[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF55235.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2oceA.bssp"
#ERROR : Can't open dsspfile "3bzkA.bssp"
#ERROR : Can't open dsspfile "3bzcA.bssp"
#ERROR : Can't open dsspfile "2eduA.bssp"
#ERROR : Can't open dsspfile "2duyA.bssp"

## Summary of PDB Search
:196
    2e-07  36%  2oceA  [x.x.x] HYPOTHETICAL PROTEIN PA5201
    2e-07  36%  3bzkA  [x.x.x] TEX
    2e-07  36%  3bzcA  [x.x.x] TEX
    5e-07  45%  2eduA  [x.x.x] KINESIN-LIKE PROTEIN KIF22
    2e-05  44%  2duyA  [x.x.x] COMPETENCE PROTEIN COMEA-RELATED PROTEIN
:196

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2oceA           ----------------------------------------------------------------------
3bzkA           ----------------------------------------------------------------------
3bzcA           ----------------------------------------------------------------------
2eduA           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxISLNT
2oceA           -----------------------------------------------------------------VDVNT
3bzkA           -----------------------------------------------------------------VDVNT
3bzcA           -----------------------------------------------------------------VDVNT
2eduA           -------------------------------------------------------------------LNE
2duyA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ATVADLVTLPGVGEKTAQAIIDFRESNGGFSTVEDLLQVKGIGPSKFEQISGLVSP
2oceA           ASAALLARISGLNSTLAQNIVAHRDANGAFRTRDELKKVSRLGEKTFEQAAGFL--
3bzkA           ASAALLARISGLNSTLAQNIVAHRDANGAFRTRDELKKVSRLGEKTFEQAAGFL--
3bzcA           ASAALLARISGLNSTLAQNIVAHRDANGAFRTRDELKKVSRLGEKTFEQAAGFL--
2eduA           GSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQME--------
2duyA           ---------PGIGPVLARRIVEGRP----YARVEDLLKVKGIGPATLERLRPYLRP