[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF54857.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2wi8A.bssp"
#ERROR : Can't open dsspfile "2whyA.bssp"
#ERROR : Can't open dsspfile "3gfvB.bssp"
#ERROR : Can't open dsspfile "3gfvA.bssp"
#ERROR : Can't open dsspfile "2phzA.bssp"
#ERROR : Can't open dsspfile "3eixA.bssp"
#ERROR : Can't open dsspfile "3be6B.bssp"
#ERROR : Can't open dsspfile "3be6A.bssp"
#ERROR : Can't open dsspfile "3eiwA.bssp"
#ERROR : Can't open dsspfile "1k2vN.bssp"
#ERROR : Can't open dsspfile "1eszA.bssp"
#ERROR : Can't open dsspfile "1efdN.bssp"

## Summary of PDB Search
:314
    2e-14  27%  2wi8A  [x.x.x] IRON-UPTAKE SYSTEM-BINDING PROTEIN
    2e-14  27%  2whyA  [x.x.x] IRON-UPTAKE SYSTEM-BINDING PROTEIN
    9e-12  24%  3gfvB  [x.x.x] UNCHARACTERIZED ABC TRANSPORTER SOLUTE-BINDING
    9e-12  24%  3gfvA  [x.x.x] UNCHARACTERIZED ABC TRANSPORTER SOLUTE-BINDING
    1e-10  29%  2phzA  [x.x.x] IRON-UPTAKE SYSTEM-BINDING PROTEIN
    6e-10  27%  3eixA  [x.x.x] HTSA PROTEIN
    8e-10  26%  3be6B  [x.x.x] PUTATIVE IRON COMPOUND-BINDING PROTEIN OF ABC
    8e-10  26%  3be6A  [x.x.x] PUTATIVE IRON COMPOUND-BINDING PROTEIN OF ABC
    1e-09  27%  3eiwA  [x.x.x] HTSA PROTEIN
    7e-04  28%  1k2vN  [c.92.2] FERRICHROME-BINDING PERIPLASMIC PROTEIN
    7e-04  28%  1eszA  [c.92.2] FERRICHROME-BINDING PERIPLASMIC PROTEIN
    7e-04  28%  1efdN  [c.92.2] FERRICHROME-BINDING PERIPLASMIC PROTEIN
:314

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDEQRIVAXXXXXXXXXX
2wi8A           ----------------------------------------------------------------------
2whyA           ----------------------------------------------------------------------
3gfvB           ----------------------------------------------------------------------
3gfvA           ----------------------------------------------------------------------
2phzA           ----------------------------------------------------------------------
3eixA           -----------------------------------------------------DAKRIVVLEYSFADALA
3be6B           ----------------------------------------------------------------------
3be6A           ----------------------------------------------------------------------
3eiwA           -----------------------------------------------------DAKRIVVLEYSFADALA
1k2vN           ----------------------------------------------------------------------
1eszA           ----------------------------------------------------------------------
1efdN           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXITPVGVAAAKNSDLIPQFLKDRFSADMDLDSIADCGLRQSPDIEAIANLNPTLICANSRADEEVLNK
2wi8A           --------------------------------DKAEPTGEKMEPNIEKILEMKPDVILASTKFPEKTLQK
2whyA           --------------------------------DKAEPTGEKMEPNIEKILEMKPDVILASTKFPEKTLQK
3gfvB           -----------------LPKQVLPKYLSKFKDDKYADVGSLKEPDFDKVAELDPDLIIISARQSES-YKE
3gfvA           -----------------LPKQVLPKYLSKFKDDKYADVGSLKEPDFDKVAELDPDLIIISARQSES-YKE
2phzA           -----------AKLLDVHPQSFSGKFPDFKDITDKAEPTGEKEPNIEKILE-KPDVILASTKFPEKTLQK
3eixA           ALDVKPVGIADDGKKKRIIKPVREKIG---DYTSV---GTRKQPNLEEISKLKPDLIIADSSRHKGINKE
3be6B           ----------------------------DFDNSSIAFIGTADI-DIEAIVAAKPDLIITEPTRNTPI-ER
3be6A           ----------------------------DFDNSSIAFIGTADI-DIEAIVAAKPDLIITEPTRNTPI-ER
3eiwA           ALDVKPVGIADDGKKKRIIKPVREKIG---DYTSV---GTRKQPNLEEISKLKPDLIIADSSRHKGINKE
1k2vN           --------------------------------DSVIDVGLRTEPNLELLTEMKPSFMSAGYGPSPEMLAR
1eszA           --------------------------------DSVIDVGLRTEPNLELLTEMKPSFMSAGYGPSPEMLAR
1efdN           --------------------------------DSVIDVGLRTEPNLELLTEMKPSFMSAGYGPSPEMLAR


                         +         .         .         .         .         *         .:210
query           LRTIAPVVTGEGGGENWKQDLLTIAEAAGQKEKAETLLKSYEDSAAEIAANQPANPPTVSFLRTKDQEFQ
2wi8A           ISTAGTTIPVSHISSNWKENMMLLAQLTGKEKKAKKIIADYEQDLKETKTNDKAKDSKALVIRIRQGNIY
2whyA           ISTAGTTIPVSHISSNWKENMMLLAQLTGKEKKAKKIIADYEQDLKETKTNDKAKDSKALVIRIRQGNIY
3gfvB           FSKIAPTIVDTAKYESFKSDAETIGKIFDKEDKVKDELANIDHSIADVKKTAEKLNKN-GLVIANDGKIS
3gfvA           FSKIAPTIVDTAKYESFKSDAETIGKIFDKEDKVKDELANIDHSIADVKKTAEKLNKN-GLVIANDGKIS
2phzA           ISTAGTTIPVSHISSNWKENLL--AQLTGKEKKAKKIIADYEQDLKEIKTNDKAKDSKALVIRIRQGNIY
3eixA           LNKIAPTLSLKSFDGDYKQNIKTIAKALNKEKEGEKLINKYKDE-IKFDRNQKVLPAVVA-----KAGLL
3be6B           LEKIAPTVSIDHLKGGAPEIYRKLAELTGTQSQLAILERRYQAQINALKATLDSQKITVSVIQANQGKIN
3be6A           LEKIAPTVSIDHLKGGAPEIYRKLAELTGTQSQLAILERRYQAQINALKATLDSQKITVSVIQANQGKIN
3eiwA           LNKIAPTLSLKSFDGDYKQNIKTIAKALNKEKEGEKLINKYKDE-IKFDRNQKVLPAVVA-----KAGLL
1k2vN           ---IAP-----GRGFNFRKSLTEMADLLNLQSAAETHLAQYEDSMKPRFVKRGARPLLLTTL-IDPRHML
1eszA           ---IAP-----GRGFNFRKSLTEMADLLNLQSAAETHLAQYEDSMKPRFVKRGARPLLLTTL-IDPRHML
1efdN           ---IAP-----GRGFNFRKSLTEMADLLNLQSAAETHLAQYEDSMKPRFVKRGARPLLLTTL-IDPRHML


                         .         .         .         +         .         .         .:280
query           MYGAQSMAGTVAADCGYARPENQQFTDTAGQDLSAELIAQADADWLFYGMKEGNINPEDTPLWTSLKAVQ
2wi8A           IYPEQYFNSTLYGDLGLKAP-NEVKAAKAQELISLEKLSEMNPDHIFFSDDENADKPEKNPIWKSLKAVK
2whyA           IYPEQYFNSTLYGDLGLKAP-NEVKAAKAQELISLEKLSEMNPDHIFFSDDENADKPEKNPIWKSLKAVK
3gfvB           AFGPKSRYGLIHDVFGVAPADQNIKASTHGQSVSYEYISKTNPDYLFIGETSSTKQVVENDYVKNVNAVK
3gfvA           AFGPKSRYGLIHDVFGVAPADQNIKASTHGQSVSYEYISKTNPDYLFIGETSSTKQVVENDYVKNVNAVK
2phzA           IYPEQVFNSTLYGDLGLKAPN--EVKAAKAQELSSLEKLSENPDHIFFSDDENADKPEKNPIWKSLKAVK
3eixA           AHPNYSYVGQFLNELGFKNALSDDVTKGLSKYLKGPYL-QLDTEHL------ADLNPEEDATWKKLNAVK
3be6B           VHSYHSL-GRVLRDAGFRFPPLIESIPEGGRDVSAERLPELDADFVFAGKPQDELATEKVPGWCQLTACR
3be6A           VHSYHSL-GRVLRDAGFRFPPLIESIPEGGRDVSAERLPELDADFVFAGKPQDELATEKVPGWCQLTACR
3eiwA           AHPNYSYVGQFLNELGFKNALSDDVTKGLSKYLKGPYL-QLDTEHL------ADLNPEEDATWKKLNAVK
1k2vN           VFGPNSLFQEILDEYGIPNAWQGETNFWGSTAVSIDLAAYKDVDVLCF----DHDNSKDTPLWQAMPFVR
1eszA           VFGPNSLFQEILDEYGIPNAWQGETNFWGSTAVSIDLAAYKDVDVLCF----DHDNSKDTPLWQAMPFVR
1efdN           VFGPNSLFQEILDEYGIPNAWQGETNFWGSTAVSIDLAAYKDVDVLCF----DHDNSKDTPLWQAMPFVR


                         .         *         .         .         .         .         +:350
query           SNQAIPVDGDSWYLNASLVSAEIIxxxxxxxxxx
2wi8A           ED--------------------------------
2whyA           ED--------------------------------
3gfvB           NGHVIYLDSATWYLS-------------------
3gfvA           NGHVIYLDSATWYLS-------------------
2phzA           ED--------------------------------
3eixA           NNRVDIVDRDVWARSRGLISSE------------
3be6B           SGRYVLISREEAISNS------------------
3be6A           SGRYVLISREEAISNS------------------
3eiwA           NNRVDIVDRDVWARSRGLISSE------------
1k2vN           AGQRVPA---VWFYGATLSAMHFV----------
1eszA           AGQRVPA---VWFYGATLSAMHFV----------
1efdN           AGQRVPA---VWFYGATLSAMHFV----------