[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF55454.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1o8cC.bssp"
#ERROR : Can't open dsspfile "1o8cA.bssp"
#ERROR : Can't open dsspfile "1o89A.bssp"
#ERROR : Can't open dsspfile "1xa0A.bssp"
#ERROR : Can't open dsspfile "1xa0B.bssp"
#ERROR : Can't open dsspfile "1tt7A.bssp"
#ERROR : Can't open dsspfile "1lluA.bssp"
#ERROR : Can't open dsspfile "1h2bB.bssp"
#ERROR : Can't open dsspfile "1h2bA.bssp"
#ERROR : Can't open dsspfile "2vn8B.bssp"
#ERROR : Can't open dsspfile "2vn8A.bssp"
#ERROR : Can't open dsspfile "3fbgA.bssp"
#ERROR : Can't open dsspfile "2obyA.bssp"
#ERROR : Can't open dsspfile "3fbgB.bssp"
#ERROR : Can't open dsspfile "2j8zA.bssp"
#ERROR : Can't open dsspfile "1rjwA.bssp"
#ERROR : Can't open dsspfile "1yb5A.bssp"
#ERROR : Can't open dsspfile "3gmsA.bssp"

## Summary of PDB Search
:335
    2e-59  40%  1o8cC  [b.35.1 - c.2.1] YHDH
    2e-59  40%  1o8cA  [b.35.1 - c.2.1] YHDH
    1e-58  41%  1o89A  [b.35.1 - c.2.1] YHDH
    1e-53  42%  1xa0A  [b.35.1 - c.2.1] PUTATIVE NADPH DEPENDENT OXIDOREDUCTASES
    5e-53  43%  1xa0B  [b.35.1 - c.2.1] PUTATIVE NADPH DEPENDENT OXIDOREDUCTASES
    2e-47  37%  1tt7A  [b.35.1 - c.2.1] YHFP
    6e-09  24%  1lluA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    2e-07  25%  1h2bB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    2e-07  25%  1h2bA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    3e-06  26%  2vn8B  [x.x.x] RETICULON-4-INTERACTING PROTEIN 1
    3e-06  26%  2vn8A  [x.x.x] RETICULON-4-INTERACTING PROTEIN 1
    6e-06  23%  3fbgA  [x.x.x] PUTATIVE ARGINATE LYASE
    2e-05  25%  2obyA  [x.x.x] PUTATIVE QUINONE OXIDOREDUCTASE
    2e-05  22%  3fbgB  [x.x.x] PUTATIVE ARGINATE LYASE
    4e-05  24%  2j8zA  [x.x.x] QUINONE OXIDOREDUCTASE
    5e-05  24%  1rjwA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    6e-05  23%  1yb5A  [b.35.1 - c.2.1] QUINONE OXIDOREDUCTASE
    1e-04  26%  3gmsA  [x.x.x] PUTATIVE NADPH:QUINONE REDUCTASE
:335

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxVLTQDEDGNFSTAYQDTYSDPSFLGEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIP
1o8cC           ----------LLLEQQDGKTLASVQTL--DESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIP
1o8cA           ----------LLLEQQDGKTLASVQTL--DESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIP
1o89A           -----------------------------DESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIP
1xa0A           ---------------------TAGVQTISDD--LPEGDVLVRVHYSSVNYKDGLASIPDGKIVKT-PFVP
1xa0B           ---------------------TAGVQTISDD--LPEGDVLVRVHYSSVNYKDGLASIPDGKIVKT-PFVP
1tt7A           ---------------------------------LPKDGVLIKVAYSGINYKDGLAGKAGGNIVREYPLIL
1lluA           ----------------------------------GPGQVLVKIEASGVCHTDLHAAEGDWPVKPPLPFIP
1h2bB           ------------------------------PRLEGRFDVIVRIAGAGVCHTDLHLVQGHELLQPKLPYTL
1h2bA           ------------------------------PRLEGRFDVIVRIAGAGVCHTDLHLVQGHELLQPKLPYTL
2vn8B           ------------------------------------------------------------------PLTL
2vn8A           ------------------------------------------------------------------PLTL
3fbgA           ----------------DGNLFKTFNLDIPEPKV---HEILVKIQSISVNPVDTKQRLMD---VSKAPRVL
2obyA           --------------DKPGGPENLYVKEVAKPS-PGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNIL
3fbgB           ----------------DGNLFKTFNLDIPEPKV---HEILVKIQSISVNPVDTK-----QRLMDVSPRVL
2j8zA           --------------DKPGGPENLYVKEVAKPS-PGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNIL
1rjwA           ----------------------------------------------------------------------
1yb5A           --------------------------------------VLIKVHACGVNPVETYIRSGTYSRKPLLPYTP
3gmsA           -----------------GNPKDVLQVEYKNIEPLKDNEVFVRMLVRPINPSDLIPITGAYAHRIPLPNIP


                         .         .         *         .         .         .         .:140
query           GIDVVGTVIESADPRFGRGDEVVLNGAGLGENRHGGFTQRLKVPSEPLLHIPFNFSAQQVXXXXXXXXXX
1o8cC           GIDFAGTVRTSEDPRFHAGQEVLLTGWGVGENHWGGLAEQARVKGDWLVAMPQGLDARKAMIIGTAGFTA
1o8cA           GIDFAGTVRTSEDPRFHAGQEVLLTGWGVGENHWGGLAEQARVKGDWLVAMPQGLDARKAMIIGTAGFTA
1o89A           GIDFAGTVRTSEDPRFHAGQEVLLTGWGVGENHWGGLAEQARVKGDWLVAMPQGLDARKAMIIGTAGFTA
1xa0A           GIDLAGVVVSSQHPRFREGDEVIATGYEIGVTHFGGYSEYARLHGEWLVPLPKGLTLKEA-AIGTAGFTA
1xa0B           GIDLAGVVVSSQHPE---GDEVIATGYEIGVTHFGGYSEYARLHGEWLVPLPKGLTLKEAAIGTAGFTAA
1tt7A           GIDAAGTVVSSNDPRFAEGDEVIATSYELGVSRDGGLSEYASVPGDWLVPLPQNLSLKEA-VYGTAGFTA
1lluA           GHEXXXXXXXXXXXRVKEGDRVGISQQNTGYSVNGGYAEYVLADPNYVGILPKNVEFAEIAPILC-----
1h2bB           GHENVGYIEEVAEGVEGKGDPVILHPARAGEDMHGGFAEFMRTSHRSVIKLPKDISREKLVEMAPLADAG
1h2bA           GHENVGYIEEVAEGVEGKGDPVILHPARAGEDMHGGFAEFMRTSHRSVIKLPKDISREKLVEMAPLADAG
2vn8B           GRDVSGVVMECGDVKYFKGDEV---WAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTA
2vn8A           GRDVSGVVMECGDVKYFKGDEV---WAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTA
3fbgA           GFDAIGVVVGNEVTMFNQGDIVYYSGS---PDQNGSNAEYQLINERLVAKAPKNISAEQAVSLPLTGITA
2obyA           GLEASGHVAELGPGCQGHGDTAMALLPG------GGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTA
3fbgB           GFDAIGVVVGNEVTMFNQGDIVYYSGS---PDQNGSNAEYQLINERLVAKAPKNISAEQAVSLPLTGITA
2j8zA           GLEASGHVAELGPQHWKIGDTAMALLPG------GGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTA
1rjwA           -----------------------------GYSVDGGYAEYCRAAADYVVKIPDNLSFEEAAPIFCAGVT-
1yb5A           GSDVAGVIEAVGDSAFKKGDRVFTSST-----ISGGYAEYALAADHTVYKLPEKLDFKQ---GAAIGIPY
3gmsA           GYEGVG-IVENVGAFVSRE---LIGKRVLPLRGEGTWQEYVKTSADFVVPIPDSFTAAQMYINPLTAWVT


                         +         .         .         .         .         *         .:210
query           XXSVNALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGASDIIDRAE
1o8cC           MLCVMALEDAGVRPQDGEIXXXXXXXXXXXXXXXLLHKLGYQVVAVSGRESTH-EYLKSLGASRVLPRDE
1o8cA           MLCVMALEDAGVRPQDGEIXXXXXXXXXXXXXXXLLHKLGYQVVAVSGRESTH-EYLKSLGASRVLPRDE
1o89A           MLCVMALEDAGVRPQDGEIXXXXXXXXXXXXXXXLLHKLGYQVVAVSGRESTH-EYLKSLGASRVLPRDE
1xa0A           ALSIHRLEEHGLTPERGPVLVTGATGGVGSLAVSLA-KRGYTVEASTGKAAEH-DYLRVLGAKEVL----
1xa0B           L-SIHRLEEHGLTPERGPVLVTGATGGVGSLAVSLA-KRGYTVEASTGKAAEH-DYLRVLGAKEV-----
1tt7A           ALSVHRLEQNGLSPEK-XXXXXXXXXXXXXXXXXXLNKRGYDVVASTGNREA-ADYLKQLGASEVISRED
1lluA           ---AGVTVYKGLKQTNGQWVAISGIGGLGHVAVQYARAMGLHVAAID-IDDAKLELARKLGASLTVN-AR
1h2bB           ITAYRAVKKAARTLYPGAYVAIVGVGGLGHIAVQLLKVMTPATVIALDVKEEKLKLAERLGADHVVDRRD
1h2bA           ITAYRAVKKAARTLYPGAYVAIVGVGGLGHIAVQLLKVMTPATVIALDVKEEKLKLAERLGADHVVDRRD
2vn8B           WSAINKVGGLNDKNCTGKVLILGASGGVGTFAIQVMKAWDAHVTAVCS--QDASELVRKLGADDVIDYKS
2vn8A           WSAINKVGGLNDKNCTGKVLILGASGGVGTFAIQVMKAWDAHVTAVCS--QDASELVRKLGADDVIDYKS
3fbgA           YETLFDVISRNRNENEGKLLIINGAGGVGSIATQIAKAYGLRVITTASRNET-IEWTKKMGADIVLNHKE
2obyA           FQLLHLV---GNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPL-VTAGSQKKLQMAEKLGAAAGFNKED
3fbgB           YETLFDVISRNRNENEGKLLIINGAGGVGSIATQIAKAYGLRVITTASRNET-IEWTKKMGADIVLNHKE
2j8zA           FQLLHLV---GNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPL-VTAGSQKKLQMAEKLGAAAGFNKED
1rjwA           --TYKALKVTGAKP--GEWVAIYGIGGLGHVAVQYAKAMGLNVVAVDIGDE-KLELAKELGADLVVDAAK
1yb5A           FTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQN-GAHEVFNHRE
3gmsA           CTETLNLQRNDV------LLVNACGSAIGHLFAQLSQILNFRLIAVT-RNNKHTEELLRLGAAYVIDTAP


                         .         .         .         +         .         .         .:280
query           LSEKGRPLQKGRWAGVVDSVGSHTLVNAIAQTKWGGIVTACGMAQGPDLPGTVLPFILRGVHLVGINSVD
1o8cC           FAE-SRPLEKQVWAGAIDTVGDKVLAKVLAQMNYXXXXXXXXXXXXFTLPTTVMPFILRNVRLQGVDSVM
1o8cA           FAE-SRPLEKQVWAGAIDTVGDKVLAKVLAQMNYXXXXXXXXXXXXFTLPTTVMPFILRNVRLQGVDSVM
1o89A           FAE-SRPLEKQVWAGAIDTVGDKVLAKVLAQMNYXXXXXXXXXXXXFTLPTTVMPFILRNVRLQGVDSVM
1xa0A           ----ARELDKQRWAAAVDPVGGRTLATVLSR-RYGGAVAVSGLTGGAEVPTTVHPFILRGVSLLGIDSVY
1xa0B           LAERIRPLDKQRWAAAVDPVGGRTLATVLSR-RYGGAVAVSGLTGGAEVPTTVHPFILRGVSLLGIDSVY
1tt7A           VYDGTKALSKQQWQGAVDPVGGKQLASLLSKIQYGGSVAVSGLTGGGEVPATVYPFILRGVSLLGIDSVY
1lluA           QEDPVEAIQRGAHGVLVTAVSNSAFGQAIGMARRGGTIALVGLPPG-DFPTPIFDVVLKGLHIAGSTRAD
1h2bB           PVKQVMELTRGRGVNVMDFVGSQATVD-------------------------------------------
1h2bA           PVKQVMELTRGRGVNVMDFVGSQATVD-------------------------------------------
2vn8B           GSVEEQLKSLKPFDFILDNVGGST----------------------------------------------
2vn8A           GSVEEQLKSLKPFDFILDNVGGST----------------------------------------------
3fbgA           ----------------------------------------------------------------------
2obyA           FSEATLKFTKGAGVNILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLL------------
3fbgB           ----------------------------------------------------------------------
2j8zA           FSEATLKFTKGAGVNILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLL------------
1rjwA           FMKEKXXXXXXXXXXXXSKPAFQSAYNSIRR---GGACVLVGLPP-EEMPIPIFDTVLNGIKIIG--SIV
1yb5A           VN--------------------------------------------------------------------
3gmsA           LYETVMELTNGIGAAAIDSIG-------------------------------------------------


                         .         *         .         .         .         .         +:350
query           APRELRRRAWALLSEHLDTAVLDDMTTVIDVKDVAQAGEDLMAGKLHGRTAVRVH
1o8cC           TPPERRAQAWQRLVADLPESFYTQAAKEISLSEAPNFAEAIINNQIQGRTLVKVN
1o8cA           TPPERRAQAWQRLVADLPESFYTQAAKEISLSEAPNFAEAIINNQIQGRTLVKVN
1o89A           TPPERRAQAWQRLVADLPESFYTQAAKEISLSEAPNFAEAIINNQIQGRTLVKV-
1xa0A           CP-DLRLRIWERLAGDLKPD-LERIAQEISLAELPQALKRILRGELRGRTVVRL-
1xa0B           CP-DLRLRIWERLAGDLKPD-LERIAQEISLAELPQALKRILRGELRGRTVVRL-
1tt7A           CP-DVRAAVWERSSDLKPDQLLTIVDREVSLEETPGALKDILQNRIQGRVIVKL-
1lluA           LQEALDFAGEGLVKATIHPGKLDDINQILD---------QMRAGQIEGRIVLEM-
1h2bB           -------------------------------------------------------
1h2bA           -------------------------------------------------------
2vn8B           -------------------------------------------------------
2vn8A           -------------------------------------------------------
3fbgA           -------------------------------------------------------
2obyA           -------------------------------------------------------
3fbgB           -------------------------------------------------------
2j8zA           -------------------------------------------------------
1rjwA           GTRK-------DLQEALQFAAEGKVKTIIEVQPLEKINERMLKGQINGRVVL---
1yb5A           -------------------------------------------------------
3gmsA           -------------------------------------------------------