[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF55672.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1lqtB.bssp"
#ERROR : Can't open dsspfile "2c7gA.bssp"
#ERROR : Can't open dsspfile "1lqtA.bssp"
#ERROR : Can't open dsspfile "1lquA.bssp"
#ERROR : Can't open dsspfile "1e6eC.bssp"
#ERROR : Can't open dsspfile "1e6eA.bssp"
#ERROR : Can't open dsspfile "1cjcA.bssp"
#ERROR : Can't open dsspfile "2vdcG.bssp"
#ERROR : Can't open dsspfile "1ybpA.bssp"
#ERROR : Can't open dsspfile "1vqwA.bssp"
#ERROR : Can't open dsspfile "2bc1A.bssp"
#ERROR : Can't open dsspfile "2bc0A.bssp"

## Summary of PDB Search
:455
    8e-86  41%  1lqtB  [c.4.1 - c.3.1] FPRA
    5e-85  41%  2c7gA  [x.x.x] NADPH-FERREDOXIN REDUCTASE FPRA
    3e-84  42%  1lqtA  [c.4.1 - c.3.1] FPRA
    4e-84  42%  1lquA  [c.4.1 - c.3.1] FPRA
    5e-78  38%  1e6eC  [c.4.1 - c.3.1] NADPH\:ADRENODOXIN OXIDOREDUCTASE
    5e-78  38%  1e6eA  [c.4.1 - c.3.1] NADPH\:ADRENODOXIN OXIDOREDUCTASE
    5e-78  38%  1cjcA  [c.4.1 - c.3.1] PROTEIN (ADRENODOXIN REDUCTASE)
    2e-08  27%  2vdcG  [x.x.x] GLUTAMATE SYNTHASE [NADPH] SMALL CHAIN
    1e-04  36%  1ybpA  [x.x.x] PROTEIN WITH SIMILARITY TO FLAVIN-CONTAINING
    1e-04  36%  1vqwA  [c.3.1 - c.3.1] PROTEIN WITH SIMILARITY TO
    4e-04  33%  2bc1A  [x.x.x] NADH OXIDASE
    4e-04  33%  2bc0A  [x.x.x] NADH OXIDASE
:455

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxRPLRVAVVGAGPAGIYASDLLMKSDTDVQIDLFERMPAPFGLIRYGVAPDHPRIKGIVKSLHNVMDKE
1lqtB           --RPYYIAIVGSGPXXXXXXXXXXXEDLDMAVDMLEMLPTPWGLVRSGVAPDHPKIKSISKQFEKTAEDP
2c7gA           --RPYYIAIVGSGPXXXXXXXXXXXEDLDMAVDMLEMLPTPWGLVRSGVAPDQPKIKSISKQFEKTAEDP
1lqtA           --RPYYIAIVGSGPXXXXXXXXXXXEDLDMAVDMLEMLPTPWGLVRSGVAPDHPKIKSISKQFEKTAEDP
1lquA           --RPYYIAIVGSGPXXXXXXXXXXXEDLDMAVDMLEMLPTPWGLVRSGVAPDHPKIKSISKQFEKTAEDP
1e6eC           -----QICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSD
1e6eA           -----QICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSD
1cjcA           -----QICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSD
2vdcG           ------------------------------EVHVYDRYDRMGGLLVYGI-PGFKLEKSVVERRVKLLADA
1ybpA           -----KIAIIGAGPSGLVTAKALLAEKAFDQVTLFERRGSPGGVWNY-----------------------
1vqwA           -----KIAIIGAGPSGLVTAKALLAEKAFDQVTLFERRGSPGGVWNY-----------------------
2bc1A           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QLRFLGNIEVGKDITVEELREFYDAIVFSTGATGDQDLRVPGSDLEGSWGAGEFVGFYDGNPNFERNWDL
1lqtB           RFRFFGNVVVGEHVQPGELSERYDAVIYAVGAQSDRMLNIPGEDLPGSIAAVDFVGWYNAHPHFEQSPDL
2c7gA           RFRFFGNVVVGEHVQPGELSERYDAVIYAVGAQSDRMLNIPGEDLPGSIAAVDFVGWYNAHPHFEQSPDL
1lqtA           RFRFFGNVVVGEHVQPGELSERYDAVIYAVGAQSDRMLNIPGEDLPGSIAAVDFVGWYNAHPHFEQSPDL
1lquA           RFRFFGNVVVGEHVQPGELSERYDAVIYAVGAQSDRMLNIPGEDLPGSIAAVDFVGWYNAHPHFEQSPDL
1e6eC           RCAFYGNVEVGRDVTVQELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFVGWYNGLPNRELAPDL
1e6eA           RCAFYGNVEVGRDVTVQELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFVGWYNGLPNRELAPDL
1cjcA           RCAFYGNVEVGRDVTVQELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFVGWYNGLPNRELAPDL
2vdcG           GVIYHPNFEVGRDASLPELRRKHVAVLVATGVYKARDIKAPGSGLGNIVAALDYVSLGDTVEAYENSLNA
1ybpA           ----------------------------------------------------------------------
1vqwA           ----------------------------------------------------------------------
2bc1A           --------------------ETYDKLIF---ATGSQPILPPIKGAEIKEGSLEFEATLE-NLQFVKLYQN
2bc0A           --------------------ETYDKLIF---ATGSQPILPPIKGAEIKEGSLEFEATLE-NLQFVKLYQN


                         +         .         .         .         .         *         .:210
query           SAEKVAVVGVGNVALDVARILAKTGDELLVTEIPDNVYESLAKNQAKEVHVFGRRGPAQAKFTPLELKEL
1lqtB           SGARAVVIGNGNVALDVARILLTDPDVLARTDIADHALESLRPRGIQEVVIVGRRGPLQAAFTTLELREL
2c7gA           SGARAVVIGNGNVALDVARILLTDPDVLARTDIADHALESLRPRGIQEVVIVGRRGPLQAAFTTLELREL
1lqtA           SGARAVVIGNGNVALDVARILLTDPDVLARTDIADHALESLRPRGIQEVVIVGRRGPLQAAFTTLELREL
1lquA           SGARAVVIGNGNVALDVARILLTDPDVLARTDIADHALESLRPRGIQEVVIVGRRGPLQAAFTTLELREL
1e6eC           SCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREM
1e6eA           SCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREM
1cjcA           SCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREM
2vdcG           AGKHVVVLGGGDTAMDCVRTAIRQG---------------------------------------------
1ybpA           ----------------------------------------------------------------------
1vqwA           ----------------------------------------------------------------------
2bc1A           SADRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVD-----------------------------------
2bc0A           SADRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVD-----------------------------------


                         .         .         .         +         .         .         .:280
query           DHSDTIEVIVNPEDIDYDAASEQARRDSKSQDLVCQTLESYAMRDPKGAPHKLFIHFFESPVEILGEDGK
1lqtB           ADLDGVDVVIDPAELD-GITDEDAAAVGKVCKQNIKVLRGYADREPRPGHRRMVFRFLTSPIEIKGK-RK
2c7gA           ADLDGVDVVIDPAELD-GITDEDAAAVGKVCKQNIKVLRGYADREPRPGHRRMVFRFLTSPIEIKGK-RK
1lqtA           ADLDGVDVVIDPAELD-GITDEDAAAVGKVCKQNIKVLRGYADRERPGHRRMVF-RFLTSPIEIKGK-RK
1lquA           ADLDGVDVVIDPAELD-GITDEDAAAVGKVCKQNIKVLRGYADRERPGHRRMVF-RFLTSPIEIKGK-RK
1e6eC           IQLPGTRPMLDPADFLQDRIKEAARPRKRLMELLLRTTEKPGVEEXXXXXXXXXLRFFRSPQQVLSPDGR
1e6eA           IQLPGTRPMLDPADFLQDRIKEAARPRKRLMELLLRTTEKPGVEEXXXXXXXXXLRFFRSPQQVLSPDGR
1cjcA           IQLPGTRPMLDPADFLQDRIKEAARPRKRLMELLLRTTEKPGVEEXXXXXXXXXLRFFRSPQQVLSPDGR
2vdcG           ----------------------------------------------------------------------
1ybpA           ----------------------------------------------------------------------
1vqwA           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VVGLKTERTQLDGNGGVTGTGEFKTWDVQSVYRAVGYRSDAIEGVPFDDERAVVPNDGGHIIDPEVGSPI
1lqtB           VERIVLGRNELDGSGRVAATGEREELPAQLVVRSVGYRGVPTPGLPFDDQSGTIPNVGGRI----NGSP-
2c7gA           VERIVLGRNELDGSGRVAATGEREELPAQLVVRSVGYRGVPTPGLPFDDQSGTIPNVGGRI----NGSP-
1lqtA           VERIVLGRNELDGSGRVAATGEREELPAQLVVRSVGYRGVPTPGLPFDDQSGTIPNVGGRI----NGSP-
1lquA           VERIVLGRNELDGSGRVAATGEREELPAQLVVRSVGYRGVPTPGLPFDDQSGTIPNVGGRI----NGSP-
1e6eC           AAGIRLAVTRLEGIGEATPTGDVEDLPCGLVLSSIGYKSRPIDSVPFDPKLGVVPNMEGRVVD------V
1e6eA           AAGIRLAVTRLEGIGEATPTGDVEDLPCGLVLSSIGYKSRPIDSVPFDPKLGVVPNMEGRVVD------V
1cjcA           AAGIRLAVTRLEGIGEATPTGDVEDLPCGLVLSSIGYKSRPIDSVPFDPKLGVVPNMEGRVVD------V
2vdcG           ----------------------------------------------------------------------
1ybpA           ----------------------------------------------------------------------
1vqwA           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           TGLYATGWIKRGPIGLIGNTKSDAKETTEMLLADHAAGSLPAPAKPELESIIEFLDERKVAFTTWDGWHL
1lqtB           -NEYVVGWIKRGPTGVIGTNKKDAQDTVDTLIKNLGNAKEGAECKDHADQVADWLAARQPKLVTSAHWQV
2c7gA           -NEYVVGWIKRGPTGVIGTNKKDAQDTVDTLIKNLGNAKEGAECKDHADQVADWLAARQPKLVTSAHWQV
1lqtA           -NEYVVGWIKRGPTGVIGTNKKDAQDTVDTLIKNLGNAKEGAECKDHADQVADWLAARQPKLVTSAHWQV
1lquA           -NEYVVGWIKRGPTGVIGTNKKDAQDTVDTLIKNLGNAKEGAECKDHADQVADWLAARQPKLVTSAHWQV
1e6eC           PGLYCSGWVKRGPTGVITTTMTDSFLTGQILLQDLKAGHLPSGPRPGSAFIKALLDSRGVWPVSFSDWEK
1e6eA           PGLYCSGWVKRGPTGVITTTMTDSFLTGQILLQDLKAGHLPSGPRPGSAFIKALLDSRGVWPVSFSDWEK
1cjcA           PGLYCSGWVKRGPTGVITTTMTDSFLTGQILLQDLKAGHLPSGPRPGSAFIKALLDSRGVWPVSFSDWEK
2vdcG           ----------------------------------------------------------------------
1ybpA           ----------------------------------------------------------------------
1vqwA           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LDAAERALGEPEGRERKKIVEWNDMVRxxxxxxxx
1lqtB           IDAFERAAGEPHGRPRVKLASLAELLR--------
2c7gA           IDAFERAAGEPHGRPRVKLASLAELLR--------
1lqtA           IDAFERAAGEPHGRPRVKLASLAELLR--------
1lquA           IDAFERAAGEPHGRPRVKLASLAELLR--------
1e6eC           LDAEEVSRGQASGKPREKLLDPQEMLR--------
1e6eA           LDAEEVSRGQASGKPREKLLDPQEMLR--------
1cjcA           LDAEEVSRGQASGKPREKLLDPQEMLR--------
2vdcG           -----------------------------------
1ybpA           -----------------------------------
1vqwA           -----------------------------------
2bc1A           -----------------------------------
2bc0A           -----------------------------------