[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF55227.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cb4D.bssp"
#ERROR : Can't open dsspfile "3degC.bssp"
#ERROR : Can't open dsspfile "2ywhA.bssp"
#ERROR : Can't open dsspfile "2ywgA.bssp"
#ERROR : Can't open dsspfile "2ywfA.bssp"
#ERROR : Can't open dsspfile "2yweA.bssp"

## Summary of PDB Search
:106
    7e-19  56%  3cb4D  [x.x.x] GTP-BINDING PROTEIN LEPA
    4e-13  50%  3degC  [x.x.x] GTP-BINDING PROTEIN LEPA
    6e-12  55%  2ywhA  [x.x.x] GTP-BINDING PROTEIN LEPA
    6e-12  55%  2ywgA  [x.x.x] GTP-BINDING PROTEIN LEPA
    6e-12  55%  2ywfA  [x.x.x] GTP-BINDING PROTEIN LEPA
    6e-12  55%  2yweA  [x.x.x] GTP-BINDING PROTEIN LEPA
:106

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDAFSAIVHRDNAQWYGNKMTVKLKELIPRQQFEVPVQAAIGSKVIARENIRALRKDVLAKCYGxxxxxx
3cb4D           VDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYG------
3degC           VDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQL----------------
2ywhA           VDALSFIVHADRAQKFARRVAEKLRETIPRQLFEVHIQVAKGGKVIASERIKPLR---------------
2ywgA           VDALSFIVHADRAQKFARRVAEKLRETIPRQLFEVHIQVAKGGKVIASERIKPLR---------------
2ywfA           VDALSFIVHADRAQKFARRVAEKLRETIPRQLFEVHIQVAKGGKVIASERIKPLR---------------
2yweA           VDALSFIVHADRAQKFARRVAEKLRETIPRQLFEVHIQVAKGGKVIASERIKPLR---------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cb4D           ------------------------------------
3degC           ------------------------------------
2ywhA           ------------------------------------
2ywgA           ------------------------------------
2ywfA           ------------------------------------
2yweA           ------------------------------------