[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF55378.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1f8fA.bssp"
#ERROR : Can't open dsspfile "1hdyA.bssp"
#ERROR : Can't open dsspfile "1u3uA.bssp"
#ERROR : Can't open dsspfile "1hdzA.bssp"
#ERROR : Can't open dsspfile "1htbA.bssp"
#ERROR : Can't open dsspfile "1hsoA.bssp"
#ERROR : Can't open dsspfile "1e3lB.bssp"
#ERROR : Can't open dsspfile "1e3lA.bssp"
#ERROR : Can't open dsspfile "3cosD.bssp"
#ERROR : Can't open dsspfile "3cosA.bssp"
#ERROR : Can't open dsspfile "1u3wA.bssp"
#ERROR : Can't open dsspfile "1qv6A.bssp"
#ERROR : Can't open dsspfile "1qlhA.bssp"
#ERROR : Can't open dsspfile "1e3eB.bssp"
#ERROR : Can't open dsspfile "1e3eA.bssp"
#ERROR : Can't open dsspfile "1mgoA.bssp"
#ERROR : Can't open dsspfile "1ju9A.bssp"
#ERROR : Can't open dsspfile "1hetA.bssp"
#ERROR : Can't open dsspfile "1axgA.bssp"
#ERROR : Can't open dsspfile "1n8kA.bssp"
#ERROR : Can't open dsspfile "1axeA.bssp"
#ERROR : Can't open dsspfile "1a71A.bssp"
#ERROR : Can't open dsspfile "1ee2A.bssp"
#ERROR : Can't open dsspfile "1d1tA.bssp"
#ERROR : Can't open dsspfile "1d1sA.bssp"
#ERROR : Can't open dsspfile "1cdoA.bssp"
#ERROR : Can't open dsspfile "1p0fA.bssp"
#ERROR : Can't open dsspfile "2fzwA.bssp"
#ERROR : Can't open dsspfile "2fzeA.bssp"
#ERROR : Can't open dsspfile "1rjwA.bssp"
#ERROR : Can't open dsspfile "1h2bB.bssp"
#ERROR : Can't open dsspfile "1h2bA.bssp"
#ERROR : Can't open dsspfile "1lluA.bssp"
#ERROR : Can't open dsspfile "2eihA.bssp"
#ERROR : Can't open dsspfile "2dfvA.bssp"
#ERROR : Can't open dsspfile "1uufA.bssp"
#ERROR : Can't open dsspfile "3ip1C.bssp"
#ERROR : Can't open dsspfile "3ip1A.bssp"
#ERROR : Can't open dsspfile "2dq4A.bssp"
#ERROR : Can't open dsspfile "3gfbA.bssp"
#ERROR : Can't open dsspfile "2d8aA.bssp"
#ERROR : Can't open dsspfile "2eerB.bssp"
#ERROR : Can't open dsspfile "2eerA.bssp"
#ERROR : Can't open dsspfile "1wlyA.bssp"
#ERROR : Can't open dsspfile "1vj0D.bssp"
#ERROR : Can't open dsspfile "1vj0B.bssp"
#ERROR : Can't open dsspfile "1vj0A.bssp"

## Summary of PDB Search
:366
    1e-68  42%  1f8fA  [b.35.1 - c.2.1] BENZYL ALCOHOL DEHYDROGENASE
    4e-36  31%  1hdyA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    4e-35  31%  1u3uA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE BETA CHAIN
    6e-35  31%  1hdzA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    1e-34  31%  1htbA  [b.35.1 - c.2.1] BETA3 ALCOHOL DEHYDROGENASE
    3e-34  30%  1hsoA  [b.35.1 - c.2.1] CLASS I ALCOHOL DEHYDROGENASE 1, ALPHA
    2e-33  31%  1e3lB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    2e-33  31%  1e3lA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    2e-33  31%  3cosD  [x.x.x] ALCOHOL DEHYDROGENASE 4
    2e-33  31%  3cosA  [x.x.x] ALCOHOL DEHYDROGENASE 4
    2e-32  32%  1u3wA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE GAMMA CHAIN
    3e-32  29%  1qv6A  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE E CHAIN
    3e-32  28%  1qlhA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    3e-32  30%  1e3eB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    3e-32  30%  1e3eA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    5e-32  29%  1mgoA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE E CHAIN
    5e-32  28%  1ju9A  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    7e-32  29%  1hetA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE E CHAIN
    7e-32  29%  1axgA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    9e-32  28%  1n8kA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE E CHAIN
    9e-32  29%  1axeA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    9e-32  29%  1a71A  [b.35.1 - c.2.1] LIVER ALCOHOL DEHYDROGENASE
    1e-30  28%  1ee2A  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    8e-30  29%  1d1tA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
    8e-30  29%  1d1sA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
    9e-29  30%  1cdoA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    8e-27  27%  1p0fA  [b.35.1 - c.2.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    5e-25  28%  2fzwA  [x.x.x] ALCOHOL DEHYDROGENASE CLASS III CHI CHAIN
    5e-25  28%  2fzeA  [b.35.1 - c.2.1 (1m6hA)] ALCOHOL DEHYDROGENASE CLASS III CHI
    8e-17  32%  1rjwA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    1e-14  28%  1h2bB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    1e-14  28%  1h2bA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    3e-14  33%  1lluA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    4e-13  38%  2eihA  [x.x.x] ALCOHOL DEHYDROGENASE
    2e-07  29%  2dfvA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    3e-07  27%  1uufA  [b.35.1 - c.2.1] ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE PROTEIN
    6e-07  26%  3ip1C  [x.x.x] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING
    6e-07  26%  3ip1A  [x.x.x] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING
    1e-06  29%  2dq4A  [x.x.x] L-THREONINE 3-DEHYDROGENASE
    2e-06  29%  3gfbA  [x.x.x] L-THREONINE 3-DEHYDROGENASE
    2e-05  32%  2d8aA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    7e-05  39%  2eerB  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    7e-05  39%  2eerA  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    2e-04  33%  1wlyA  [x.x.x] 2-HALOACRYLATE REDUCTASE
    8e-04  25%  1vj0D  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING
    8e-04  25%  1vj0B  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING
    8e-04  25%  1vj0A  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING
:366

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXXXXXXXXXXXX
1f8fA           ---IAAVTPCKGADFELQALKIRQPQGDEVLVKVVATGMCHTDLIVRDQKYPVPLPAVLGHEGSGIIEAI
1hdyA           ----AAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDDHVVSGNLVTPLPVILGHEAAGIVESV
1u3uA           ----AAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSGNLVTPLPVILGHEAAGIVESV
1hdzA           ----AAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICGTDDHVVSGNLVTPLPVILGHEAAGIVESV
1htbA           ----AAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSGNLVTPLPVILGHEAAGIVESV
1hsoA           ----AAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAVGICGTDDHVVSGTMVTPLPVILGHEAAGIVESV
1e3lB           ----AAIAWKTGSPLCIEEIEVSPPKACEVRIQVIATCVCHTDINATDPKKKALFPVVLGHECAGIVESV
1e3lA           ----AAIAWKTGSPLCIEEIEVSPPKACEVRIQVIATCVCHTDINATDPKKKALFPVVLGHECAGIVESV
3cosD           ----AAIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLFPVIVGHEAAGIVESI
3cosA           ----AAIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLFPVIVGHEAAGIVESI
1u3wA           ----AAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVTPLPVILGHEAAGIVESV
1qv6A           ----AAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDQVVSGTLVTPLPVIAGHEAAGIVESI
1qlhA           ----AAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESI
1e3eB           ----AAIAWKTGSPLCIEEIEVSPPKACEVRIQVIATCVCPTDINATDPKKKALFPVVLGHECAGIVESV
1e3eA           ----AAIAWKTGSPLCIEEIEVSPPKACEVRIQVIATCVCPTDINATDPKKKALFPVVLGHECAGIVESV
1mgoA           ----AAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESI
1ju9A           ----AAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESI
1hetA           ----AAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESI
1axgA           ----AAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESI
1n8kA           ----AAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESI
1axeA           ----AAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESI
1a71A           ----AAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESI
1ee2A           ----AAVLWEQKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDDHVVSGTLVAPLPVIAGHEAAGIVESI
1d1tA           ----AAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTMVSKFPVIVGHEATGIVESI
1d1sA           ----AAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTMVSKFPVIVGHEATGIVESI
1cdoA           ----AAVAWEANKPLVIEEIEVDVPHANEIRIKIIATGVCHTDLYLFEGKHKDGFPVVLGHEGAGIVESV
1p0fA           ----AAVAWEPHKPLSLETITVAPPKAHEVRIKILASGICGSDSSVLKEIIPSKFPVILGHEAVGVVESI
2fzwA           ----AAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPECFPVILGHLGAGIVESV
2fzeA           ----AAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPECFPVILGHEGAGIVESV
1rjwA           ----AAVVEQFKEPLKIKEVEKPTISYGEVLVRIKACGVCHTDLHAAHGDWPVKLPLXXXXXXXXXXXXX
1h2bB           ----AARLHEYNKPLRIE--DVDYPRLEDVIVRIAGAGVCHTDLHLVQGMWHELLPYTLGHENVGYIEEV
1h2bA           ----AARLHEYNKPLRIE--DVDYPRLEDVIVRIAGAGVCHTDLHLVQGMWHELLPYTLGHENVGYIEEV
1lluA           ----AAVVHAYGAPLRIEEVKVPLPGPGQVLVKIEASGVCHTDLHAAEGDWPVKLPFIPGHEXXXXXXXX
2eihA           ----AVVMRARGGPLEVADLPVPEPGPKEVRVRLKAAALNHLDVWVRKGVASPKLPHXXXXXXXXXXXXX
2dfvA           ---------------ELVEVDVPKPGPGEVLIKVLATSICGTDLHIQSRIKP---PQIGHXXXXXXXXXX
1uufA           ---------SAKQPLEPMDITRREPGPNDVKIEIAYCGVCHSDLQVRSEWAGTVYPCVPGHEIVGRVVAV
3ip1C           -------------------------KPTEIIIKVKACGICGSDVHAQTDLYPTGFPVTLGHEFSGVVVEA
3ip1A           -------------------------KPTEIIIKVKACGICGSDVHAQTDLYPTGFPVTLGHEFSGVVVEA
2dq4A           ----------------------------------------------------------------------
3gfbA           ---------------ELVEVDVPKPGPGEVLIKVLATSICGTDLHIQSRIKP---PQIMXXXXXXXXXXX
2d8aA           ----------------------------------------------------------------------
2eerB           ----------------------------------------------------------------------
2eerA           ----------------------------------------------------------------------
1wlyA           ----------------------------------------------------------------------
1vj0D           ----------------------------------------------------------------------
1vj0B           ----------------------------------------------------------------------
1vj0A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTAFSEDGEQVGSHFFGQSTF
1f8fA           GPNVTELQVGDHVVLSYGYCGKCTQCNTGNPAYCSEFFGRNFSGADSEGNHALC-----VNDHFFAQSSF
1hdyA           GEGVTTVKPGDKVIPLFTQCGKCRVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPI-HHFLGTSTF
1u3uA           GEGVTTVKPGDKVIPLFTQCGKCRVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPI-HHFLGTSTF
1hdzA           GEGVTTVKPGDKVIPLFTQCGKCRVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPI-HHFLGTSTF
1htbA           GEGVTTVKPGDKVIPLFTQCGKCRVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPI-HHFLGTSTF
1hsoA           GEGVTTVKPGDKVILAIPQCGKCRICKNPESNYCLKNDVSNPQGTLQDGTSRFTCRRKPI-HHFLGISTF
1e3lB           GPGVTNFKPGDKVIPFFAQCKRCKLCLSPLTNLCGKL--RNFKYPTEDRTSRFTCKGRSI-YHFMGVSSF
1e3lA           GPGVTNFKPGDKVIPFFAQCKRCKLCLSPLTNLCGKL--RNFKYPTEDRTSRFTCKGRSI-YHFMGVSSF
3cosD           GPGVTNVKPGDKVILYAPLCRKCKFCLSPLTNLCGKISNLKSPASMEDKTSRFTCKGKPV-YHFFGTSTF
3cosA           GPGVTNVKPGDKVILYAPLCRKCKFCLSPLTNLCGKISNLKSPASMEDKTSRFTCKGKPV-YHFFGTSTF
1u3wA           GEGVTTVKPGDKVIPLFTQCGKCRICKNPESNYCLKNDLGNPRGTLQDGTRRFTCSGKPI-HHFVGVSTF
1qv6A           GEGVTTVRPGDKVIPLFTQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPI-HHFLGTSTF
1qlhA           GEGVTTVRPGDKVIPLFTQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPI-HHFLGTSTF
1e3eB           GPGVTNFKPGDKVIPFFAQCKRCKLCLSPLTNLCGKL--RNFKYPTEDRTSRFTCKGRSI-YHFMGVSSF
1e3eA           GPGVTNFKPGDKVIPFFAQCKRCKLCLSPLTNLCGKL--RNFKYPTEDRTSRFTCKGRSI-YHFMGVSSF
1mgoA           GEGVTTVRPGDKVILATPQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPI-HHFLGTSTF
1ju9A           GEGVTTVRPGDKVIPLFTQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPI-HHFLGTSTF
1hetA           GEGVTTVRPGDKVIPLFTQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPI-HHFLGTSTF
1axgA           GEGVTTVRPGDKVIPLFTQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPI-HHFLGTSTF
1n8kA           GEGVTTVRPGDKVIPLFTQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPI-HHFLGTSTF
1axeA           GEGVTTVRPGDKVILWTPQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPI-HHFLGTSTF
1a71A           GEGVTTVRPGDKVILWTPQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPI-HHFLGTSTF
1ee2A           GEGVTTVRPGDKVILFIPQCGKCSVCKHPEGNLCLKNLSMPRG-TMQDGTSRFTCRGKPI-HHFLGTSTF
1d1tA           GEGVTTVKPGDKVILFLPQCRECNACRNPDGNLCIR-SDITGRGVLADGTTRFTCKGKPV-HHFLNTSTF
1d1sA           GEGVTTVKPGDKVILFLPQCRECNACRNPDGNLCIR-SDITGRGVLADGTTRFTCKGKPV-HHFMNTSTF
1cdoA           GPGVTEFQPGEKVILFISQCGECRFCQSPKTNQCVKGWANESPDVMSPKETRFTCKGRKV-LQFLGTSTF
1p0fA           GAGVTCVKPGDKVILFVPQCGSCRACKSSNSNFCEKNDMGAKTGLMADMTSRFTCRGKPI-YNLMGTSTF
2fzwA           GEGVTKLKAGDTVILYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTI-LHYMGTSTF
2fzeA           GEGVTKLKAGDTVILYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTI-LHYMGTSTF
1rjwA           XXXXTHLKVGDRVGIPYSACGHCDYCLSGQETLCE--HQKNAGYSVDGG--------------------Y
1h2bB           AEGVEGLEKGDPVILHAVTDGTCLACRAGEDMHCENL---EFPGLNIDGG-------------------F
1h2bA           AEGVEGLEKGDPVILHAVTDGTCLACRAGEDMHCENL---EFPGLNIDGG-------------------F
1lluA           XXXXTRVKEGDRVGIPYTACGCCEHCLTGWETLCES-----------QQNTGYSVNGG-----------Y
2eihA           XXXXEGFAPGDEVVINPGSCGRCERCLAGEDNLCPRY--------------------QILGEHRHG--TY
2dfvA           XXXXXXXXXDYVSVETHIVCGKCYACRRGQYHVCQN-------------TKIFGVDTDGV---------F
1uufA           GDQVEKYAPGDLVGVGVDSCKHCEECEDGLENYCDHMTGTYNSPTPDEPGHTLGGYSQQIVVH-------
3ip1C           GPEAINRRTNKRFEIGEPVCGHCRPCAEGFPNHCENLNELGFEYVKVDAKYAWSLEGVYEGDRLFLAGSL
3ip1A           GPEAINRRTNKRFEIGEPVCGHCRPCAEGFPNHCENLNELGFEYVKVDAKYAWSLEGVYEGDRLFLAGSL
2dq4A           ----------------------------------------------------------------------
3gfbA           XXXXXDLQVGDYISVETHICGKCYACKHNRYHVCQN-------------TKIFGVDMDGV---------F
2d8aA           ----------------------------------------------------------------------
2eerB           ----------------------------------------------------------------------
2eerA           ----------------------------------------------------------------------
1wlyA           ----------------------------------------------------------------------
1vj0D           ----------------------------------------------------------------------
1vj0B           ----------------------------------------------------------------------
1vj0A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXX
1f8fA           ATYALSRENNTVKVTKDVPIELLGPLGCGIQTGAGACINALKVTPASSFVTWXXXXXXXXXXXXXKVCGA
1hdyA           SQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGA
1u3uA           SQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGA
1hdzA           SQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGA
1htbA           SQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGA
1hsoA           SQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAIMGCKAAGA
1e3lB           SQYTVVSEANLARVDDEANLERVCLIGCGFSSGYGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGA
1e3lA           SQYTVVSEANLARVDDEANLERVCLIGCGFSSGYGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGA
3cosD           SQYTVVSDINLAKIDDDANLERVCLLGCGFSTGYGAAINNAKVTPGSTCAVFGLGGVGLSAVMGCKAAGA
3cosA           SQYTVVSDINLAKIDDDANLERVCLLGCGFSTGYGAAINNAKVTPGSTCAVFGLGGVGLSAVMGCKAAGA
1u3wA           SQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAXXXXXXXXXXXXXXCKAAGA
1qv6A           SQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGA
1qlhA           SQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGA
1e3eB           SQYTVVSEANLARVDDEANLERVCLIGCGFSSGYGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGA
1e3eA           SQYTVVSEANLARVDDEANLERVCLIGCGFSSGYGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGA
1mgoA           SQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGA
1ju9A           SQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGA
1hetA           SQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGA
1axgA           SQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGAGLSVIMGCKAAGA
1n8kA           SQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGA
1axeA           SQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGA
1a71A           SQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGAGLSVIMGCKAAGA
1ee2A           SQYTVVDEISVAKIDAASPLEKVCLVGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGA
1d1tA           TEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGKVKPGSTCXXXXXXXXXXXXIMGCKSAGA
1d1sA           TEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGKVKPGSTCXXXXXXXXXXXXIMGCKSAGA
1cdoA           SQYTVVNQIAVAKIDPSAPLDTVCLLGCGVSTGFGAAVNTAKVEPGSTCXXXXXXXXXXXXXXXCHSAGA
1p0fA           TEYTVVADIAVAKIDPKA-PLESCLIGCGFATGYGAAVNTAKVTPGSTCAVFGLGGVGFSAIVGCKAAGA
2fzwA           SEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSXXXXXXXXXXXXXXIMGCKVAGA
2fzeA           SEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSXXXXXXXXXXXXXXIMGCKVAGA
1rjwA           AEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYKA-LKVTGAKPGEWVAIYG-IGGLGHVAVQYAKAMG
1h2bB           AEFMRTSHRSVIKLPKDISREKLVEMAPLADAGITAYRAARTLYPGAYVAIVGVGGLGHIAVQLLKVMTP
1h2bA           AEFMRTSHRSVIKLPKDISREKLVEMAPLADAGITAYRAARTLYPGAYVAIVGVGGLGHIAVQLLKVMTP
1lluA           AEYVLADPNYVGILPKNVEFAEIAPILCAGVTVYKG-LKQTNARPGQWVAISGIGGLGHVAVQYARAMGL
2eihA           AEYVVLPEANLAPKPKNLSFEEAAAIPLTFLTAWQMVVDKLGVRPGDDVLVMXXXXXXXXXXIQIAKLFG
2dfvA           AEYAVVPAQNIWKNPKSIPPEYATLQEPLGNAVDTVLAGPI---SGKSVLITGAGPLGLLGIAVAKASGA
1uufA           ----------------------------------------------------------------------
3ip1C           VEPTSVAYNAV-------------------------IVRGGGIRPGDNVVILGGGPIGLAAVAILKHAGA
3ip1A           VEPTSVAYNAV-------------------------IVRGGGIRPGDNVVILGGGPIGLAAVAILKHAGA
2dq4A           ----------------------------------------------------------------------
3gfbA           AHYAIVPAKNAWKNPKDMPPEYAALQEPLGNAVDTVLAGPI---AGRSTLITGAGPLGLLGIAVAKASGA
2d8aA           ----------------------------------------------------------------------
2eerB           ----------------------------------------------------------------------
2eerA           ----------------------------------------------------------------------
1wlyA           ----------------------------------------------------------------------
1vj0D           ----------------------------------------------------------------------
1vj0B           ----------------------------------------------------------------------
1vj0A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXVDIHNSRLEMAKELGATHTINSKDEDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTV
1f8fA           SIIIAVDIVESRLELAKQLGATHVINSKTQDPVAAIKEITDGGVNFALESTGSPEILKQGVDALGILGKI
1hdyA           ARIIAVDINKDKFAKAKELGATECINPQDKPIQEVLKEMTDGGVDFSFEVIG--RLDTMMASLLCCHGTS
1u3uA           ARIIAVDINKDKFAKAKELGATECINPQDKPIQEVLKEMTDGGVDFSFEVIG--RLDTMMASLLCCHGTS
1hdzA           ARIIAVDINKDKFAKAKELGATECINPQDKPIQEVLKEMTDGGVDFSFEVIG--RLDTMMASLLCCHGTS
1htbA           ARIIAVDINKDKFAKAKELGATECINPQDKPIQEVLKEMTDGGVDFSFEVIG--RLDTMMASLLCCHGTS
1hsoA           ARIIAVDINKDKFAKAKELGATECINPQDKPIQEVLKEMTDGGVDFSFEVIG--RLDTMMASLLCCHGTS
1e3lB           SRIIAIDINGEKFPKAKALGATDCLNPRDKPVQDVITELTAGGVDYSLDCAGTAQTLKAAVDCTVLGGSC
1e3lA           SRIIAIDINGEKFPKAKALGATDCLNPRDKPVQDVITELTAGGVDYSLDCAGTAQTLKAAVDCTVLGGSC
3cosD           SRIIGIDINSEKFVKAKALGATDCLNPRDKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGGSC
3cosA           SRIIGIDINSEKFVKAKALGATDCLNPRDKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGGSC
1u3wA           ARIIAVDINKDKFAKAKELGATECINPQDKPIQEVLKEMTDGGVDFSFEVIG--QLDTMMASLLCCHGTS
1qv6A           ARIIGVDINKDRFAKAKEVGATECVNPQDKPIQEVLTEMSNGGVDFSFEVIGRLMVTALSCCQEAYGVSV
1qlhA           ARIIGVDINKDKFAKAKEVGATECVNPQDKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGV
1e3eB           SRIIAIDINGEKFPKAKALGATDCLNPRDKPVQDVITELTAGGVDYSLDCAGTAQTLKAAVDCTVLGGSC
1e3eA           SRIIAIDINGEKFPKAKALGATDCLNPRDKPVQDVITELTAGGVDYSLDCAGTAQTLKAAVDCTVLGGSC
1mgoA           ARIIGVDINKDKFAKAKEVGATECVNPQDKPIQEVLTEMSNGGVDFSFEVIGRLMVTALSCCQEAYGVSV
1ju9A           ARIIGVDINKDKFAKAKEVGATECVNPQDKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGV
1hetA           ARIIGVDINKDKFAKAKEVGATECVNPQDKPIQEVLTEMSNGGVDFSFEVIGRLMVTALSCCQEAYGVSV
1axgA           ARIIGVDINKDKFAKAKEVGATECVNPQDKPIQEVLTEMSNGGVDFSFEVIGRLMVTALSCCQEAYGVSV
1n8kA           ARIIGVDINKDKFAKAKEVGATECVNPQDKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGV
1axeA           ARIIGVDINKDKFAKAKEVGATECVNPQDKPIQEVLTEMSNGGVDFSFEVIGRLMVTALSCCQEAYGVSV
1a71A           ARIIGVDINKDKFAKAKEVGATECVNPQDKPIQEVLTEMSNGGVDFSFEVIGRLMVTALSCCQEAYGVSV
1ee2A           ARIIGVDINKDKFAKAKEVGATECVNPQDKPIQEVLTEMSNGGVDFSFEVIGMVAALSCCQEAYGVSVIV
1d1tA           SRIIGIDLNKDKFEKAMAVGATECISPKDSTKSEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNGTS
1d1sA           SRIIGIDLNKDKFEKAMAVGATECISPKDSTKSEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNGTS
1cdoA           KRIIAVDLNPDKFEKAKVFGATDFVNPNDEPISQVLSKMTNGGVDFSLECVGNVGVMRNALESLKGWGVS
1p0fA           SRIIGVGTHKDKFPKAIELGATECLNPKDYDKPEVICEKTNGGVDYAVECAGRIETMMNALQSTYCGSGV
2fzwA           SRIIGVDINKDKFARAKEFGATECINPQDKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWXX
2fzeA           SRIIGVDINKDKFARAKEFGATECINPQDKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWXX
1rjwA           LNVVAVDIGDEKLELAKELGADLVVNPLKEDAAKFMKEKXXXXXXXXXXXXSKPAF-QSAYNSIRRGGAC
1h2bB           ATVIALDVKEEKLKLAERLGADHVVDAR-RDPVKQVMELTGRGVNVAMDFVGSQATVDYTPYLLGRMGRL
1h2bA           ATVIALDVKEEKLKLAERLGADHVVDAR-RDPVKQVMELTGRGVNVAMDFVGSQATVDYTPYLLGRMGRL
1lluA           HVAA-IDIDDAKLELARKLGASLTVNARQEDPVEAIQRDIG-GAHGVLVTAVSNSAFGQAIGMARRGGTI
2eihA           ARVIATAGSEDKLRRAKALGADETVNYTHPDWPKEVRRLTGKGADKVVDHTGAL----------------
2dfvA           YPVIVSEPSDFRRELAKKVGADYVINPFEEDVVKEVDITDGNGVDVFLEFSGAPKALEQGLQAVTPAGRV
1uufA           ----------------------------------------------------------------------
3ip1C           SKVILSEPSEVRRNLAKELGADHVIDPTKENFVEAVLDYTGLGAKLFLEATGVPQLVWPQIEEVGINATV
3ip1A           SKVILSEPSEVRRNLAKELGADHVIDPTKENFVEAVLDYTGLGAKLFLEATGVPQLVWPQIEEVGINATV
2dq4A           --------------------ADRLVNPLEEDLLEVVRRVTGSGVEVLLEFSGNEAAIHQGLMALIPGGEA
3gfbA           YPVIVSEPSEFRRKLAKKVGADYVVNPFEEDPVKFVMDITGAGVEVFLEFSGAPKALEQGLKAVTPGGRV
2d8aA           -----------RRELAKKVGADYVINPFEEDVVKEVDITDGNGVDVFLEFSGAPKALEQGLQAVTPAGRV
2eerB           -----VDVREEALEAAKRAGADYVINASSQDPVSEIRRITGKGADAVID---------------------
2eerA           -----VDVREEALEAAKRAGADYVINASSQDPVSEIRRITGKGADAVID---------------------
1wlyA           -----------KAETARKLGCHHTINYSTQDFAEVVREITGKGVDVVYDSIGKDTL-QKSLDCLRPRGMC
1vj0D           ----------NRLKLAEEIGADLTLNRRETSVEERRKAIMGRGADFILEATGDXXXXXXXXXXXXXXXFY
1vj0B           ----------NRLKLAEEIGADLTLNRRETSVEERRKAIMGRGADFILEATGDXXXXXXXXXXXXXXXFY
1vj0A           ----------NRLKLAEEIGADLTLNRRETSVEERRKAIMGRGADFILEATGDXXXXXXXXXXXXXXXFY


                         .         *         .         .         .         .         +:350
query           GLVGAPAPGAEATFEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLVRTYPLEHINDAF
1f8fA           AVVGAPQLGTTAQFDVNDLLLGGKTILGVVEGSGSPKKFIPELVRLYQQGKFPFDQLVKFYAFDEINQAA
1hdyA           VIVGVP-PASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALIHVLPFEKINEGF
1u3uA           VIVGVP-PASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALIHVLPFEKINEGF
1hdzA           VIVGVP-PASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALIHVLPFEKINEGF
1htbA           VIVGVP-PASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALIHVLPFEKINEGF
1hsoA           VIVGVP-PDSQNLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALIHVLPFEKINEGF
1e3lB           TVVGAKVD--EMTIPT-VDVILGRSINGTFFGGWKSVDSVPNLVSDYKNKKFDLDLLVHALPFESINDAI
1e3lA           TVVGAKVD--EMTIPT-VDVILGRSINGTFFGGWKSVDSVPNLVSDYKNKKFDLDLLVHALPFESINDAI
3cosD           TFIGV-AAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALVHTLPFDKISEAF
3cosA           TFIGV-AAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALVHTLPFDKISEAF
1u3wA           VIVGVP-PDSQNLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALINVLPFEKINEGF
1qv6A           -IVGVP-PDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLIHVLPFEKINEGF
1qlhA           SVIVAVTPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLIHVLPFEKINEGF
1e3eB           TVVGAKVD--EMTIPT-VDVILGRSINGTFFGGWKSVDSVPNLVSDYKNKKFDLDLLVHALPFESINDAI
1e3eA           TVVGAKVD--EMTIPT-VDVILGRSINGTFFGGWKSVDSVPNLVSDYKNKKFDLDLLVHALPFESINDAI
1mgoA           -IVGVP-PDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLIHVLPFEKINEGF
1ju9A           SVISGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLIHVLPFEKINEGF
1hetA           -IVGVP-PDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLIHVLPFEKINEGF
1axgA           -IVGVP-PDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLIHVLPFEKINEGF
1n8kA           SVITGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLIHVLPFEKINEGF
1axeA           -IVGVP-PDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLIHVLPFEKINEGF
1a71A           -IVGVP-PDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLIHVLPFEKINEGF
1ee2A           GV----PPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLIHVLPFEKINEGF
1d1tA           VVVGVPPSAKMLTYD-PMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLIHVLPFKKISEGF
1d1sA           VVVGVPPSAKMLTYD-PMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLIHVLPFKKISEGF
1cdoA           VLVGWTDLHDVATRPIQLIAGRTWKGSMF--GGFKGKDGVPKMVKAYLDKKVKLDEFIHRMPLESVNDAI
1p0fA           TVVLGLASPNERXXXXXXXXXTGRSLKGSVFGGFKGEE-VSRLVDDYMKKKINVNFLVSTLTLDQINKAF
2fzwA           XXXXXXXXXXEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVHNLSFDEINKAF
2fzeA           XXXXXXXXXXEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVHNLSFDEINKAF
1rjwA           VLVGLPP--EEMPIPIFDTVLNGIKIIGSIVG---TRKDLQEALQFAAEGK--VKTIIEVQPLEKINEVF
1h2bB           IIVGY---GGELRFPTIRVISSEVSFEGSLVGNYVE---LHELVTLALQGKVRVE--VDIHKLDEINDVL
1h2bA           IIVGY---GGELRFPTIRVISSEVSFEGSLVGNYVE---LHELVTLALQGKVRVE--VDIHKLDEINDVL
1lluA           ALVGLP-PG-------------------------------------------------------------
2eihA           ----------------------------------------------------------------------
2dfvA           SLLG------------------------------------------------------------------
1uufA           ----------------------------------------------------------------------
3ip1C           AIVAAKIPLTGEVFQVRRAQIVG-----------------------------------------------
3ip1A           AIVAAKIPLTGEVFQVRRAQIVG-----------------------------------------------
2dq4A           RILGIPSD--PIRFDLAGELVMRGITAFGIAGRRLWQTWMTALVYSGRVDLSPL--LTHRLPLSRYREAF
3gfbA           SLLG------------------------------------------------------------------
2d8aA           SLLG------------------------------------------------------------------
2eerB           ----------------------------------------------------------------------
2eerA           ----------------------------------------------------------------------
1wlyA           AAYGHASGVADPIRVVEDLGVRGSLFIT------------------------------------------
1vj0D           SVAGVAVPQDPVPFKVYEWLVKNATFKGIWVSDT--SHFVKTVSITSRNYQLLSKLITHRLPLKEANKAL
1vj0B           SVAGVAVPQDPVPFKVYEWLVKNATFKGIWVSDT--SHFVKTVSITSRNYQLLSKLITHRLPLKEANKAL
1vj0A           SVAGVAVPQDPVPFKVYEWLVKNATFKGIWVSDT--SHFVKTVSITSRNYQLLSKLITHRLPLKEANKAL


                         .         .         .         .         *         .         .:420
query           ADSASGEVIKPIITFP
1f8fA           IDSRKGITLKPII---
1hdyA           DLLHSGKSIRTVLTF-
1u3uA           DLLHSGKSIRTVLTF-
1hdzA           DLLHSGKSIRTVLTF-
1htbA           DLLHSGKSICTVLTF-
1hsoA           DLLHSGKSIRTILMF-
1e3lB           DLMKEGKSIRTILTF-
1e3lA           DLMKEGKSIRTILTF-
3cosD           DLMNQGKSIRTILIF-
3cosA           DLMNQGKSIRTILIF-
1u3wA           DLLRSGKSIRTVLTF-
1qv6A           DLLRSGESIRTILTF-
1qlhA           DLLRSGESIRTILTF-
1e3eB           DLMKEGKSIRTILTF-
1e3eA           DLMKEGKSIRTILTF-
1mgoA           DLLRSGESIRTILTF-
1ju9A           DLLRSGESIRTILTF-
1hetA           DLLRSGESIRTILTF-
1axgA           DLLRSGESIRTILTF-
1n8kA           DLLRSGESIRTILTF-
1axeA           DLLRSGESIRTILTF-
1a71A           DLLRSGESIRTILTF-
1ee2A           DLLRSGKSIRTILTF-
1d1tA           ELLNSGQSIRTVLTF-
1d1sA           ELLNSGQSIRTVLTF-
1cdoA           DLMKHGKCIRTVLS--
1p0fA           ELLSSGQGVRSIMIY-
2fzwA           ELMHSGKSIRTVV---
2fzeA           ELMHSGKSIRTVV---
1rjwA           DRMLKGQI--------
1h2bB           ERLEKGEVLGRAVLIP
1h2bA           ERLEKGEVLGRAVLIP
1lluA           ----------------
2eihA           ----------------
2dfvA           ----------------
1uufA           ----------------
3ip1C           ----------------
3ip1A           ----------------
2dq4A           GLLASGQAVKVIL---
3gfbA           ----------------
2d8aA           ----------------
2eerB           ----------------
2eerA           ----------------
1wlyA           ----------------
1vj0D           ELMESREALKVIL---
1vj0B           ELMESREALKVIL---
1vj0A           ELMESREALKVIL---