------------------------
3equA           ----------------------------------------------------------------------
3eqvB           ----------------------------------------------------------------------
2hq8B           ----------------------------------------------------------------------
2hq8A           ----------------------------------------------------------------------
3equB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SNLGDSTYSLTTVDANLGARMEQDLAGIPGLTFNEEASMVATDPGFAPDIVSRVARIVEDELEGSNGWRA
1mwxB           SDFAKKFHLTTNETESRNYPLEKATSHLLGYVINSEELKQKEYKGYKDDAVKGLEKLYDKKLQHEDGYRV
1vqqB           SDFAKKFHLTTNETESRNYPLEKATSHLLGYVINSEELKQKEYKGYKDDAVKGLEKLYDKKLQHEDGYRV
1mwxA           SDFAKKFHLTTNETESRNYPLEKATSHLLGYVINSEELKQKEYKGYKDDAVKGLEKLYDKKLQHEDGYRV
1vqqA           SDFAKKFHLTTNETESRNYPLEKATSHLLGYVINSEELKQKEYKGYKDDAVKGLEKLYDKKLQHEDGYRV
1mwsB           SDFAKKFHLTTNETESRNYPLEKATSHLLGYVINSEELKQKEYKGYKDDAVKGLEKLYDKKLQHEDGYRV
1mwuA           SDFAKKFHLTTNETESRNYPLEKATSHLLGYVINSEELKQKEYKGYKDDAVKGLEKLYDKKLQHEDGYRV
1mwtB           SDFAKKFHLTTNETESRNYPLEKATSHLLGYVINSEELKQKEYKGYKDDAVKGLEKLYDKKLQHEDGYRV
1mwsA           SDFAKKFHLTTNETESRNYPLEKATSHLLGYVINSEELKQKEYKGYKDDAVKGLEKLYDKKLQHEDGYRV
1mwtA           SDFAKKFHLTTNETESRNYPLEKATSHLLGYVINSEELKQKEYKGYKDDAVKGLEKLYDKKLQHEDGYRV
1mwrB           SDFAKKFHLTTNETESRNYPLEKATSHLLGYVINSEELKQKEYKGYKDDAVKGLEKLYDKKLQHEDGYRV
1mwrA           SDFAKKFHLTTNETESRNYPLEKATSHLLGYVINSEELKQKEYKGYKDDAVKGLEKLYDKKLQHEDGYRV
1mwuB           SDFAKKFHLTTNETESRNYPLEKATSHLLGYVINSEELKQKEYKGYKDDAVKGLEKLYDKKLQHEDGYRV
1rp5B           SNLKQVSFGAKTYANMMSIKKELETAEVKGIDFTTSPNRSYPNGQFASSFIG-LAQLHENELLGTSGMES
1rp5A           SNLKQVSFGAKTYANMMSIKKELETAEVKGIDFTTSPNRSYPNGQFASSFIG-LAQLHENELLGTSGMES
2zc4E           ----------------------------------------------------------------------
2z2mE           ----------------------------------------------------------------------
2z2mB           ----------------------------------------------------------------------
1pyyA           ----------------------------------------------------------------------
2zc3B           ----------------------------------------------------------------------
2z2lB           ----------------------------------------------------------------------
1qmfA           ----------------------------------------------------------------------
1qmeA           ----------------------------------------------------------------------
1k25D           ----DFTTSPNRSYPN--GQFASSFIGLAQLHENEDGSKSLLG-------TSGMESSLNSILAGTDG---
1k25B           ----DFTTSPNRSYPN--GQFASSFIGLAQLHENEDGSKSLLG-------TSGMESSLNSILAGTDG---
3eqvA           ---------------------------------------------------------LEDSLYGEDGAEV
3equA           ---------------------------------------------------------LEDSLYGEDGAEV
3eqvB           ---------------------------------------------------------LEDSLYGEDG--A
2hq8B           ----------------------------------------------------------------------
2hq8A           ----------------------------------------------------------------------
3equB           ---------------------------------------------------------LEDSLYGEDG--A


                         .         *         .         .         .         .         +:350
query           SIVTSNGAVIDDIAYDAPELAPSVRISLDHNVQRAAEEAVDLRAEMKAMMVVMRPSTGEILAVAQTDEAD
1mwxB           TIVDDSNTIAHTLIEKKKKDGKDIQLTIDAKVQKS------IYNNMKGSGTAIHPQTGELLALVSTPSYD
1vqqB           TIVDDSNTIAHTLIEKKKKDGKDIQLTIDAKVQKS------IYNNMKGSGTAIHPQTGELLALVSTPSYD
1mwxA           TIVDDSNTIAHTLIEKKKKDGKDIQLTIDAKVQKS------IYNNMKGSGTAIHPQTGELLALVSTPSYD
1vqqA           TIVDDSNTIAHTLIEKKKKDGKDIQLTIDAKVQKS------IYNNMKGSGTAIHPQTGELLALVSTPSYD
1mwsB           TIVDDNSNTIAHTLIEKKKKGKDIQLTIDAKVQKS------IYNNMKGSGTAIHPQTGELLALVSTPSYD
1mwuA           TIVDDNSNTIAHTLIEKKKKGKDIQLTIDAKVQKS------IYNNMKGSGTAIHPQTGELLALVSTPSYD
1mwtB           TIVDDNSNTIAHTLIEKKKKGKDIQLTIDAKVQKS------IYNNMKGSGTAIHPQTGELLALVSTPSYD
1mwsA           TIVDDNSNTIAHTLIEKKKKGKDIQLTIDAKVQKS------IYNNMKGSGTAIHPQTGELLALVSTPSYD
1mwtA           TIVDDNSNTIAHTLIEKKKKGKDIQLTIDAKVQKS------IYNNMKGSGTAIHPQTGELLALVSTPSYD
1mwrB           TIVDDSNTIAHTLIEKKKKDGKDIQLTIDAKVQKSIYNNKNDYGSGTAI----HPQTGELLALVSTPSYD
1mwrA           TIVDDSNTIAHTLIEKKKKDGKDIQLTIDAKVQKSIYNNKNDYGSGTA----IHPQTGELLALVSTPSYD
1mwuB           TIVDDNSNTIAHTLIEKKKKGKDIQLTIDAKVQKS------IYNNMKGSGTAIHPQTGELLALVSTPSYD
1rp5B           SLNSILAGTDGIITYEKDRLGNIVP-----GTEQVSQQTVDLQSFMETQMTLVSAKTGEILATTQTFDAD
1rp5A           SLNSILAGTDGIITYEKDRLGNIVP-----GTEQVSQQTVDLQSFMETQMTLVSAKTGEILATTQTFDAD
2zc4E           --------------------------------------------------------TGEILATTQTFDAD
2z2mE           --------------------------------------------------------TGEILATTQTFDAD
2z2mB           --------------------------------------------------------TGEILATTQTFDAD
1pyyA           --------------------------------------------------------TGEILATTQTFDAD
2zc3B           --------------------------------------------------------TGEILATTQTFDAD
2z2lB           --------------------------------------------------------TGEILATTQTFDAD
1qmfA           --------------------------------------------------------TGEILATTQTFDAD
1qmeA           --------------------------------------------------------TGEILATTQTFDAD
1k25D           -IITPGTELVSQQTVDGKDVYTTLSSPLQSFMETQMDAFLEKVKGKYMTATLVSAKTGEILATTQTFNAD
1k25B           -IITPGTELVSQQTVDGKDVYTTLSSPLQSFMETQMDAFLEKVKGKYMTATLVSAKTGEILATTQTFNAD
3eqvA           VLRDRQGNIVDSLRNKAPQNGKDIILSLDQRIQTLAYEAVEYHQAKAGTVVVLDARTGEILALANTPDSE
3equA           VLRDRQGNIVDSLRNKAPQNGKDIILSLDQRIQTLAYEAVEYHQAKAGTVVVLDARTGEILALANTPAYD
3eqvB           EVVLRDNIVLDSPRNKAPQNGKDIILSLDQRIQTLAYEAVEYHQAKAGTVVVLDARTGEILALANTPDSE
2hq8B           -------------------LAPGVRISVEEAAVNATDSLLKMKGEEKAMAVI------QSLIMYDCIDTD
2hq8A           -------------------LAPGVRISVEEAAVNATDSLLKMKGEEKAMAVI------QSLIMYDCIDTD
3equB           EVVLRDNIVLDSPRNKAPQNGKDIILSLDQRIQTLAYEAVEYHQAKAGTVVVLDARTGEILALANTPAYD


                         .         .         .         .         *         .         .:420
query           KDGDVALMGQYPPGSTFKIITAAAGLAHEGLTPDSIVPCPGTMNIYGRIVTNYNSFSLGNTSLDDAFANS
1mwxB           EDKKEPLLNKFSPGSTQKILTAMIGLNNKTLDDKTSYKIDGDKSWGGYNVTRYEVVN-GNIDLKQAIESS
1vqqB           EDKKEPLLNKFSPGSTQKILTAMIGLNNKTLDDKTSYKIDGDKSWGGYNVTRYEVVN-GNIDLKQAIESS
1mwxA           EDKKEPLLNKFSPGSTQKILTAMIGLNNKTLDDKTSYKIDGDKSWGGYNVTRYEVVN-GNIDLKQAIESS
1vqqA           EDKKEPLLNKFSPGSTQKILTAMIGLNNKTLDDKTSYKIDGDKSWGGYNVTRYEVVN-GNIDLKQAIESS
1mwsB           EDKKEPLLNKFSPG-TQKILTAMIGLNNKTLDDKTSYKIDGDKSWGGYNVTRYEVVN-GNIDLKQAIESS
1mwuA           EDKKEPLLNKFSPG-TQKILTAMIGLNNKTLDDKTSYKIDGDKSWGGYNVTRYEVVN-GNIDLKQAIESS
1mwtB           EDKKEPLLNKFSPG-TQKILTAMIGLNNKTLDDKTSYKIDGDKSWGGYNVTRYEVVN-GNIDLKQAIESS
1mwsA           EDKKEPLLNKFSPG-TQKILTAMIGLNNKTLDDKTSYKIDGDKSWGGYNVTRYEVVN-GNIDLKQAIESS
1mwtA           EDKKEPLLNKFSPG-TQKILTAMIGLNNKTLDDKTSYKIDGDKSWGGYNVTRYEVVN-GNIDLKQAIESS
1mwrB           EDKKEPLLNKFQPGSTQKILTAI-GLNNKTLDDKTSYKIDGKKSWGGYNVTRYEVVN-GNIDLKQAIESS
1mwrA           EDKKEPLLNKFSPGSTQKILT-AIGLNNKTLDDKTSYKIDGDKSWGGYNVTRYEVVN-GNIDLKQAIESS
1mwuB           EDKKEPLLNKFSPG-TQKILTAMIGLNNKTLDDKTSYKIDGKDKSWGN-VTRYEVVN-GNIDLKQAIESS
1rp5B           KEGDILYQSNYEPGSTMKVMMLAAAIDNNTF-PGGEVFNSSELKIADATIRDWD---VRMMTFSQGFAHS
1rp5A           KEGDILYQSNYEPGSTMKVMMLAAAIDNNTF-PGGEVFNSSELKIADATIRDWNEGLTGGMTFSQGFAHS
2zc4E           KEGDILYQSNYEPGSTMKVMMLAAAIDNNTF-PGGEVFNSSELKIADATIRDWDVNLTGGMTFSQGFAHS
2z2mE           KEGDILYQSNYEPGSTMKVMMLAAAIDNNTF-PGGEVFNSSELKIADATIRDWDVGGRMMT-FSQGFAHS
2z2mB           KEGDILYQSNYEPGSTMKVMMLAAAIDNNTF-PGGEVFNSSELKIADATIRDWNEGLTGGMTFSQGFAHS
1pyyA           KEGDILYQSNYEPGSAFKVMMLAAAIDNNTF-PGGEVFNSSELKIADATIRDWNEGLTGGMTFSQGFAHS
2zc3B           KEGDILYQSNYEPGSTMKVMMLAAAIDNNTF-PGGEVFNSSELKIADATIRDWNEGLTGGMTFSQGFAHS
2z2lB           KEGDILYQSNYEPGSTMKVMMLAAAIDNNTF-PGGEVFNSSELKIADATIRDWNEGLTGGMTFSQGFAHS
1qmfA           KEGDILYQSNYEPGSTMKVMMLAAAIDNNTF-PGGEVFNSSELKIADATIRDWNEGLTGGMTFSQGFAHS
1qmeA           KEGDILYQSNYEPGSTMKVMMLAAAIDNNTF-PGGEVFNSSELKIADATIRDWNEGLTGGMTFSQGFAHS
1k25D           KEGDILYQSNYEPGSAMKVMTLASSI------DNNTFPSGEYFNNVG--------MSLLEQKMGDA----
1k25B           KEGDILYQSNYEPGSAMKVMTLASSI------DNNTFPSGEYFNNVG--------MSLLEQKMGDA----
3eqvA           QRRNRAVTDMIEPGSAIKPFVIAKAL--------------------------------------------
3equA           ----------------------------------------------------------------------
3eqvB           QRRNRAVTDMIEPGSAIKPFVIAKAL--------------------------------------------
2hq8B           KDGYVSL-------PEFKAFLQAVG---PDLTDDKAITCFNTLNKNGQITVNDFLFGLEETALANAF---
2hq8A           KDGYVSL-------PEFKAFLQAVG---PDLTDDKAITCFNTLNKNGQITVNDFLFGLEETALANAF---
3equB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           CNTTFADISTNLEPGQLKNVAKQFGLGIDYQIPGLDTMTGSVPAGDIVLDRTESGYGQGLDLASPFGMAL
1mwxB           DNIFFARVALELGSKKFEKGMKKLGVGED--IPSYPFYNAQILDNEILL--ADSGYGQGEILINPVQLSI
1vqqB           DNIFFARVALELGSKKFEKGMKKLGVGED--IPSYPFYNAQILDNEILL--ADSGYGQGEILINPVQLSI
1mwxA           DNIFFARVALELGSKKFEKGMKKLGVGEDIDYPFYNAQISNKNLDNEIL-LADSGYGQGEILINPVQLSI
1vqqA           DNIFFARVALELGSKKFEKGMKKLGVGEDIDYPFYNAQISNKNLDNEIL-LADSGYGQGEILINPVQLSI
1mwsB           DNIFFARVALELGSKKFEKGMKKLGVGED--IPSYPFYNAQILDNEILL--ADSGYGQGEILINPVQLSI
1mwuA           DNIFFARVALELGSKKFEKGMKKLGVGEDIDYPFYNAQISNNLDNEILL--ADSGYGQGEILINPVQLSI
1mwtB           DNIFFARVALELGSKKFEKGMKKLGVGED--IPSYPFYNAQILDNEILL--ADSGYGQGEILINPVQLSI
1mwsA           DNIFFARVALELGSKKFEKGMKKLGVGEDIDYPFYNAQISNKNLDNEIL-LADSGYGQGEILINPVQLSI
1mwtA           DNIFFARVALELGSKKFEKGMKKLGVGEDIDYPFYNAQISNKNLDNEIL-LADSGYGQGEILINPVQLSI
1mwrB           DNIFFARVALELGSKKFEK-GKKLGVGEDIDYPFYNAQISNKNLDNEIL-LADSGYGQGEILINPVQLSI
1mwrA           DNIFFARVA--LELGS-KKFEKGKKLGVGEDIPSYPFYNAQILDNEILL--ADSGYGQGEILINPVQLSI
1mwuB           DNIFFARVALELGSKKFEKGMKKLGVGED--IPSDYPFYNAQIDNEILL--ADSGYGQGEILINPVQLSI
1rp5B           SNVGMTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIV-NIAMSAFGQGISVTQTQMLRA
1rp5A           SNVGMTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIV-NIAMSAFGQGISVTQTQMLRA
2zc4E           SNVGMTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIV-NIAQSSFGQGISVTQTQMIRA
2z2mE           SNVGMTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIV-NIAQSSFGQGISVTQTQMIRA
2z2mB           SNVGMTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIV-NIAQSSFGQGISVTQTQMIRA
1pyyA           SNVGMTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIV-NIAQSSFGQGISVTQTQMIRA
2zc3B           SNVGMTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIV-NIAQSSFGQGISVTQTQMIRA
2z2lB           SNVGMTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIV-NIAQSSFGQGISVTQTQMIRA
1qmfA           SNVGMTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIV-NIAQSSFGQGISVTQTQMIRA
1qmeA           SNVGMTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIV-NIAQSSFGQGISVTQTQMIRA
1k25D           ---TWLD------------YLKRFKFGVPTRFGLTDEYAGQLPADNIV-SIAQSSFGQGISVTQTQMLRA
1k25B           ---TWLD------------YLKRFKFGVPTRFGLTDEYAGQLPADNIV-SIAQSSFGQGISVTQTQMLRA
3eqvA           ----------------------------------------------------------------------
3equA           ----------------------------------------------------------------------
3eqvB           ----------------------------------------------------------------------
2hq8B           ----------------------------------------------------------------------
2hq8A           ----------------------------------------------------------------------
3equB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           VASTAATGSVPTPTLISGHETVASEEVPALDPEVLANVQRMMKSVVNDGTARGMRQTGGQIYAKTGEAEI
1mwxB           YSALENNGNINAPHLLKDTKNKVWKK-NIISKENINLLNDGMQQVVNKTHKEDIYRSYANLIGKSGTAEL
1vqqB           YSALENNGNINAPHLLKDTKNKVWKK-NIISKENINLLTDGMQQVVNKTHKEDIYRSYANLIGKSGTAEL
1mwxA           YSALENNGNINAPHLLKDTKNKVWKK-NIISKENINLLNDGMQQVVNKTHKEDIYRSYANLIGKSGTAEL
1vqqA           YSALENNGNINAPHLLKDTKNKVWKK-NIISKENINLLTDGMQQVVNKTHKEDIYRSYANLIGKSGTAEL
1mwsB           YSALENNGNINAPHLLKDTKNKVWKK-NIISKENINLLTDGMQQVVNKTHKEDIYRSYANLIGKSGTAEL
1mwuA           YSALENNGNINAPHLLKDTKNKVWKK-NIISKENINLLTDGMQQVVNKTHKEDIYRSYANLIGKSGTAEL
1mwtB           YSALENNGNINAPHLLKDTKNKVWKK-NIISKENINLLTDGMQQVVNKTHKEDIYRSYANLIGKSGTAEL
1mwsA           YSALENNGNINAPHLLKDTKNKVWKK-NIISKENINLLTDGMQQVVNKTHKEDIYRSYANLIGKSGTAEL
1mwtA           YSALENNGNINAPHLLKDTKNKVWKK-NIISKENINLLTDGMQQVVNKTHKEDIYRSYANLIGKSGTAEL
1mwrB           YSALENNGNINAPHLLKDTKNKVWKKNIISKENI--NLLTDGQQVVNKTHKEDIYRSYANLIGKSGTAEL
1mwrA           YSALENNGNINAPHLLKDTKNKVWKKNIISKENI--NLLTDGQQVVNKTHKEDIYRSYANLIGKSGTAEL
1mwuB           YSALENNGNINAPHLLKDTKNKVWKK-NIISKENINLLTDGMQQVVNKTHKEDIYRSYANLIGK------
1rp5B           FTAIANDGVMLEPKFISALYDPNDQSVRKSQKEIVGNVSKEAASVTRDHMVMGTDPTYGTMYHSTGKATV
1rp5A           FTAIANDGVMLEPKFISALYDPNDQSVRKSQKEIVGNVSKEAASVTRDHMVMGTDPTYGTMYHSTGKATV
2zc4E           FTAIANDGVMLEPKFIS-----------------------------------------------------
2z2mE           FTAIANDGVMLEPKFIS-----------------------------------------------------
2z2mB           FTAIANDGVMLEPKFISAKEIVVSKDAASLTRTVLVGTDPVYGTMYNHSTGKPTVTVPGQVALKSGTAQI
1pyyA           FTAIANDGVMLEPKFIS-----------------------------------------------------
2zc3B           FTAIANDGVMLEPKFIS-----------------------------------------------------
2z2lB           FTAIANDGVMLEPKFIS-----------------------------------------------------
1qmfA           FTAIANDGVMLEPKFIS-----------------------------------------------------
1qmeA           FTAIANDGVMLEPKFIS-----------------------------------------------------
1k25D           FTAIANDGVMLEPKFISAIYDTNNQSVRKSQKEIVGN---------------------------------
1k25B           FTAIANDGVMLEPKFISAIYDTNNQSVRKSQKEIVGN---------------------------------
3eqvA           ----------------------------------------------------------------------
3equA           ----------------------------------------------------------------------
3eqvB           ----------------------------------------------------------------------
2hq8B           ----------------------------------------------------------------------
2hq8A           ----------------------------------------------------------------------
3equB           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           NEGSHAWFTGYREDDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1mwxB           KGRQIGWFISYDKDN-----------------------------------------------
1vqqB           KGRQIGWFISYDKDN-----------------------------------------------
1mwxA           KGRQIGWFISYDKDN-----------------------------------------------
1vqqA           KGRQIGWFISYDKDN-----------------------------------------------
1mwsB           KGRQIGWFISYDKDN-----------------------------------------------
1mwuA           QIG---WFISYDKDN-----------------------------------------------
1mwtB           RQ--IGWFISYDKDN-----------------------------------------------
1mwsA           KQ--IGWFISYDKDN-----------------------------------------------
1mwtA           GR-QIGWFISYDKDN-----------------------------------------------
1mwrB           KGRQIGWFISYDKDN-----------------------------------------------
1mwrA           KR-QIGWFISYDKDN-----------------------------------------------
1mwuB           ---SIGWFISYDKDN-----------------------------------------------
1rp5B           N-------------------------------------------------------------
1rp5A           N-------------------------------------------------------------
2zc4E           --------------------------------------------------------------
2z2mE           --------------------------------------------------------------
2z2mB           ADGYLVGLTDY---------------------------------------------------
1pyyA           --------------------------------------------------------------
2zc3B           --------------------------------------------------------------
2z2lB           --------------------------------------------------------------
1qmfA           --------------------------------------------------------------
1qmeA           --------------------------------------------------------------
1k25D           --------------------------------------------------------------
1k25B           --------------------------------------------------------------
3eqvA           --------------------------------------------------------------
3equA           --------------------------------------------------------------
3eqvB           --------------------------------------------------------------
2hq8B           --------------------------------------------------------------
2hq8A           --------------------------------------------------------------
3equB           --------------------------------------------------------------