[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cglu2:BAF55908.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1velE.bssp"
#ERROR : Can't open dsspfile "1veiA.bssp"
#ERROR : Can't open dsspfile "1velC.bssp"
#ERROR : Can't open dsspfile "1velA.bssp"
#ERROR : Can't open dsspfile "1veqA.bssp"
#ERROR : Can't open dsspfile "1uvhA.bssp"
#ERROR : Can't open dsspfile "2yw7C.bssp"
#ERROR : Can't open dsspfile "2yw7A.bssp"
#ERROR : Can't open dsspfile "2yw6B.bssp"
#ERROR : Can't open dsspfile "2yw6A.bssp"
#ERROR : Can't open dsspfile "2yw7I.bssp"
#ERROR : Can't open dsspfile "2yw7H.bssp"
#ERROR : Can't open dsspfile "2yw7G.bssp"
#ERROR : Can't open dsspfile "2yw7B.bssp"
#ERROR : Can't open dsspfile "1f33F.bssp"
#ERROR : Can't open dsspfile "1f30A.bssp"
#ERROR : Can't open dsspfile "1dpsD.bssp"
#ERROR : Can't open dsspfile "1dpsB.bssp"
#ERROR : Can't open dsspfile "1dpsA.bssp"
#ERROR : Can't open dsspfile "1jtsJ.bssp"
#ERROR : Can't open dsspfile "1jtsC.bssp"
#ERROR : Can't open dsspfile "1jreE.bssp"
#ERROR : Can't open dsspfile "1jreC.bssp"
#ERROR : Can't open dsspfile "1jreA.bssp"
#ERROR : Can't open dsspfile "1o9rD.bssp"
#ERROR : Can't open dsspfile "1o9rC.bssp"
#ERROR : Can't open dsspfile "1o9rA.bssp"
#ERROR : Can't open dsspfile "1ji5A.bssp"
#ERROR : Can't open dsspfile "2f7nA.bssp"
#ERROR : Can't open dsspfile "2d5kC.bssp"
#ERROR : Can't open dsspfile "2d5kB.bssp"
#ERROR : Can't open dsspfile "2d5kA.bssp"
#ERROR : Can't open dsspfile "2c2fA.bssp"
#ERROR : Can't open dsspfile "3ge4A.bssp"
#ERROR : Can't open dsspfile "1jigA.bssp"
#ERROR : Can't open dsspfile "2z90B.bssp"
#ERROR : Can't open dsspfile "2z90A.bssp"
#ERROR : Can't open dsspfile "2ux1E.bssp"
#ERROR : Can't open dsspfile "1umnI.bssp"
#ERROR : Can't open dsspfile "1umnG.bssp"
#ERROR : Can't open dsspfile "1umnD.bssp"
#ERROR : Can't open dsspfile "1umnA.bssp"
#ERROR : Can't open dsspfile "2bw1G.bssp"
#ERROR : Can't open dsspfile "2wluA.bssp"
#ERROR : Can't open dsspfile "2wlaA.bssp"
#ERROR : Can't open dsspfile "2cf7G.bssp"
#ERROR : Can't open dsspfile "2cf7E.bssp"
#ERROR : Can't open dsspfile "2cf7C.bssp"
#ERROR : Can't open dsspfile "2cf7B.bssp"
#ERROR : Can't open dsspfile "2cf7A.bssp"
#ERROR : Can't open dsspfile "2chpC.bssp"
#ERROR : Can't open dsspfile "2chpB.bssp"
#ERROR : Can't open dsspfile "2chpA.bssp"
#ERROR : Can't open dsspfile "1n1qD.bssp"
#ERROR : Can't open dsspfile "1n1qC.bssp"
#ERROR : Can't open dsspfile "1n1qA.bssp"
#ERROR : Can't open dsspfile "2iy4U.bssp"
#ERROR : Can't open dsspfile "1qghA.bssp"
#ERROR : Can't open dsspfile "2iy4M.bssp"
#ERROR : Can't open dsspfile "2iy4B.bssp"
#ERROR : Can't open dsspfile "2iy4A.bssp"
#ERROR : Can't open dsspfile "2c2jA.bssp"
#ERROR : Can't open dsspfile "2bk6C.bssp"
#ERROR : Can't open dsspfile "2c41J.bssp"
#ERROR : Can't open dsspfile "2c41F.bssp"
#ERROR : Can't open dsspfile "2c41C.bssp"
#ERROR : Can't open dsspfile "2c41B.bssp"
#ERROR : Can't open dsspfile "2c41A.bssp"
#ERROR : Can't open dsspfile "2bkcR.bssp"
#ERROR : Can't open dsspfile "2bkcA.bssp"
#ERROR : Can't open dsspfile "2bk6A.bssp"
#ERROR : Can't open dsspfile "1mojB.bssp"
#ERROR : Can't open dsspfile "1mojA.bssp"
#ERROR : Can't open dsspfile "1ji4A.bssp"
#ERROR : Can't open dsspfile "2fjcB.bssp"
#ERROR : Can't open dsspfile "2bjyL.bssp"
#ERROR : Can't open dsspfile "2fjcC.bssp"
#ERROR : Can't open dsspfile "2fjcA.bssp"
#ERROR : Can't open dsspfile "2bjyH.bssp"
#ERROR : Can't open dsspfile "2bjyB.bssp"
#ERROR : Can't open dsspfile "2bjyA.bssp"
#ERROR : Can't open dsspfile "2pybA.bssp"
#ERROR : Can't open dsspfile "2qqyA.bssp"
#ERROR : Can't open dsspfile "3iq1C.bssp"
#ERROR : Can't open dsspfile "3iq1B.bssp"
#ERROR : Can't open dsspfile "3iq1A.bssp"

## Summary of PDB Search
:165
    3e-49  53%  1velE  [a.25.1] STARVATION-INDUCED DNA PROTECTING PROTEIN
    3e-49  53%  1veiA  [a.25.1] STARVATION-INDUCED DNA PROTECTING PROTEIN
    1e-48  53%  1velC  [a.25.1] STARVATION-INDUCED DNA PROTECTING PROTEIN
    1e-48  53%  1velA  [a.25.1] STARVATION-INDUCED DNA PROTECTING PROTEIN
    4e-48  55%  1veqA  [a.25.1] STARVATION-INDUCED DNA PROTECTING PROTEIN
    5e-48  55%  1uvhA  [x.x.x] STARVATION-INDUCED DNA PROTECTING PROTEIN
    7e-45  56%  2yw7C  [x.x.x] STARVATION-INDUCED DNA PROTECTING PROTEIN
    7e-45  56%  2yw7A  [x.x.x] STARVATION-INDUCED DNA PROTECTING PROTEIN
    7e-45  56%  2yw6B  [x.x.x] DNA PROTECTION DURING STARVATION PROTEIN
    7e-45  56%  2yw6A  [x.x.x] DNA PROTECTION DURING STARVATION PROTEIN
    9e-45  57%  2yw7I  [x.x.x] STARVATION-INDUCED DNA PROTECTING PROTEIN
    9e-45  57%  2yw7H  [x.x.x] STARVATION-INDUCED DNA PROTECTING PROTEIN
    9e-45  57%  2yw7G  [x.x.x] STARVATION-INDUCED DNA PROTECTING PROTEIN
    1e-44  57%  2yw7B  [x.x.x] STARVATION-INDUCED DNA PROTECTING PROTEIN
    1e-22  38%  1f33F  [a.25.1] DNA PROTECTION DURING STARVATION PROTEIN
    1e-22  38%  1f30A  [a.25.1] DNA PROTECTION DURING STARVATION PROTEIN
    1e-22  38%  1dpsD  [a.25.1] DPS
    1e-22  38%  1dpsB  [a.25.1] DPS
    1e-22  38%  1dpsA  [a.25.1] DPS
    1e-21  37%  1jtsJ  [a.25.1] DNA PROTECTION DURING STARVATION PROTEIN
    1e-21  37%  1jtsC  [a.25.1] DNA PROTECTION DURING STARVATION PROTEIN
    1e-21  37%  1jreE  [a.25.1] DNA PROTECTION DURING STARVATION PROTEIN
    1e-21  37%  1jreC  [a.25.1] DNA PROTECTION DURING STARVATION PROTEIN
    1e-21  37%  1jreA  [a.25.1] DNA PROTECTION DURING STARVATION PROTEIN
    2e-20  36%  1o9rD  [a.25.1] AGROBACTERIUM TUMEFACIENS DPS
    2e-20  36%  1o9rC  [a.25.1] AGROBACTERIUM TUMEFACIENS DPS
    2e-20  36%  1o9rA  [a.25.1] AGROBACTERIUM TUMEFACIENS DPS
    9e-16  30%  1ji5A  [a.25.1] DLP-1
    3e-15  30%  2f7nA  [x.x.x] DNA-BINDING STRESS RESPONSE PROTEIN, DPS FAMILY
    3e-15  25%  2d5kC  [x.x.x] DPS FAMILY PROTEIN
    3e-15  25%  2d5kB  [x.x.x] DPS FAMILY PROTEIN
    3e-15  25%  2d5kA  [x.x.x] DPS FAMILY PROTEIN
    3e-15  30%  2c2fA  [x.x.x] DNA-BINDING STRESS RESPONSE PROTEIN
    6e-15  33%  3ge4A  [x.x.x] DNA PROTECTION DURING STARVATION PROTEIN
    1e-13  27%  1jigA  [a.25.1] DLP-2
    5e-13  36%  2z90B  [x.x.x] STARVATION-INDUCIBLE DNA-BINDING PROTEIN OR FINE
    5e-13  36%  2z90A  [x.x.x] STARVATION-INDUCIBLE DNA-BINDING PROTEIN OR FINE
    2e-12  30%  2ux1E  [x.x.x] DNA PROTECTION DURING STARVATION PROTEIN
    2e-12  30%  1umnI  [a.25.1] DPS-LIKE PEROXIDE RESISTANCE PROTEIN
    2e-12  30%  1umnG  [a.25.1] DPS-LIKE PEROXIDE RESISTANCE PROTEIN
    2e-12  30%  1umnD  [a.25.1] DPS-LIKE PEROXIDE RESISTANCE PROTEIN
    2e-12  30%  1umnA  [a.25.1] DPS-LIKE PEROXIDE RESISTANCE PROTEIN
    2e-12  30%  2bw1G  [x.x.x] DPS-LIKE PEROXIDE RESISTANCE PROTEIN
    1e-11  29%  2wluA  [x.x.x] DPS-LIKE PEROXIDE RESISTANCE PROTEIN
    1e-11  29%  2wlaA  [x.x.x] DPS-LIKE PEROXIDE RESISTANCE PROTEIN
    2e-11  29%  2cf7G  [x.x.x] DPR
    2e-11  29%  2cf7E  [x.x.x] DPR
    2e-11  29%  2cf7C  [x.x.x] DPR
    2e-11  29%  2cf7B  [x.x.x] DPR
    2e-11  29%  2cf7A  [x.x.x] DPR
    4e-11  26%  2chpC  [x.x.x] METALLOREGULATION DNA-BINDING STRESS PROTEIN
    4e-11  26%  2chpB  [x.x.x] METALLOREGULATION DNA-BINDING STRESS PROTEIN
    4e-11  26%  2chpA  [x.x.x] METALLOREGULATION DNA-BINDING STRESS PROTEIN
    2e-10  35%  1n1qD  [a.25.1] DPS PROTEIN
    2e-10  35%  1n1qC  [a.25.1] DPS PROTEIN
    2e-10  35%  1n1qA  [a.25.1] DPS PROTEIN
    5e-09  27%  2iy4U  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    2e-08  26%  1qghA  [a.25.1] NON-HEME IRON-CONTAINING FERRITIN
    2e-08  26%  2iy4M  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    2e-08  26%  2iy4B  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    2e-08  26%  2iy4A  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    3e-08  29%  2c2jA  [x.x.x] DNA-BINDING STRESS RESPONSE PROTEIN
    5e-08  26%  2bk6C  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    9e-08  26%  2c41J  [x.x.x] DPS FAMILY DNA-BINDING STRESS RESPONSE PROTEIN
    9e-08  26%  2c41F  [x.x.x] DPS FAMILY DNA-BINDING STRESS RESPONSE PROTEIN
    9e-08  26%  2c41C  [x.x.x] DPS FAMILY DNA-BINDING STRESS RESPONSE PROTEIN
    9e-08  26%  2c41B  [x.x.x] DPS FAMILY DNA-BINDING STRESS RESPONSE PROTEIN
    9e-08  26%  2c41A  [x.x.x] DPS FAMILY DNA-BINDING STRESS RESPONSE PROTEIN
    3e-07  25%  2bkcR  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    3e-07  25%  2bkcA  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    3e-07  25%  2bk6A  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    4e-07  26%  1mojB  [a.25.1] DPS-LIKE FERRITIN
    4e-07  26%  1mojA  [a.25.1] DPS-LIKE FERRITIN
    1e-06  25%  1ji4A  [a.25.1] NEUTROPHIL-ACTIVATING PROTEIN A
    1e-06  27%  2fjcB  [x.x.x] ANTIGEN TPF1
    2e-06  25%  2bjyL  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    3e-06  26%  2fjcC  [x.x.x] ANTIGEN TPF1
    3e-06  26%  2fjcA  [x.x.x] ANTIGEN TPF1
    4e-06  24%  2bjyH  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    4e-06  24%  2bjyB  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    4e-06  24%  2bjyA  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    1e-05  35%  2pybA  [x.x.x] NEUTROPHIL ACTIVATING PROTEIN
    4e-05  33%  2qqyA  [x.x.x] SIGMA B OPERON
    6e-04  37%  3iq1C  [x.x.x] DPS FAMILY PROTEIN
    6e-04  37%  3iq1B  [x.x.x] DPS FAMILY PROTEIN
    6e-04  37%  3iq1A  [x.x.x] DPS FAMILY PROTEIN
:165

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MANYTVPGINENDAKQLIDGLQERLTDYNDLHLILKHVHWNVTGPNFIAVHEMLDPQVDLVRGYADEVAE
1velE           MTSFTIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE
1veiA           MTSFTIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE
1velC           --SFTIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE
1velA           --SFTIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE
1veqA           --SFTIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE
1uvhA           ----TIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE
2yw7C           ----------DKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE
2yw7A           ----------DKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE
2yw6B           ----------DKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE
2yw6A           ----------DKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE
2yw7I           -------------ASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE
2yw7H           -------------ASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE
2yw7G           -------------ASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE
2yw7B           ----------DKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE
1f33F           ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
1f30A           ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
1dpsD           ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
1dpsB           ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
1dpsA           ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
1jtsJ           ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALICHLATMAE
1jtsC           ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALICHLATMAE
1jreE           ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALICHLATMAE
1jreC           ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALICHLATMAE
1jreA           ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALICHLATMAE
1o9rD           -----------SNAKSTVIGLNESLASVIDLALVTKQAHWNLKGPQFIAVHELLDTFRTQLDNHGDTIAE
1o9rC           -----------SNAKSTVIGLNESLASVIDLALVTKQAHWNLKGPQFIAVHELLDTFRTQLDNHGDTIAE
1o9rA           -----------SNAKSTVIGLNESLASVIDLALVTKQAHWNLKGPQFIAVHELLDTFRTQLDNHGDTIAE
1ji5A           ---------------QVIEVLNKQVADWSVLFTKLHNFHWYVKGPQFFTLHEKFEELYTESATHIDEIAE
2f7nA           --------LEEKEFQTVAETLQRNLATTISLYLKFKKYHWDIRGRFFRDLHLAYDEFIAEIFPSIDEQAE
2d5kC           -----------SNQQDVVKELNQQVANWTVAYTKLHNFHWYVKGPNFFSLHVKFEELYNEASQYVDELAE
2d5kB           -----------SNQQDVVKELNQQVANWTVAYTKLHNFHWYVKGPNFFSLHVKFEELYNEASQYVDELAE
2d5kA           -----------SNQQDVVKELNQQVANWTVAYTKLHNFHWYVKGPNFFSLHVKFEELYNEASQYVDELAE
2c2fA           --------LEEKEFQTVAETLQRNLATTISLYLKFKKYHWDIRGRFFRDLHLAYDEFIAEIFPSIDEQAE
3ge4A           -----------NTKTTMIALLNENLAATIDLALITKQAHWNLKGPQFIAVHEMLDGFRAELDDHVDTIAE
1jigA           ----------------VVEVLNKQVANWNVLYVKLHNYHWYVTGPHFFTLHEKFEEFYNEAGTYIDELAE
2z90B           --------------------LQKVLVDLIELSLQGKQAHWNVVGSNFRDLHLQLDELVDFAREGSDTIAE
2z90A           --------------------LQKVLVDLIELSLQGKQAHWNVVGSNFRDLHLQLDELVDFAREGSDTIAE
2ux1E           --------------------LNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSE
1umnI           --------------------LNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSE
1umnG           --------------------LNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSE
1umnD           --------------------LNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSE
1umnA           --------------------LNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSE
2bw1G           --------------------LNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSE
2wluA           --------------------LNQAVADLSVAASIVHQVHWYMRGPGFLYLHPKMDELLDSLNANLDEVSE
2wlaA           --------------------LNQAVADLSVAASIVHQVHWYMRGPGFLYLHPKMDELLDSLNANLDEVSE
2cf7G           --------------------LNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLAEMSE
2cf7E           --------------------LNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLAEMSE
2cf7C           --------------------LNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLAEMSE
2cf7B           --------------------LNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLAEMSE
2cf7A           --------------------LNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLAEMSE
2chpC           ------------------NSLNTQLSNWFLLYSKLHRFHWYVKGPHFFTLHEKFEELYDHAAETVDTIAE
2chpB           ------------------NSLNTQLSNWFLLYSKLHRFHWYVKGPHFFTLHEKFEELYDHAAETVDTIAE
2chpA           ------------------NSLNTQLSNWFLLYSKLHRFHWYVKGPHFFTLHEKFEELYDHAAETVDTIAE
1n1qD           --------------------LNRQVANWVVLYVKLHNFHWNVNGPNFFTLHEKFEELYTEASGHIDTLAE
1n1qC           --------------------LNRQVANWVVLYVKLHNFHWNVNGPNFFTLHEKFEELYTEASGHIDTLAE
1n1qA           --------------------LNRQVANWVVLYVKLHNFHWNVNGPNFFTLHEKFEELYTEASGHIDTLAE
2iy4U           --------INSVDTKEF---LNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQMDEVAE
1qghA           --------------------LNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQMDEVAE
2iy4M           --------------------LNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQMDEVAE
2iy4B           --------------------LNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQMDEVAE
2iy4A           --------------------LNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQMDEVAE
2c2jA           --------------------------------------HWNVSGTLWYTLHELLQDHYEGISKFADDVAE
2bk6C           --------INSVDTKEF---LNHQVANLNVFTVKIHQIGWYMRGHNFFTLHEKMDDLYSEFGEQMDEVAE
2c41J           --------------EQVLTTLKREQANAVVMYLNYKKYHWLTYGPLFRDLHLLFEEQGSEVFAMIDELAE
2c41F           --------------EQVLTTLKREQANAVVMYLNYKKYHWLTYGPLFRDLHLLFEEQGSEVFAMIDELAE
2c41C           --------------EQVLTTLKREQANAVVMYLNYKKYHWLTYGPLFRDLHLLFEEQGSEVFAMIDELAE
2c41B           --------------EQVLTTLKREQANAVVMYLNYKKYHWLTYGPLFRDLHLLFEEQGSEVFAMIDELAE
2c41A           --------------EQVLTTLKREQANAVVMYLNYKKYHWLTYGPLFRDLHLLFEEQGSEVFAMIDELAE
2bkcR           --------------------LNHQVANLNVFTVKIHQIHWYMRGHNFFTLGEKMDDLYSEFGEQMDEVAE
2bkcA           --------------------LNHQVANLNVFTVKIHQIHWYMRGHNFFTLGEKMDDLYSEFGEQMDEVAE
2bk6A           --------------------LNHQVANLNVFTVKIHQIGWYMRGHNFFTLHEKMDDLYSEFGEQMDEVAE
1mojB           -------------AEQCVDALNADLANVYVLYHQLKKHHWNVEGAEFRDLHLFLGXXXXXXXXXXXXXXX
1mojA           -------------AEQCVDALNADLANVYVLYHQLKKHHWNVEGAEFRDLHLFLGXXXXXXXXXXXXXXX
1ji4A           ------------------------------LFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAE
2fjcB           ----SAPGVPDARAIAAIEQLRQHVADLGVLYIKLHNYHWHIYGIEFKQVHELLEEYYVSVTEAFDTIAE
2bjyL           ---------NSVDTKEF---LNHQVANLNVFTVKIHQIGWYMRGHNFFTLGEKMDDLYSEFGEQMDEVAE
2fjcC           ----------------ICEQLRQHVADLGVLYIKLHNYHWHIYGIEFKQVHELLEEYYVSVTEAFDTIAE
2fjcA           ----------------ICEQLRQHVADLGVLYIKLHNYHWHIYGIEFKQVHELLEEYYVSVTEAFDTIAE
2bjyH           --------------------LNHQVANLNVFTVKIHQIGWYMRGHNFFTLGEKMDDLYSEFGEQMDEVAE
2bjyB           --------------------LNHQVANLNVFTVKIHQIGWYMRGHNFFTLGEKMDDLYSEFGEQMDEVAE
2bjyA           --------------------LNHQVANLNVFTVKIHQIGWYMRGHNFFTLGEKMDDLYSEFGEQMDEVAE
2pybA           ------------DAIQL--KLQELLASLHIFYSNLRGIHWNIKDTNFFVIHKKTQKLYEYIEKIIDIVAE
2qqyA           -----------HDVKELIEGLNEDLAEYSAI--IYNHNAATVSGIYRQVLKPFFESEISDEQGHALYLAE
3iq1C           --------------------------------------HWNIQGKEFFELHAKFEEIYTDLQLKIDELAE
3iq1B           --------------------------------------HWNIQGKEFFELHAKFEEIYTDLQLKIDELAE
3iq1A           --------------------------------------HWNIQGKEFFELHAKFEEIYTDLQLKIDELAE


                         .         .         *         .         .         .         .:140
query           RISTLGGAPVGTPEGHVADRTPLQYERNAGNAQAHLTDLNRVYTQVLTGVRESMASAGPVDPVTEDIYIG
1velE           RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA
1veiA           RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA
1velC           RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA
1velA           RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA
1veqA           RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA
1uvhA           RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA
2yw7C           RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA
2yw7A           RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA
2yw6B           RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA
2yw6A           RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA
2yw7I           RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA
2yw7H           RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA
2yw7G           RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA
2yw7B           RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA
1f33F           RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
1f30A           RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
1dpsD           RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
1dpsB           RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
1dpsA           RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
1jtsJ           RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
1jtsC           RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
1jreE           RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
1jreC           RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
1jreA           RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
1o9rD           RVVQLGGTALGSLQA-VSSTTKLKYPTDIYKIHDHLDALIERYGEVANMIRKAIDDSDEADPTTADIFTA
1o9rC           RVVQLGGTALGSLQA-VSSTTKLKYPTDIYKIHDHLDALIERYGEVANMIRKAIDDSDEADPTTADIFTA
1o9rA           RVVQLGGTALGSLQA-VSSTTKLKYPTDIYKIHDHLDALIERYGEVANMIRKAIDDSDEADPTTADIFTA
1ji5A           RILAIGGKPVATMKEYL-EISSIQEAAYGETAEGMVEAIMKDYEMMLVELKKGMEIANSDDEMTSDLLLG
2f7nA           RLVALGGSPLAAPADLARYSTVQVPQETVRDARTQVADLVQDLSRVGKGYRDSQACDEANDPVTADMYNG
2d5kC           RILAVGGNPVGTLT-ECLEQSIVKEAAKGYSAEQMVEELSQDFTNISKQLENAIEIAGNADDVSEDMFIG
2d5kB           RILAVGGNPVGTLT-ECLEQSIVKEAAKGYSAEQMVEELSQDFTNISKQLENAIEIAGNADDVSEDMFIG
2d5kA           RILAVGGNPVGTLT-ECLEQSIVKEAAKGYSAEQMVEELSQDFTNISKQLENAIEIAGNADDVSEDMFIG
2c2fA           RLVALGGSPLAAPADLARYSTVQVPQETVRDARTQVADLVQDLSRVGKGYRDSQACDEANDPVTADMYNG
3ge4A           RAVQIGGTAYGTTQVVVKESRLKPYPTDIYAVHDHLVALIERYGDVANLVRKSIXXXXXXXXXXXXXXXX
1jigA           RILALEGKPLATMKEYLA-TSSVNEGTSKESAEEMVQTLVNDYSALIQELKEGMEVAGEADATSADMLLA
2z90B           RMRALDAVPDGRSDTVAATTTLPEFERSTADVVDLIT--TRINATVDT-IRRVHDAVDAEDPSTADLLHG
2z90A           RMRALDAVPDGRSDTVAATTTLPEFERSTADVVDLIT--TRINATVDT-IRRVHDAVDAEDPSTADLLHG
2ux1E           RLITLGGAPFSTSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEG--DSVTNDIFNV
1umnI           RLITLGGAPFSTSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEG--DSVTNDIFNV
1umnG           RLITLGGAPFSTSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEG--DSVTNDIFNV
1umnD           RLITLGGAPFSTSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEG--DSVTNDIFNV
1umnA           RLITLGGAPFSTSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEG--DSVTNDIFNV
2bw1G           RLITLGGAPFSTSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEG--DSVTNDIFNV
2wluA           RLITIGGAPYSTSKHSKLDEAKGTYDKTVAQHLARLVEVXXXXXQVGLDITDEEGDAG-----TNDLFTA
2wlaA           RLITIGGAPYSTSKHSKLDEAKGTYDKTVAQHLARLVEVXXXXXQVGLDITDEEGDAG-----TNDLFTA
2cf7G           RLITLGGAPFSTSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEG--DSVTNDIFNV
2cf7E           RLITLGGAPFSTSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEG--DSVTNDIFNV
2cf7C           RLITLGGAPFSTSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEG--DSVTNDIFNV
2cf7B           RLITLGGAPFSTSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEG--DSVTNDIFNV
2cf7A           RLITLGGAPFSTSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEG--DSVTNDIFNV
2chpC           RLLAIGGQPVATVKEY-TEHASITDGGNETSASEMVQALVNDYKQISSESKFVIGLAEEQDNATADLFVG
2chpB           RLLAIGGQPVATVKEY-TEHASITDGGNETSASEMVQALVNDYKQISSESKFVIGLAEEQDNATADLFVG
2chpA           RLLAIGGQPVATVKEY-TEHASITDGGNETSASEMVQALVNDYKQISSESKFVIGLAEEQDNATADLFVG
1n1qD           RVLSIGGSPIAT----------------------------------------------------------
1n1qC           RVLSIGGSPIAT----------------------------------------------------------
1n1qA           RVLSIGGSPIAT----------------------------------------------------------
2iy4U           RLLAIGGSPFSTLENASVEEAPYTKPKTMDQLMEDLVTLELLRDEYQQGIELTDKEG---DNVTNDMLIA
1qghA           RLLAIGGSPFSTLENASVEEAPYTKPKTMDQLMEDLVTLELLRDEYKQGIELTDKEG---DDVTNDMLIA
2iy4M           RLLAIGGSPFSTLENASVEEAPYTKPKTMDQLMEDLVTLELLRDEYQQGIELTDKEG---DNVTNDMLIA
2iy4B           RLLAIGGSPFSTLENASVEEAPYTKPKTMDQLMEDLVTLELLRDEYQQGIELTDKEG---DNVTNDMLIA
2iy4A           RLLAIGGSPFSTLENASVEEAPYTKPKTMDQLMEDLVTLELLRDEYQQGIELTDKEG---DNVTNDMLIA
2c2jA           RQLSVGASSDGRAITIVASRLPEIPGGFLDDAQV-IQFFTYQYETVGQRIHQRVGDVEKVDPTTANLLQE
2bk6C           RLLAIGGSPFSTLENASVEEAPYTKPKTMDQLMEDLVTLELLRDEYKQGIELTDKEG---DDVTNDMLIA
2c41J           RSLMLDGQPVADPADYVATVTPSSGQLTVKQMIEEAIANHELIITEMHQDAEIATEAGDIG--TADLYTR
2c41F           RSLMLDGQPVADPADYVATVTPSSGQLTVKQMIEEAIANHELIITEMHQDAEIATEAGDIG--TADLYTR
2c41C           RSLMLDGQPVADPADYVATVTPSSGQLTVKQMIEEAIANHELIITEMHQDAEIATEAGDIG--TADLYTR
2c41B           RSLMLDGQPVADPADYVATVTPSSGQLTVKQMIEEAIANHELIITEMHQDAEIATEAGDIG--TADLYTR
2c41A           RSLMLDGQPVADPADYVATVTPSSGQLTVKQMIEEAIANHELIITEMHQDAEIATEAGDIG--TADLYTR
2bkcR           RLLAIGGSPFSTLENASVEEAPYTKPKTMDQLMEDLVTLELLRDEYKQGIELTDKEG---DDVTNDMLIA
2bkcA           RLLAIGGSPFSTLENASVEEAPYTKPKTMDQLMEDLVTLELLRDEYKQGIELTDKEG---DDVTNDMLIA
2bk6A           RLLAIGGSPFSTLENASVEEAPYTKPKTMDQLMEDLVTLELLRDEYKQGIELTDKEG---DDVTNDMLIA
1mojB           RVQALGGVPHASPETLQAEASVDVEDEDVYDIRTSLANDMAIYGDIIEATRE------------------
1mojA           RVQALGGVPHASPETLQAEASVDVEDEDVYDIRTSLANDMAIYGDIIEATRE------------------
1ji4A           RIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKESNTAEKEGDKVTVTYADD
2fjcB           RLLQLGAAPASMAEYLALSGIAEETEKEITIVSA-LARVKRDFEYLSTRFSQTVLAAESGDAVTDGIITD
2bjyL           RLLAIGGSPFSTLENASVEEAPYTKPKTMDQLMEDLVTLELLRDEYKQGIELTDKEG---DDVTNDMLIA
2fjcC           RLLQLGAAPASMAEYLALSGIAEETEKEITIVSA-LARVKRDFEYLSTRFSQTVLAAESGDAVTDGIITD
2fjcA           RLLQLGAAPASMAEYLALSGIAEETEKEITIVSA-LARVKRDFEYLSTRFSQTVLAAESGDAVTDGIITD
2bjyH           RLLAIGGSPFSTLENASVEEAPYTKPKTMDQLMEDLVTLELLRDEYKQGIELTDKEG---DDVTNDMLIA
2bjyB           RLLAIGGSPFSTLENASVEEAPYTKPKTMDQLMEDLVTLELLRDEYKQGIELTDKEG---DDVTNDMLIA
2bjyA           RLLAIGGSPFSTLENASVEEAPYTKPKTMDQLMEDLVTLELLRDEYKQGIELTDKEG---DDVTNDMLIA
2pybA           RSRMLG----------------------------------------------------------------
2qqyA           KIKTLGGTPTTIPVKQAEDVRELEYARQS-----------------------------------------
3iq1C           RILTLSARP-------------------------------------------------------------
3iq1B           RILTLSARP-------------------------------------------------------------
3iq1A           RILTLSARP-------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QAAELEKFQWFIRAHIVDVDGNIxx
1velE           HAGELEKFQWFVRAHLESAGGQL--
1veiA           HAGELEKFQWFVRAHLESAGGQL--
1velC           HAGELEKFQWFVRAHLESAGGQL--
1velA           HAGELEKFQWFVRAHLESAGGQL--
1veqA           HAGELEKFQWFVRAHL---------
1uvhA           HAGELEKFQWFVRAHLESAGG----
2yw7C           HAGELEKFQWFVRAHL---------
2yw7A           HAGELEKFQWFVRAHL---------
2yw6B           HAGELEKFQWFVRAHL---------
2yw6A           HAGELEKFQWFVRAHL---------
2yw7I           HAGELEKFQWFVRAHL---------
2yw7H           HAGELEKFQWFVRAHL---------
2yw7G           HAGELEKFQWFVRAHL---------
2yw7B           HAGELEKFQWFVRAH----------
1f33F           ASRDLDKFLWFIESNI---------
1f30A           ASRDLDKFLWFIESNI---------
1dpsD           ASRDLDKFLWFIECNI---------
1dpsB           ASRDLDKFLWFIECNI---------
1dpsA           ASRDLDKFLWFIECNI---------
1jtsJ           ASRDLDKFLWFIESNI---------
1jtsC           ASRDLDKFLWFIESNI---------
1jreE           ASRDLDKFLWFIESNI---------
1jreC           ASRDLDKFLWFIESNI---------
1jreA           ASRDLDKFLWFIESNI---------
1o9rD           ASRDLDKSLWFLEAHV---------
1o9rC           ASRDLDKSLWFLEAHV---------
1o9rA           ASRDLDKSLWFLEAHV---------
1ji5A           IYTELEKHAWMLRAFL---------
2f7nA           YAATIDKIRWMLQAIMDD-------
2d5kC           MQTSVDKHNWMFKSYL---------
2d5kB           MQTSVDKHNWMFKSYL---------
2d5kA           MQTSVDKHNWMFKSYL---------
2c2fA           YAATIDKIRWMLQAIMDD-------
3ge4A           XSRSLDKALWFLEAHV---------
1jigA           IHTTLEQHVWMLSAFL---------
2z90B           LIDGLEKQAWLIRS-----------
2z90A           LIDGLEKQAWLIRS-----------
2ux1E           AKASIEKHIWMLQAEL---------
1umnI           AKASIEKHIWMLQAEL---------
1umnG           AKASIEKHIWMLQAEL---------
1umnD           AKASIEKHIWMLQAEL---------
1umnA           AKASIEKHIWMLQAEL---------
2bw1G           AKASIEKHIWMLQAEL---------
2wluA           AKTEAEKTIWMLQA-----------
2wlaA           AKTEAEKTIWMLQA-----------
2cf7G           AKASIEKHIWMLQAEL---------
2cf7E           AKASIEKHIWMLQAEL---------
2cf7C           AKASIEKHIWMLQAEL---------
2cf7B           AKASIEKHIWMLQAEL---------
2cf7A           AKASIEKHIWMLQAEL---------
2chpC           LIEEVEKQVWMLSSYL---------
2chpB           LIEEVEKQVWMLSSYL---------
2chpA           LIEEVEKQVWMLSSYL---------
1n1qD           -------------------------
1n1qC           -------------------------
1n1qA           -------------------------
2iy4U           FKASIDKHIWMFKAFL---------
1qghA           FKASIDKHIWMFKAFL---------
2iy4M           FKASIDKHIWMFKAFL---------
2iy4B           FKASIDKHIWMFKAFL---------
2iy4A           FKASIDKHIWMFKAFL---------
2c2jA           VEHIIEKYQWQMRAFL---------
2bk6C           FKASIDKHIWMFKAFL---------
2c41J           LVQTHQKHRWFLKEFLAKGDG----
2c41F           LVQTHQKHRWFLKEFLAKGDG----
2c41C           LVQTHQKHRWFLKEFLAKGDG----
2c41B           LVQTHQKHRWFLKEFLAKGDG----
2c41A           LVQTHQKHRWFLKEFLAKGDG----
2bkcR           FKASIDKHIWMFKAFL---------
2bkcA           FKASIDKHIWMFKAFL---------
2bk6A           FKASIDKHIWMFKAFL---------
1mojB           -------------------------
1mojA           -------------------------
1ji4A           QLAKLQKSIWMLQAHL---------
2fjcB           ILRTLGKAIWMLGA-----------
2bjyL           FKASIDKHIWMFKAFL---------
2fjcC           ILRTLGKAIWMLGA-----------
2fjcA           ILRTLGKAIWMLGA-----------
2bjyH           FKASIDKHIWMFKAFL---------
2bjyB           FKASIDKHIWMFKAFL---------
2bjyA           FKASIDKHIWMFKAFL---------
2pybA           -------------------------
2qqyA           -------------------------
3iq1C           -------------------------
3iq1B           -------------------------
3iq1A           -------------------------