[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF55333.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1w4xA.bssp"
#ERROR : Can't open dsspfile "3gwfA.bssp"
#ERROR : Can't open dsspfile "3gwdA.bssp"
#ERROR : Can't open dsspfile "2vq7C.bssp"
#ERROR : Can't open dsspfile "2vq7A.bssp"
#ERROR : Can't open dsspfile "1wamA.bssp"
#ERROR : Can't open dsspfile "1usjA.bssp"
#ERROR : Can't open dsspfile "3intB.bssp"
#ERROR : Can't open dsspfile "3inrB.bssp"
#ERROR : Can't open dsspfile "3gf4A.bssp"
#ERROR : Can't open dsspfile "2bi7A.bssp"
#ERROR : Can't open dsspfile "1b37B.bssp"
#ERROR : Can't open dsspfile "1b37A.bssp"
#ERROR : Can't open dsspfile "1tdfA.bssp"

## Summary of PDB Search
:499
    9e-61  34%  1w4xA  [c.3.1 - c.3.1] PHENYLACETONE MONOOXYGENASE
    8e-52  34%  3gwfA  [x.x.x] CYCLOHEXANONE MONOOXYGENASE
    8e-52  34%  3gwdA  [x.x.x] CYCLOHEXANONE MONOOXYGENASE
    5e-08  27%  2vq7C  [x.x.x] FLAVIN-CONTAINING MONOOXYGENASE
    5e-08  27%  2vq7A  [x.x.x] FLAVIN-CONTAINING MONOOXYGENASE
    2e-04  44%  1wamA  [x.x.x] UDP-GALACTOPYRANOSE MUTASE
    2e-04  44%  1usjA  [c.4.1 - d.16.1] UDP-GALACTOPYRANOSE MUTASE
    2e-04  44%  3intB  [x.x.x] PROBABLE UDP-GALACTOPYRANOSE MUTASE
    2e-04  44%  3inrB  [x.x.x] UDP-GALACTOPYRANOSE MUTASE
    2e-04  44%  3gf4A  [x.x.x] UDP-GALACTOPYRANOSE MUTASE
    2e-04  44%  2bi7A  [x.x.x] UDP-GALACTOPYRANOSE MUTASE
    2e-04  30%  1b37B  [c.3.1 - d.16.1] PROTEIN (POLYAMINE OXIDASE)
    2e-04  30%  1b37A  [c.3.1 - d.16.1] PROTEIN (POLYAMINE OXIDASE)
    8e-04  27%  1tdfA  [x.x.x] THIOREDOXIN REDUCTASE
:499

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxKRTVIVGSGFAGLGMGAQLKRRGDHDFVIIERADDVGGTWRDNTYPGAACDVPSHLYSFSFH
1w4xA           -----------LVVGAGFSGLYALYRLRELG-RSVHVIETAGDVGGVWYWNRYPGARCDIESIEYCYSFS
3gwfA           -----------VVIGAGFGGIYAVHKLHHELGLTTVGFDKADGPGGTWYWNRYPGALSDTESHLYRFSFD
3gwdA           -----------VVIGAGFGGIYAVHKLHHELGLTTVGFDKADGPGGTWYWNRYPGALSDTESHLYRFSFD
2vq7C           ---------RIAILGAGPSGMAQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENVHSSMYRYLWS
2vq7A           ---------RIAILGAGPSGMAQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENVHSSMYRYLWS
1wamA           --------KKILIVGAGFSGAVIGRQLAEKG-HQVHIIDQRDHIGGNSYD--------------------
1usjA           --------KKILIVGAGFSGAVIGRQLAEKG-HQVHIIDQRDHIGGNSYD--------------------
3intB           --------KKILIVGAGFSGAVIGRQLAEKG-HQVHIIDQRDHIGGNSYD--------------------
3inrB           --------KKILIVGAGFSGAVIGRQLAEKG-HQVHIIDQRDHIGGNSYD--------------------
3gf4A           --------KKILIVGAGFSGAVIGRQLAEKG-HQVHIIDQRDHIGGNSYD--------------------
2bi7A           --------KKILIVGAGFSGAVIGRQLAEKG-HQVHIIDQRDHIGGNSYD--------------------
1b37B           ---------RVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAG---------------
1b37A           ---------RVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAG---------------
1tdfA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PNPNWSQVFSPGPEIQTYLQNFAQDEGLLPHLHFNRNMNNARWDEKEGRWHITTPGQVYIAQFLITGTGH
1w4xA           EEVNWTERYASQPEILRYINFVADKFDLRSGITFHTTVTAAAFDEATNTWTVTNHGDRIRARYLIMASGQ
3gwfA           RDSTWKTTYITQPEILEYLEDVVDRFDLRRHFKFGTEVTSALYLDDENLWEVTTDGEVYRAKYVVNAVGL
3gwdA           RDSTWKTTYITQPEILEYLEDVVDRFDLRRHFKFGTEVTSALYLDDENLWEVTTDGEVYRAKYVVNAVGL
2vq7C           NGPKECLEFAPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTTTDTIYSAAFVVCCTGH
2vq7A           NGPKECLEFAPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTTTDTIYSAAFVVCCTGH
1wamA           ----------------------------------------------------------------------
1usjA           ----------------------------------------------------------------------
3intB           ----------------------------------------------------------------------
3inrB           ----------------------------------------------------------------------
3gf4A           ----------------------------------------------------------------------
2bi7A           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
1tdfA           ----------------------------------------------------------YTCDALIIATG-


                         +         .         .         .         .         *         .:210
query           LADESYPTIPGLESFTGEKFHSARWDHNVSLKGKRIGVVGTGASAIQIVPEMAKIASELVVFQRTPSYII
1w4xA           LSVPQLPNFPGLKDFAGNLYHTGNWPHEVDFSGQRVGVIGTGSSGIQVSPQIAKQAAELFVFQRTPHFAV
3gwfA           LSAINFPNLPGLDTFEGETIHTAAWPEGKSLAGRRVGVIGTGSTGQQVITSLAPEVEHLTVFVRTPQYSV
3gwdA           LSAINFPNLPGLDTFEGETIHTAAWPEGKSLAGRRVGVIGTGSTGQQVITSLAPEVEHLTVFVRTPQYSV
2vq7C           FSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYAKKLISCYRT-----
2vq7A           FSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYAKKLISCYRT-----
1wamA           ----------------------------------------------------------------------
1usjA           ----------------------------------------------------------------------
3intB           ----------------------------------------------------------------------
3inrB           ----------------------------------------------------------------------
3gf4A           ----------------------------------------------------------------------
2bi7A           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
1tdfA           -ASARYLGLPSEEAFKGRGVSACATSDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFLI


                         .         .         .         +         .         .         .:280
query           PRMERKYTDGEKRLFQRNPHVIENLRSELFWGGENTFAQRRAIPRFLAEGKKLALDHLAAQVSDEELRAK
1w4xA           PREESRNTPGGTHRYQGPKSALEVSDEELYWGGPDILAAYRDILRDRDANERVARNKIRNTVRDPEVAER
3gwfA           PVGNRPV----------NPEQIAEIKADYIWERAKNSAEESTLPAMSVSEEERAWDHVAEIIEDPETARK
3gwdA           PVGNRPV----------NPEQIAEIKADYIWERAKNSAEESTLPAMSVSEEERAWDHVAEIIEDPETARK
2vq7C           ----------------------------------------------------------------------
2vq7A           ----------------------------------------------------------------------
1wamA           ----------------------------------------------------------------------
1usjA           ----------------------------------------------------------------------
3intB           ----------------------------------------------------------------------
3inrB           ----------------------------------------------------------------------
3gf4A           ----------------------------------------------------------------------
2bi7A           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
1tdfA           KRLMDKVENG------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LTPSYEPGCKRVLISNTYYPALQSPITTLEASALSSINGSTVRAASGEEYELDILIFATGFEATEPPYAQ
1w4xA           LVPKGYPGTKRLILEIDYYEMFNRDNVHLVDTLSAPIETITPRGVSEREYELDSLVLATGFDALTGALFK
3gwfA           LMPK-GLFAKRPLCDSGYYEVYNRPAVAIKENPIREVTAKGVVTEDGVLHELDVLVFATGFDAVDGNYRR
3gwdA           LMPK-GLFAKRPLCDSGYYEVYNRPAVAIKENPIREVTAKGVVTEDGVLHELDVLVFATGFDAVDGNYRR
2vq7C           ----------------------------------------------------------------------
2vq7A           ----------------------------------------------------------------------
1wamA           ----------------------------------------------------------------------
1usjA           ----------------------------------------------------------------------
3intB           ----------------------------------------------------------------------
3inrB           ----------------------------------------------------------------------
3gf4A           ----------------------------------------------------------------------
2bi7A           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
1tdfA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LIDGCDGLNLSEHWERGMQAYQSVAVAGFPNLLSINGPNTSLGHNSIVYIIESQIEYILGAMDYMSAIGA
1w4xA           IIRGVGNVALKEKWAAGPRTYLGLSTAGFPNLFFIAGPGSPSALSNMLVSIEQHVEWVTDHIAYMFKNGL
3gwfA           IIRGRDGLHINDHWDGQPTSYLGVSTANFPNWFMVLGPNGPF--TNLPPSIETQVEWISDTIGYAERNG-
3gwdA           IIRGRDGLHINDHWDGQPTSYLGVSTANFPNWFMVLGPNGPF--TNLPPSIETQVEWISDTIGYAERNG-
2vq7C           ----------------------------------------------------------------------
2vq7A           ----------------------------------------------------------------------
1wamA           ----------------------------------------------------------------------
1usjA           ----------------------------------------------------------------------
3intB           ----------------------------------------------------------------------
3inrB           ----------------------------------------------------------------------
3gf4A           ----------------------------------------------------------------------
2bi7A           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
1tdfA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           SIIEPTAEAEEAYVEHIQRNAVGTVWLDGGCNSWYVDQRTGRLTLIWPDFGYAFRDANGTFDAEGYExxx
1w4xA           TRSEAVLEKEDEWVEHV--NEIADETLYPMTASWYTGANVPRVFMLYVGGFHRYRQICDEVAAKGYE---
3gwfA           ----------------------------------------------------------------------
3gwdA           ----------------------------------------------------------------------
2vq7C           ----------------------------------------------------------------------
2vq7A           ----------------------------------------------------------------------
1wamA           ----------------------------------------------------------------------
1usjA           ----------------------------------------------------------------------
3intB           ----------------------------------------------------------------------
3inrB           ----------------------------------------------------------------------
3gf4A           ----------------------------------------------------------------------
2bi7A           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
1tdfA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxx
1w4xA           ---------
3gwfA           ---------
3gwdA           ---------
2vq7C           ---------
2vq7A           ---------
1wamA           ---------
1usjA           ---------
3intB           ---------
3inrB           ---------
3gf4A           ---------
2bi7A           ---------
1b37B           ---------
1b37A           ---------
1tdfA           ---------