[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF55698.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2w1vA.bssp"
#ERROR : Can't open dsspfile "1f89A.bssp"
#ERROR : Can't open dsspfile "1emsB.bssp"
#ERROR : Can't open dsspfile "1emsA.bssp"
#ERROR : Can't open dsspfile "1j31A.bssp"
#ERROR : Can't open dsspfile "3hkxA.bssp"
#ERROR : Can't open dsspfile "1erzA.bssp"
#ERROR : Can't open dsspfile "1uf5A.bssp"
#ERROR : Can't open dsspfile "2ggkA.bssp"
#ERROR : Can't open dsspfile "1fo6A.bssp"
#ERROR : Can't open dsspfile "2gglA.bssp"
#ERROR : Can't open dsspfile "2vhiA.bssp"
#ERROR : Can't open dsspfile "2e11A.bssp"
#ERROR : Can't open dsspfile "2vhiE.bssp"
#ERROR : Can't open dsspfile "2vhiC.bssp"
#ERROR : Can't open dsspfile "2vhhC.bssp"
#ERROR : Can't open dsspfile "2vhhB.bssp"
#ERROR : Can't open dsspfile "2vhiH.bssp"
#ERROR : Can't open dsspfile "2vhhA.bssp"

## Summary of PDB Search
:266
    1e-34  34%  2w1vA  [x.x.x] NITRILASE HOMOLOG 2
    3e-22  29%  1f89A  [d.160.1] 32.5 KDA PROTEIN YLR351C
    2e-20  29%  1emsB  [d.160.1 - d.13.1] NIT-FRAGILE HISTIDINE TRIAD FUSION PROTEIN
    2e-20  29%  1emsA  [d.160.1 - d.13.1] NIT-FRAGILE HISTIDINE TRIAD FUSION PROTEIN
    1e-15  37%  1j31A  [d.160.1] HYPOTHETICAL PROTEIN PH0642
    2e-14  37%  3hkxA  [x.x.x] AMIDASE
    3e-14  32%  1erzA  [d.160.1] N-CARBAMYL-D-AMINO ACID AMIDOHYDROLASE
    1e-13  32%  1uf5A  [d.160.1] N-CARBAMYL-D-AMINO ACID AMIDOHYDROLASE
    1e-13  31%  2ggkA  [x.x.x] N-CARBAMOYL-D-AMINO ACID AMIDOHYDROLASE
    1e-13  31%  1fo6A  [d.160.1] N-CARBAMOYL-D-AMINO-ACID AMIDOHYDROLASE
    3e-13  31%  2gglA  [x.x.x] N-CARBAMOYL-D-AMINO ACID AMIDOHYDROLASE
    1e-07  27%  2vhiA  [x.x.x] CG3027-PA
    3e-07  27%  2e11A  [x.x.x] HYDROLASE
    9e-07  28%  2vhiE  [x.x.x] CG3027-PA
    9e-07  28%  2vhiC  [x.x.x] CG3027-PA
    9e-07  28%  2vhhC  [x.x.x] CG3027-PA
    9e-07  28%  2vhhB  [x.x.x] CG3027-PA
    4e-06  27%  2vhiH  [x.x.x] CG3027-PA
    3e-04  25%  2vhhA  [x.x.x] CG3027-PA
:266

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGEFSTAVKELA
2w1vA           -RLALIQLQVSSIKSDNLTRACSLVREAAKQGANIVSLPECFNSPYGTTYFPDYAEKIPGESTQKLSEVA
1f89A           IKVALVQLSGSSDKMANLQRAATFIERAMKEDTKLVVLPECFNSPYSTDQFRKYSEVINPEPSTSVQNLA
1emsB           --IAVCQMTSDNDLEKNFQAAKNMIERAGEKKCEMVFLPECFDFGLNKNEQIDLAMATDCEYMEKYRELA
1emsA           --IAVCQMTSDNDLEKNFQAAKNMIERAGEKKCEMVFLPECFDFGLNKNEQIDLAMATDCEYMEKYRELA
1j31A           ----------------NYSKAEKLIKEASKEGAKLVVLPEL----FDTGYNFESREEVEGETTTFL-ELA
3hkxA           MRIALMQHTARPDPQHNLDLIDDAAARASEQGAQLLLTPEL----FGFGYVPSQAEQVDAARSR-LRGIA
1erzA           --------------------LLDMLTKAASRGANFIVFPELALTTFFPRWHFTDEAELDSFYETEMPEKA
1uf5A           --------------------LLDMLTKAASRGANFIVFPELALTTFFPRWHFTDEAELDSFYETEMPEKA
2ggkA           --------------------LLDMLTNAASRGVNFIVFPELALTTFFPRWHFTDEAELDSFYETEMPETA
1fo6A           --------------------LLDMLTNAASRGVNFIVFPELALTTFFPRWHFTDEAELDSFYETEMPETA
2gglA           --------------------LLDMLTNAASRGVNFIVFPELALTTFFPRWHFTDEAELDSFYETEMPETA
2vhiA           ---------------------------AAEAGCNIVCTQEAWTMPFAC---EFAEEAENGPTTKMLAELA
2e11A           LRISLVQGSTRHDPAGNRDYYGALLEPLAGQ-SDLVILPETFTSGFSNEAID-KAEDMDGPTVAWIRTQA
2vhiE           ---------------------------AAEAGCNIVCTQEATREKFPWCEFAEEAE--NGPTTKMLAELA
2vhiC           ---------------------------AAEAGCNIVCTQEATREKFPWCEFAEEAE--NGPTTKMLAELA
2vhhC           ---------------------------AAEAGCNIVCTQEATREKFPWCEFAEEAE--NGPTTKMLAELA
2vhhB           ---------------------------AAEAGCNIVCTQEATREKFPWCEFAEEAE--NGPTTKMLAELA
2vhiH           ---------------------------AAEAGCNIVCTQEAWTMPFAC---EFAEEAENGPTTKMLAELA
2vhhA           ---------------------------AAEAGCNIVCTQEAWTMPXXXXXXXXXX---NGPTTKMLAELA


                         .         .         *         .         .         .         .:140
query           DELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQGYNKIHTYDAFGYRESDTVKPGDELVVFE
2w1vA           KESSIYLIGGSIP--------EEDAGKLYNTCSVFGGSLLVKHRKIHLFDKITFQESKTLSPGDSFSTFD
1f89A           NKFKIILVGGTIPELDP-----KTDKIYNTSIIFNEDGLIDKHRKVHLF-----HESETLSPGEKSTTID
1emsB           RKHNIWLSLGGLHHKDPSDAAHPW----NTHLIIDSDGVTRAYNKLHLFDLVRLMESEFSKAGTEMIPPV
1emsA           RKHNIWLSLGGLHHKDPSDAAHPW----NTHLIIDSDGVTRAYNKLHLFDLVRLMESEFSKAGTEMIPPV
1j31A           RELGLYIVAG------TAEKSGNYL--YNSAVVVGPRGYIGKYRKIHLF----YREKVFFEPGDGFKVFD
3hkxA           RDRGIALVWSLPGPEGPEQRGTAELADEHGEVLAS-------YQKVQLY---GPEEKAAFVPGEQPPVLS
1erzA           AELGIGFNLGY---AELVVEGGVK-RRFNTSILVDKSGKIVGYRKIHAYRPFQHLEKRYFEPGDGFPVYD
1uf5A           AELGIGFNLGY---AELVVEG-GVKRRFNTSILVDKSGKIVGYRKIHAYRPFQHLEKRYFEPGDGFPVYD
2ggkA           AELGIGFNLGY---AELVVEGGVK-RRFNTSILVDKSGKIVGYRKIHAYRPFQHLEKRYFEPGDGFPVYD
1fo6A           AELGIGFNLGY---AELVVEGGVK-RRFNTSILVDKSGKIVGYRKIHAYRPFQHLEKRYFEPGDGFPVYD
2gglA           AELGIGFNLGY---AELVVEGGVK-RRFNTSILVDKSGKIVGYRKIHAYRPFQHLEKRYFEPGDGFPVYD
2vhiA           KAYNMVIIHSILER--DMEHGETIW---NTAVVISNSGRYLGK---HRKNHIPYMEGNTGHP-----VFE
2e11A           ARLGAAITGSVQL------RTEHGV--FNRLLWATPDGALQYYDKRHLF-RFG-NEHLRYAAGRERLCVE
2vhiE           KAYNMVIIHSILER--DMEHGETIW---NTAVVISNSGRYLGKHRKNHIPRVGYMEGNTGHP-----VFE
2vhiC           KAYNMVIIHSILER--DMEHGETIW---NTAVVISNSGRYLGKHRKNHIPRVGYMEGNTGHP-----VFE
2vhhC           KAYNMVIIHSILER--DMEHGETIW---NTAVVISNSGRYLGKHRKNHIPRVGYMEGNTGHP-----VFE
2vhhB           KAYNMVIIHSILER--DMEHGETIW---NTAVVISNSGRYLGKHRKNHIPRVGYMEGNTGHP-----VFE
2vhiH           KAYNMVIIHSILER--DMEHGETIW---NTAVVISNSGRYLGKHRKNHIPM----EGNTGHP-----VFE
2vhhA           KAYNMVIIHSILER--DMEHGETIW---NTAVVISNSGRYLGK---HRKNHIPRMEGNTGHP-----VFE


                         +         .         .         .         .         *         .:210
query           VDDIKFGVATCYDIRFPEQFKDLARNDAQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARL
2w1vA           TPYCKVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFNLTTGP-AHWELLQRARAVDNQVYVATASPA--
1f89A           TKYGKFGVGICYDMRFPELAMLSARKGAFAMIYPSAFNTVTGPL-HWHLLARSRAVDNQVYVMLCSPA--
1emsB           DTPIRLGLSICYDVRFPELSLWNRKRGAQLLSFPSAFTLNTG-LAHWETLLRARAIENQCYVVAAAQTGA
1emsA           DTPIRLGLSICYDVRFPELSLWNRKRGAQLLSFPSAFTLNTG-LAHWETLLRARAIENQCYVVAAAQTGA
1j31A           IGFAKVGVI-CFDWFFPESARTLALKGAEIIAHPANLV---------PYAPRARALENRVYTITAD--RV
3hkxA           WGGRQLSLLVCYDVEFPEMVRAAAARGAQLVLVPTA----------------------------------
1erzA           VDAAKMGMFICNDRRWPEAWRVMGLRGAEIICTPTHNPPVPDHLTSFHLSMQAGSYQNGAWSAAAGKVGM
1uf5A           VDAAKMGMFIANDRRWPEAWRVMGLRGAEIICTPTHNPPVPDHLTSFHLSMQAGSYQNGAWSAAAGKAGM
2ggkA           VDAAKMGMFICNDRRWPETWRVMGLKGAEIICTPTHNPPVPDHLTSFHLSMQAGSYQNGAWSAAAGKVGM
1fo6A           VDAAKMGMFICNDRRWPETWRVMGLKGAEIICTPTHNPPVPDHLTSFHLSMQAGSYQNGAWSAAAGKVGM
2gglA           VDAAKMGMFICNDRRWPETWRVMGLKGAEIICTPTHNPPVPDHLTSFHLSMQCGSYQNGAWSAAAGKVGM
2vhiA           TEFGKLAVNICYGRHHPQNWMMFGLNGAEIVFNPSA---TIGRLSEWSIEARNAAIANSYFTVPINRVG-
2e11A           WKGWRINPQVCYDLRFPVFCRDVERPDFDLQLFVANWPS--ARAYAWKTLLRARAIENLCFVAAVNRVGV
2vhiE           TEFGKLAVNICYGRHHPQNWMMFGLNGAEIVFNPSA---TIGRLSEWSIEARNAAIANSYFTVRVGTEQF
2vhiC           TEFGKLAVNICYGRHHPQNWMMFGLNGAEIVFNPSA---TIGRLSEWSIEARNAAIANSYFTVRVGTEQF
2vhhC           TEFGKLAVNICYGRHHPQNWMMFGLNGAEIVFNPSA---TIGRLSEWSIEARNAAIANSYFTVRVGTEQF
2vhhB           TEFGKLAVNICYGRHHPQNWMMFGLNGAEIVFNPSA---TIGRLSEWSIEARNAAIANSYFTVRVGTEQF
2vhiH           TEFGKLAVNICYGRHHPQNWMMFGLNGAEIVFNPSA---TIGRLSEWSIEARNAAIANSYFTV-------
2vhhA           TEFGKLAVNICYGRHHPQNWMMFGLNGAEIVFNPSA---TIGRLSEWSIEARNAAIANSYFTVPINRVGT


                         .         .         .         +         .         .         .:280
query           PEELRDKRNGPTGIGHSMVANPHGQVIVSAGYEPEMLIVDIDVSDLSKIREALPVL
2w1vA           ----RDDKASYVAWGHSTVVDPWGQVLTKAGTEETILYSDIDLKKLAEIRQQIPIL
1f89A           ----RNLQSSYHAYGHSIVVDPRXXXXXXXXXXXXXXXXXLDPEVIESFRQAVPL-
1emsB           HNPKRQS------YGHSMVVDPWGAVVAQCSERVDMCFAEIDLSYVDTLREMQPV-
1emsA           HNPKRQS------YGHSMVVDPWGAVVAQCSERVDMCFAEIDLSYVDTLREMQPV-
1j31A           GEE-----RGLKFIGKSLIASPKAEVLIASETEEEIGVVEIDLN------------
3hkxA           --------------------------------------------------------
1erzA           EENC-------MLLGHSCIVAPTGEIVLTTTLEDEVITAAVDLDRCRELRE-----
1uf5A           EENC-------MLLGHSCIVAPTGEIVLTTTLEDEVITAAVDLDRCRELRE-----
2ggkA           EE-------GCMLLGHSCIVAPTGEIVLTTTLEDEVITAALDLDRCRELRE-----
1fo6A           EE-------GCMLLGHSCIVAPTGEIVLTTTLEDEVITAALDLDRCRELRE-----
2gglA           EE-------GCMLLGHSCIVAPTGEIVLTTTLEDEVITAALDLDRCRELRE-----
2vhiA           ----TEQFPGPF-YGSSYVAAPDGSRTPSLSRDKDLLVVELDLNLCRQVKD-----
2e11A           ------DGNQLHYAGDSAVIDFLGQPQVEIREQEQVVTTTISAAALAEHRARFPAM
2vhiE           PNEYTSKEFGPF-YGSSYVAAPDGSRTPSLSRDKDLLVVELDLNLCRQVKD-----
2vhiC           PNEYTSKEFGPF-YGSSYVAAPDGSRTPSLSRDKDLLVVELDLNLCRQVKD-----
2vhhC           PNEYTSKEFGPF-YGSSYVAAPDGSRTPSLSRDKDLLVVELDLNLCRQVKD-----
2vhhB           PNEYTSKEFGPF-YGSSYVAAPDGSRTPSLSRDKDLLVVELDLNLCRQVKD-----
2vhiH           PINRVGTEQGPF-YGSSYVAAPDGSRTPSLSRDKDLLVVELDLNLCRQVKD-----
2vhhA           EQF--------PFYGSSYVAAPDGSRTPSLSRDKDLLVVELDLNLCRQVKD-----