[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF55431.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2wa9G.bssp"
#ERROR : Can't open dsspfile "2wa9B.bssp"
#ERROR : Can't open dsspfile "2wa9A.bssp"
#ERROR : Can't open dsspfile "2wa8C.bssp"
#ERROR : Can't open dsspfile "2wa8A.bssp"
#ERROR : Can't open dsspfile "2w9rA.bssp"
#ERROR : Can't open dsspfile "1r6qD.bssp"
#ERROR : Can't open dsspfile "1r6oD.bssp"
#ERROR : Can't open dsspfile "1r6oC.bssp"
#ERROR : Can't open dsspfile "1mbxC.bssp"
#ERROR : Can't open dsspfile "1mbuC.bssp"

## Summary of PDB Search
:100
    2e-04  38%  2wa9G  [x.x.x] ATP-DEPENDENT CLP PROTEASE ADAPTER PROTEIN CLPS
    2e-04  38%  2wa9B  [x.x.x] ATP-DEPENDENT CLP PROTEASE ADAPTER PROTEIN CLPS
    2e-04  38%  2wa9A  [x.x.x] ATP-DEPENDENT CLP PROTEASE ADAPTER PROTEIN CLPS
    2e-04  38%  2wa8C  [x.x.x] ATP-DEPENDENT CLP PROTEASE ADAPTER PROTEIN CLPS
    2e-04  38%  2wa8A  [x.x.x] ATP-DEPENDENT CLP PROTEASE ADAPTER PROTEIN CLPS
    2e-04  38%  2w9rA  [x.x.x] ATP-DEPENDENT CLP PROTEASE ADAPTER PROTEIN CLPS
    2e-04  38%  1r6qD  [x.x.x] ATP-DEPENDENT CLP PROTEASE ADAPTOR PROTEIN CLPS
    2e-04  38%  1r6oD  [x.x.x] ATP-DEPENDENT CLP PROTEASE ADAPTOR PROTEIN CLPS
    2e-04  38%  1r6oC  [x.x.x] ATP-DEPENDENT CLP PROTEASE ADAPTOR PROTEIN CLPS
    2e-04  38%  1mbxC  [d.45.1] PROTEIN YLJA
    2e-04  38%  1mbuC  [d.45.1] PROTEIN YLJA
:100

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxIVWDDPVNLMSYVTYVFQTVLGFSKKRATELMMQVHTEGKA
2wa9G           -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
2wa9B           -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
2wa9A           -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
2wa8C           -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
2wa8A           -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
2w9rA           -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
1r6qD           -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
1r6oD           -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
1r6oC           -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
1mbxC           -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
1mbuC           -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA


                         .         .         *         .         .         .         .:140
query           Vxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2wa9G           I-----------------------------
2wa9B           I-----------------------------
2wa9A           I-----------------------------
2wa8C           I-----------------------------
2wa8A           I-----------------------------
2w9rA           I-----------------------------
1r6qD           I-----------------------------
1r6oD           I-----------------------------
1r6oC           I-----------------------------
1mbxC           I-----------------------------
1mbuC           I-----------------------------