[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF52967.1

[Show Plain Result]


## Summary of Sequence Search
    1::684
    7::675       0.0  68%  675 aa  GYRB_MYCSM RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    7::675       0.0  68%  675 aa  GYRB_MYCS2 RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    9::677       0.0  68%  677 aa  GYRB_MYCPA RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    9::675       0.0  69%  675 aa  GYRB_MYCTU RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    9::675       0.0  69%  675 aa  GYRB_MYCTA RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    8::678       0.0  63%  678 aa  GYRB_MYCLE RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   32::686       0.0  60%  686 aa  GYRB_STRCO RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   25::684       0.0  56%  684 aa  GYRBS_STRSH RecName: Full=DNA gyrase subunit B,
    1::638       0.0  53%  638 aa  GYRB_BACSU RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   25::677     e-178  53%  677 aa  GYRBR_STRSH RecName: Full=DNA gyrase subunit B,
    1::637     e-176  52%  637 aa  GYRB_CLOAB RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    4::639     e-172  51%  639 aa  GYRB_HALSQ RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    1::637     e-171  51%  637 aa  GYRB_BACHD RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    5::650     e-163  49%  650 aa  GYRB_MYCGE RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    9::636     e-162  50%  643 aa  GYRB_STAES RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    9::636     e-162  50%  643 aa  GYRB_STAEQ RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    1::647     e-162  51%  648 aa  GYRB_MYCGA RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    8::640     e-162  50%  640 aa  GYRB_BACAN RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    5::650     e-160  49%  650 aa  GYRB_MYCPN RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    2::631     e-160  51%  638 aa  GYRB_TREDE RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    8::648     e-158  50%  648 aa  GYRB_MYCHO RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   12::641     e-158  48%  648 aa  GYRB_STRR6 RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   12::641     e-158  48%  648 aa  GYRB_STRPN RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   15::643     e-157  48%  650 aa  GYRB_STRP3 RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    9::637     e-153  50%  644 aa  GYRB_STAAN RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    9::637     e-153  50%  644 aa  GYRB_STAAM RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    2::634     e-153  47%  634 aa  GYRB_BORHE RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    5::630     e-153  49%  637 aa  GYRB_TREPA RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   15::643     e-153  47%  650 aa  GYRB_STRP8 RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   15::643     e-153  47%  650 aa  GYRB_STRP6 RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    9::637     e-152  50%  644 aa  GYRB_STAAW RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    9::637     e-152  50%  644 aa  GYRB_STAAU RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    9::637     e-152  50%  644 aa  GYRB_STAAS RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    9::637     e-152  50%  644 aa  GYRB_STAA3 RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    4::636     e-152  50%  636 aa  GYRB_THEMA RecName: Full=DNA gyrase subunit B;       
    9::637     e-152  50%  644 aa  GYRB_STAAR RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    9::637     e-152  50%  644 aa  GYRB_STAAC RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   15::643     e-151  47%  650 aa  GYRB_STRP1 RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    7::639     e-147  46%  639 aa  GYRB_BORBU RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    5::604     e-145  49%  804 aa  GYRB_CHLMU RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    4::640     e-145  45%  640 aa  GYRB_SPICI RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    5::569     e-145  51%  805 aa  GYRB_CHLPN RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    6::632     e-144  48%  632 aa  GYRB_ARCFU RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    6::632     e-143  47%  655 aa  PARE_BACSU RecName: Full=DNA topoisomerase 4 subunit B;       
    2::769     e-143  51%  769 aa  GYRB_CAMJE RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   10::603     e-143  49%  638 aa  GYRB_MYCAT RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    3::804     e-140  50%  804 aa  GYRB_SHIFL RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    3::804     e-140  50%  804 aa  GYRB_ECOLI RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    3::804     e-140  50%  804 aa  GYRB_ECO57 RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    2::635     e-140  45%  663 aa  PARE_STAAW RecName: Full=DNA topoisomerase 4 subunit B;       
    2::635     e-140  45%  663 aa  PARE_STAAU RecName: Full=DNA topoisomerase 4 subunit B;       
    2::635     e-140  45%  663 aa  PARE_STAAN RecName: Full=DNA topoisomerase 4 subunit B;       
    2::635     e-140  45%  663 aa  PARE_STAAM RecName: Full=DNA topoisomerase 4 subunit B;       
    2::635     e-140  45%  663 aa  PARE_STAAC RecName: Full=DNA topoisomerase 4 subunit B;       
    2::635     e-140  45%  663 aa  PARE_STAA8 RecName: Full=DNA topoisomerase 4 subunit B;       
    5::590     e-140  48%  804 aa  GYRB_CHLTR RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    3::804     e-140  50%  804 aa  GYRB_SALTY RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    3::804     e-140  50%  804 aa  GYRB_SALTI RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    2::633     e-140  45%  663 aa  PARE_STAAR RecName: Full=DNA topoisomerase 4 subunit B;       
    2::635     e-139  45%  663 aa  PARE_STAAS RecName: Full=DNA topoisomerase 4 subunit B;       
   89::729     e-137  46%  729 aa  GYRB_ORYSJ RecName: Full=DNA gyrase subunit B,
    6::580     e-136  47%  792 aa  GYRB_AQUAE RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    9::638     e-135  45%  647 aa  PARE_STRPN RecName: Full=DNA topoisomerase 4 subunit B;       
    5::799     e-135  49%  806 aa  GYRB_HAEIN RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   90::721     e-134  44%  731 aa  GYRB_NICBE RecName: Full=DNA gyrase subunit B,
    5::556     e-131  47%  806 aa  GYRB_PSEAE RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    4::805     e-131  49%  805 aa  GYRB_VIBPA RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    4::626     e-130  44%  633 aa  PARE_MYCGA RecName: Full=DNA topoisomerase 4 subunit B;       
   10::807     e-130  48%  807 aa  GYRB_RICCN RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    3::805     e-129  49%  805 aa  GYRB_VIBCH RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    7::628     e-129  45%  643 aa  GYRB_MYCCT RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    4::626     e-128  44%  633 aa  PARE_MYCGE RecName: Full=DNA topoisomerase 4 subunit B;       
   18::815     e-128  52%  815 aa  GYRB_MYXXA RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    5::803     e-128  46%  803 aa  GYRB_BUCAI RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    7::580     e-128  45%  806 aa  GYRB_PSEPU RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   87::732     e-126  42%  732 aa  GYRBM_ARATH RecName: Full=DNA gyrase subunit B, mitochondrial;     
   10::808     e-126  47%  808 aa  GYRB_RICFE RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   10::808     e-126  48%  808 aa  GYRB_RICBR RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    2::804     e-125  46%  804 aa  GYRB_BUCBP RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    5::803     e-124  46%  803 aa  GYRB_BUCAP RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   11::647     e-124  41%  661 aa  GYRBP_ARATH RecName: Full=DNA gyrase subunit B, chloroplastic;     
    2::635     e-123  42%  664 aa  PARE_STAES RecName: Full=DNA topoisomerase 4 subunit B;       
    2::635     e-123  42%  664 aa  PARE_STAEQ RecName: Full=DNA topoisomerase 4 subunit B;       
    3::773     e-123  46%  773 aa  GYRB_HELPY RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    3::773     e-122  46%  773 aa  GYRB_HELPJ RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   10::807     e-122  46%  807 aa  GYRB_RICPR RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   10::807     e-121  46%  807 aa  GYRB_RICTY RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
    1::559     e-121  46%  781 aa  GYRB_NEIGO RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   10::595     e-120  45%  805 aa  GYRB_CAUCR RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   10::595     e-120  45%  805 aa  GYRB_CAUCN RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   55::687     e-120  44%  695 aa  PARE_CAUCR RecName: Full=DNA topoisomerase 4 subunit B;       
   50::692     e-120  42%  692 aa  GYRB_BARBK RecName: Full=DNA gyrase subunit B;         EC=5.99.1.3;
   17::649     e-120  41%  662 aa  PARE_RICCN RecName: Full=DNA topoisomerase 4 subunit B;       
    2::628     e-119  41%  635 aa  PARE_MYCPN RecName: Full=DNA topoisomerase 4 subunit B;       
   17::649     e-118  41%  662 aa  PARE_RICFE RecName: Full=DNA topoisomerase 4 subunit B;       
    1::478     e-114  48%  478 aa  GYRB_CYTAU RecName: Full=DNA gyrase subunit B;       
   20::649     e-114  41%  662 aa  PARE_RICBR RecName: Full=DNA topoisomerase 4 subunit B;       
    1::478     e-114  48%  478 aa  GYRB_CYTHU RecName: Full=DNA gyrase subunit B;       
   19::649     e-114  40%  662 aa  PARE_RICPR RecName: Full=DNA topoisomerase 4 subunit B;       
    1::478     e-113  49%  478 aa  GYRB_FLEEL RecName: Full=DNA gyrase subunit B;       
   20::650     e-112  40%  663 aa  PARE_RICTY RecName: Full=DNA topoisomerase 4 subunit B;       
    4::606     e-111  42%  629 aa  PARE_PSEAE RecName: Full=DNA topoisomerase 4 subunit B;       
    5::607     e-108  41%  630 aa  PARE_ECOLI RecName: Full=DNA topoisomerase 4 subunit B;       
    5::630     e-107  40%  630 aa  PARE_SALTY RecName: Full=DNA topoisomerase 4 subunit B;       
    5::630     e-107  40%  630 aa  PARE_SALTI RecName: Full=DNA topoisomerase 4 subunit B;       
    1::481     e-104  46%  481 aa  GYRB_FLEJA RecName: Full=DNA gyrase subunit B;       
    4::602     e-104  42%  632 aa  PARE_HAEIN RecName: Full=DNA topoisomerase 4 subunit B;       
    1::404     e-103  50%  404 aa  GYRB_BACCE RecName: Full=DNA gyrase subunit B;       
    1::404     e-102  50%  404 aa  GYRB_BACMY RecName: Full=DNA gyrase subunit B;       
    1::436     1e-86  43% 1078 aa  GYRB_SYNY3 RecName: Full=DNA gyrase subunit B;       
   19::388     2e-83  47%  388 aa  GYRB_ACIBA RecName: Full=DNA gyrase subunit B;       
   19::388     3e-82  46%  388 aa  GYRB_ACIHA RecName: Full=DNA gyrase subunit B;       
   19::389     8e-82  46%  389 aa  GYRB_ACIGB RecName: Full=DNA gyrase subunit B;       
   19::388     2e-81  46%  388 aa  GYRB_ACIJU RecName: Full=DNA gyrase subunit B;       
   19::390     3e-81  46%  390 aa  GYRB_ACILW RecName: Full=DNA gyrase subunit B;       
   19::390     3e-81  46%  390 aa  GYRB_ACIG9 RecName: Full=DNA gyrase subunit B;       
   19::388     4e-81  46%  388 aa  GYRB_ACIG3 RecName: Full=DNA gyrase subunit B;       
   19::388     5e-81  46%  388 aa  GYRB_ACICA RecName: Full=DNA gyrase subunit B;       
   19::388     5e-79  46%  388 aa  GYRB_ACIG6 RecName: Full=DNA gyrase subunit B;       
   19::389     2e-78  45%  389 aa  GYRB_ACIJO RecName: Full=DNA gyrase subunit B;       
    5::597     9e-70  35%  599 aa  PARE_BORBU RecName: Full=DNA topoisomerase 4 subunit B;       
    1::174     1e-34  45%  182 aa  GYRB_PROMI RecName: Full=DNA gyrase subunit B;       
   17::101     8e-34  52%  216 aa  GYRB_ACIS9 RecName: Full=DNA gyrase subunit B;       
   17::101     8e-34  52%  216 aa  GYRB_ACIS6 RecName: Full=DNA gyrase subunit B;       
   17::101     8e-34  54%  216 aa  GYRB_ACIGA RecName: Full=DNA gyrase subunit B;       
   17::101     1e-33  54%  216 aa  GYRB_ACIS8 RecName: Full=DNA gyrase subunit B;       
   17::101     3e-33  50%  216 aa  GYRB_ACIS7 RecName: Full=DNA gyrase subunit B;       
    1::134     5e-30  45%  134 aa  GYRB_RHOCA RecName: Full=DNA gyrase subunit B;       
  301::665     9e-25  29% 1520 aa  TOP2_CAEEL RecName: Full=Probable DNA topoisomerase 2;       
  168::532     3e-24  30% 1054 aa  TOP2M_CAEEL RecName: Full=Putative DNA topoisomerase 2,
  415::768     8e-24  29% 1284 aa  TOP2M_DICDI RecName: Full=DNA topoisomerase 2, mitochondrial;      
   85::307     2e-22  28% 1485 aa  TOP2_SCHPO RecName: Full=DNA topoisomerase 2;       
   65::607     2e-22  28% 1461 aa  TOP2_CANAL RecName: Full=DNA topoisomerase 2;       
  111::691     7e-22  27% 1521 aa  TOP2_DICDI RecName: Full=Probable DNA topoisomerase 2;       
   49::264     1e-21  29% 1612 aa  TOP2B_MOUSE RecName: Full=DNA topoisomerase 2-beta;       
   61::243     2e-21  30% 1626 aa  TOP2B_HUMAN RecName: Full=DNA topoisomerase 2-beta;       
   49::264     2e-21  29% 1612 aa  TOP2B_CRILO RecName: Full=DNA topoisomerase 2-beta;       
   66::287     3e-21  30% 1627 aa  TOP2B_CHICK RecName: Full=DNA topoisomerase 2-beta;       
  321::653     8e-21  29% 1398 aa  TOP2_PLAFK RecName: Full=DNA topoisomerase 2;       
   62::606     1e-20  29% 1400 aa  TOP2_PICGU RecName: Full=DNA topoisomerase 2;       
  299::623     2e-20  33% 1263 aa  TOP2_MIMIV RecName: Full=DNA topoisomerase 2;       
  266::630     3e-19  27% 1533 aa  TOP2A_PIG RecName: Full=DNA topoisomerase 2-alpha;       
  266::630     6e-19  28% 1531 aa  TOP2A_HUMAN RecName: Full=DNA topoisomerase 2-alpha;       
   88::634     7e-19  28% 1547 aa  TOP2_BOMMO RecName: Full=DNA topoisomerase 2;       
  363::629     7e-19  33% 1528 aa  TOP2A_MOUSE RecName: Full=DNA topoisomerase 2-alpha;       
   71::257     2e-18  30% 1587 aa  TOP2_PENCH RecName: Full=DNA topoisomerase 2;       
  302::549     3e-18  31% 1462 aa  TOP2_PEA RecName: Full=DNA topoisomerase 2;       
   41::223     3e-18  28% 1473 aa  TOP2_ARATH RecName: Full=DNA topoisomerase 2;       
   39::260     4e-18  31% 1526 aa  TOP2A_CRIGR RecName: Full=DNA topoisomerase 2-alpha;       
   39::259     1e-17  31% 1526 aa  TOP2A_RAT RecName: Full=DNA topoisomerase 2-alpha;       
   41::262     2e-17  30% 1553 aa  TOP2A_CHICK RecName: Full=DNA topoisomerase 2-alpha;       
   61::242     4e-17  28% 1447 aa  TOP2_DROME RecName: Full=DNA topoisomerase 2;       
  309::615     9e-17  29% 1113 aa  TOP2_IIV3 RecName: Full=DNA topoisomerase 2;       
   17::176     3e-16  29% 1406 aa  TOP2_CANGA RecName: Full=DNA topoisomerase 2;       
   18::177     4e-16  30% 1428 aa  TOP2_YEAST RecName: Full=DNA topoisomerase 2;       
  259::525     5e-12  29% 1132 aa  TOP2_IIV6 RecName: Full=DNA topoisomerase 2;       
   10::198     7e-12  28% 1221 aa  TOP2_TRYBB RecName: Full=DNA topoisomerase 2;       
    4::188     1e-11  35%  516 aa  TOPL_BPT4 RecName: Full=DNA topoisomerase large subunit;       
  349::646     4e-09  28% 1236 aa  TOP2_LEICH RecName: Full=DNA topoisomerase 2;       
  261::661     5e-09  26% 1192 aa  TOP2_ASFP4 RecName: Full=DNA topoisomerase 2;       
  261::661     9e-09  26% 1192 aa  TOP2_ASFWA RecName: Full=DNA topoisomerase 2;       
  266::661     9e-09  27% 1192 aa  TOP2_ASFK5 RecName: Full=DNA topoisomerase 2;       
  261::661     1e-08  26% 1192 aa  TOP2_ASFB7 RecName: Full=DNA topoisomerase 2;       
  261::660     3e-08  26% 1191 aa  TOP2_ASFM2 RecName: Full=DNA topoisomerase 2;       
    3::198     1e-07  26% 1232 aa  TOP2_TRYCR RecName: Full=DNA topoisomerase 2;       
    3::168     5e-07  26% 1239 aa  TOP2_CRIFA RecName: Full=DNA topoisomerase 2;       
   29::160     5e-05  25%  160 aa  TOPS_BPT4 RecName: Full=DNA topoisomerase small subunit;       
    1::684

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MANTEHNYDASSITILEGLEAVRKRPGMYIGSTGPRGLHHLIWEVVDNSVDEAMAGHATKVEVTLLEXXX
GYRB_MYCSM      --NAPKEYGADSITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAGFATRVDVKIHADGS
GYRB_MYCS2      --NAPKEYGADSITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAGFATRVDVKIHADGS
GYRB_MYCPA      ----QDEYGASAITVLEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNSVDEAMAGYADRVDVRILDDGS
GYRB_MYCTU      ----QDEYGAASITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAGYATTVNVVLLEDGG
GYRB_MYCTA      ----QDEYGAASITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAGYATTVNVVLLEDGG
GYRB_MYCLE      ----QDEYGAASITILEGLEAVRKRPGMYVGSTGERGLHHLIWEVVDNSVDEAMAGYATQVDVRLFDDGS
GYRB_STRCO      ------SYDASAITVLEGLDAVRKRPGMYIGSTGERGLHHLVQEVVDNSVDEALAGHADTIDVTILPXXX
GYRBS_STRSH     ------SYNASAITVLEGLDAVRKRPGMYIGSTGERGLHHLVTEVVDNSVDEALAGHADTIDVTILAXXX
GYRB_BACSU      MEQQQNSYDENQIQVLEGLEAVRKRPGMYIGSTNSKGLHHLVWEIVDNSIDEALAGYCTDINIQIEKDNS
GYRBR_STRSH     ------SYDANAITVLDGLDAVRKRPGMYIGSTGERGLHHLVQELVDNSVDEALAGVADRIDVTVLAXXX
GYRB_CLOAB      MSEKNEIYDESQIQVLEGLEAVRKRPGMYIGSTGTRGLHHLVYEIVDNSIDEALAGYCSHIKVFIHKDNS
GYRB_HALSQ      ----DNEYGAGQIQVLEGLEAVRKRPAMYIGSTDSRGLHHLVYEVVDNSIDEALAGHCDAIEVALHEDGS
GYRB_BACHD      MTREQQAYDESQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVWEIVDNSIDEAMAGFCDEIGVVIEEDNS
GYRB_MYCGE      --NKANIYDSSSIKVLEGLEAVRKRPGMYIGSTGEEGLHHMIWEIVDNSIDEAMGGFASFVKLTLEDNFV
GYRB_STAES      --NNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYASHIEVVIEKDNW
GYRB_STAEQ      --NNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYASHIEVVIEKDNW
GYRB_MYCGA      MNNTKKDYSSQSIKVLEGLSAVRKRPGMYIGSTDQKGLHHMIWEIIDNSVDEMMAGYGTTVKLTLKDNYL
GYRB_BACAN      ----ENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNS
GYRB_MYCPN      --NKTQAYDSSSIKILEGLEAVRKRPGMYIGSTGEEGLHHMIWEIIDNSIDEAMGGFASTVKLTLKDNFV
GYRB_TREDE      ---TKSNYSANNITVLKGLEAVRKRPGMYIGSTGPDGLHHLVYEVVDNCIDEAMAGFCDKILVVLEPNDI
GYRB_MYCHO      -----HKYNADNIQILEGLEAVRKRPGMYIGSIGFKGLHHLLWEIVDNSVDEAMAGFATEIKIKLYPNNV
GYRB_STRR6      ------DYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDS
GYRB_STRPN      ------DYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDS
GYRB_STRP3      -------YDASQIQVLEGLEAVRMRPGMYIGSTAKEGLHHLVWEIVDNSIDEALAGFASHIKVFIEADNS
GYRB_STAAN      --NNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANKIEVVIEKDNW
GYRB_STAAM      --NNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANKIEVVIEKDNW
GYRB_BORHE      ------SYVASNIQVLKGLEAVRKRPGMYIGSVSINGLHHLVYEVVDNSIDEALAGFCDKIEVVINSDNS
GYRB_TREPA      -------YSASSITVLEGLEAVRKRPGMYIGSTGPNGLHHLVYEVVDNCIDEAMAGYCDRITVVLEQGNV
GYRB_STRP8      -------YDASQIQVLEGLEAVRMRPGMYIGSTAKEGLHHLVWEIVDNSIDEALAGFASHIKVFIEADNS
GYRB_STRP6      -------YDASQIQVLEGLEAVRMRPGMYIGSTAKEGLHHLVWEIVDNSIDEALAGFASHIKVFIEADNS
GYRB_STAAW      --NNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNW
GYRB_STAAU      --NNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNW
GYRB_STAAS      --NNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNW
GYRB_STAA3      --NNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNW
GYRB_THEMA      -------YSAESIKVLKGLEPVRMRPGMYIGSTGKRGLHHLVYEVVDNSVDEALAGYCDWIRVTLHEDGS
GYRB_STAAR      --NNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNW
GYRB_STAAC      --NNTDNYGAGQIQVLEGLEAARKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNW
GYRB_STRP1      -------YDASQIQVLEGLEAVRMRPGMYIGSTAKEGLHHLVWEIVDNSIDEALAGFASHIKVFIEADNS
GYRB_BORBU      ------NYVASNIQVLKGLEAVRKRPGMYIGSVSINGLHHLVYEVVDNSIDEALAGFCDRIDVIINLDNT
GYRB_CHLMU      ----EKKYDASAITVLEGLQAVRERPGMYIGDTGVTGLHHLVYEVVDNSIDEAMAGFCTEVVVRILEDGG
GYRB_SPICI      ------NYNSESIQILEGLEAIRKRPGMYIGATNARGLHHLVWEIVDNSIDEVLANFANKIKIILNKDES
GYRB_CHLPN      ----EKNYDASAITVLEGLQAVRERPGMYIGDTGITGLHHLVYEVVDNSIDEAMAGYCSRIDVRILEDGG
GYRB_ARCFU      ---TAVEYTAKDIEVLDDLEAVRKRPGMYIXXXXXXXXXXXXWEVVDNAVDEALAGYCDTIKVSLHKDGS
PARE_BACSU      ----QFDYNEDAIQVLEGLEAVRKRPGMYIGSTDARGLHHLVYEIVDNSVDEVLAGHGDHIIVKIHKDNS
GYRB_CAMJE      ----QENYGASNIKVLKGLEAVRKRPGMYIGDTNIGGLHHMIYEVVDNSIDEAMAGHCDTIDVEITTEGS
GYRB_MYCAT      -------YGAKNIQFLEGLEAVRKRPGMYIGSIGFRGLHHLIWEIVDNSVDEAMAGFATNIEVKLHPNNE
GYRB_SHIFL      -----NSYDSSSIKVLKGLDAVRKRPGMYIGDTDDTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNS
GYRB_ECOLI      -----NSYDSSSIKVLKGLDAVRKRPGMYIGDTDDTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNS
GYRB_ECO57      -----NSYDSSSIKVLKGLDAVRKRPGMYIGDTDDTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNS
PARE_STAAW      --NKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGNEIDVTINKDGS
PARE_STAAU      --NKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGNEIDVTINKDGS
PARE_STAAN      --NKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGNEIDVTINKDGS
PARE_STAAM      --NKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGNEIDVTINKDGS
PARE_STAAC      --NKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGNEIDVTINKDGS
PARE_STAA8      --NKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGNEIDVTINKDGS
GYRB_CHLTR      ----EKKYDASAITVLEGLQAVRERPGMYIGDTGVTGLHHLVYEVVDNSIDEAMAGFCTEVVVRILEDGG
GYRB_SALTY      -----NSYDSSSIKVLKGLDAVRKRPGMYIGDTDDTGLHHMVFEVVDNAIDEALAGHCKDIVVTIHADNS
GYRB_SALTI      -----NSYDSSSIKVLKGLDAVRKRPGMYIGDTDDTGLHHMVFEVVDNAIDEALAGHCKDIVVTIHADNS
PARE_STAAR      --NKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGNEIDVTINKDGS
PARE_STAAS      --NKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGNEIDVTINKDGS
GYRB_ORYSJ      -------YTAANVQVLEALDGVRTRPGMYIGSTGSRGLHHLVYEILDNAVDEAQAGYATKVDVILHGDNS
GYRB_AQUAE      -SQTPQEYTAEAIKAVSGLEHVRLRPAMYIGDIGERGLHHLIWEILDNAVDEAVAGYARNISVTIHRDNS
PARE_STRPN      -----NNYNDDAIQVLEGLDAVRKRPGMYIGSTDGAGLHHLVWEIVDNAVDEALSGFGDRIDVTINKDGS
GYRB_HAEIN      ---TNDNYGASSIKVLKGLDAVRKRPGMYIGDTDDTGLHHMVFEVVDNAIDEALAGHCSDIIVTIHDDNS
GYRB_NICBE      -------YGSEQIQVLEGLDPVRKRPGMYIGSTGPRGLHHLVYEILDNAVDEAQAGFATKIDVVLHADNS
GYRB_PSEAE      -----NTYDSSSIKVLKGLDAVRKRPGMYIGDTDDTGLHHMVFEVVDNSIDEALAGYCSEISITIHTDES
GYRB_VIBPA      ------NYDSSSIKVLKGLDAVRKRPGMYIGDTDDTGLHHMVFEVVDNSIDEALAGHCKDIVVTIHEDNS
PARE_MYCGA      ------NYNEKHIKVLKGLEPVRKRPGMYIGSTDTRGLHHLVWELFDNAVDEALNGSANKIEVVHKKDGS
GYRB_RICCN      ----ESSYGADSIKVLKGLEAVRKRPGMYIGDVGDSGLHHMIYEVVDNAIDESLAGYCDLVRVTLNKNGS
GYRB_VIBCH      -----NNYDSSSIKVLKGLDAVRKRPGMYIGDTDDTGLHHMVFEVVDNSIDEALAGYCKDIVVTIHEDNS
GYRB_MYCCT      -------YDESAIQVLEGLEAVRKRPGMYIGSTDNKGLHHLVWEIVDNAIDEALAGYCTQIDVILEKDNS
PARE_MYCGE      ------NYSATNIKILKGLDAVKKRPGMYIGSTDSKGLHHMLWEILANSVDEVLAGYATNITVTLDLNNT
GYRB_MYXXA      -------YGTDSITKLEGREAVRKRPGMYIGDTMAYGLHKLVYEVVDNAVDESLAGHCTDIEVVIHVDGS
GYRB_BUCAI      -------YDSSNIKILRGLDAVRKRPGMYIGDTDDSGLHHMVFEIVDNSIDEALSGYCKEIIVTIHSDNS
GYRB_PSEPU      -------YDSSSIKVLKGLDAVRKRPGMYIGDTDDSGLHHMVFEVVDNSIDEALAGHCDDITVIIHTDES
GYRBM_ARATH     ---TSKGYSSEQIQVLEGLDPVRKRPGMYIGSTGSRGLHHLVYEILDNAIDEAQAGYASKVDVVLHADGS
GYRB_RICFE      ----ESSYGADSIKVLKGLEAVRKRPGMYIGDVGDSGLHHMIYEVVDNAIDESLAGYCDLVRVTLNKNGS
GYRB_RICBR      ----ESSYGADSIKVLKGLEAVRKRPGMYIGDVGDSGLHHMIYEVVDNAIDEALAGYCDLVRVVLNKNGS
GYRB_BUCBP      ----KNTYTSSNIKILKGLDAVKKRPGMYIGNTDDTGLHHMVFEVVDNSIDEALAGFCKNIIVTIHDDNS
GYRB_BUCAP      -------YDSSKIKILRGLDAVRKRPGMYIGDTDDSGLHHMVFEIVDNSIDEALAGFCKEIKVVIHSDNS
GYRBP_ARATH     -SSTSKDYSSEHIQVLEGLDPVRKRPGMYIGSTGSRGLHHLVYEILDNAIDEAQAGFASKIDVVLHSDDS
PARE_STAES      --NKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEVVDNSVDEVLNGYGDAITVTINQDGS
PARE_STAEQ      --NKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEVVDNSVDEVLNGYGDAITVTINQDGS
GYRB_HELPY      ------NYQSHSIKVLKGLEGVRKRPGMYIGDTNVGGLHHMVYEVVDNAVDESMAGFCDTINITLTDEGS
GYRB_HELPJ      ------NYQSHSIKVLKGLEGVRKRPGMYIGDTNVGGLHHMVYEVVDNAVDESMAGFCDTINITLTEEGS
GYRB_RICPR      ----ESSYSADSIKVLKGLEAVRKRPGMYIGDVGDSGLHHMIYEVVDNSIDEALAGYCDLVQVTLNKNGS
GYRB_RICTY      ----ESSYSADSIKVLKGLEAVRKRPGMYIGDVGDSGLHHMIYEVVDNSIDEALAGYCDLIRVTLNKNGS
GYRB_NEIGO      MTEQKHEYGADSIQVLEGLEAVPKRPGMYIGDTQDSGLHHMVFEVLDNAIDEALAGHCDKITVTIHADHS
GYRB_CAUCR      -------YGADSIKVLKGLDAVRKRPGMYIGDTDDSGLHHMVYEVVDNAIDEALAGHATKVQVILNADGS
GYRB_CAUCN      -------YGADSIKVLKGLDAVRKRPGMYIGDTDDSGLHHMVYEVVDNAIDEALAGHATKVQVILNADGS
PARE_CAUCR      -------YSAADIEVLEGLEPVRKRPGMYIGGTDERALHHLFAEVLDNSMDEAVAGFAKTIEVKLDADGF
GYRB_BARBK      ----DSTYNASSIRILEGLEPVRLRPGMYIGGTDSKALHHLFSEIIDNAMDEAVAGYADLIDITLDSNNY
PARE_RICCN      ----DNNYSAKDIEVLEGLEPVRKRPGMYIGGTDSNAMHHLVSEVLDNAMDEAVAGFASIITITMHHDHS
PARE_MYCPN      ----KNNYSEANIKILKGLDAVKKRPGMYIGSTDSRGFHHLLWEILDNCVDEVLSGFANTIAVVLHAENQ
PARE_RICFE      ----DNNYSAKDIEVLEGLEPVRKRPGMYIGGTDSNAMHHLVSEVLDNAMDEAVAGFASIITIKMHQDHS
GYRB_CYTAU      ----------------------------------------------------------------------
PARE_RICBR      -------YSAKDIEVLEGLEPVRKRPGMYIGGTDLNAMHHLVSEVLDNSMDEAVAGFASIITIKMHQDHS
GYRB_CYTHU      ----------------------------------------------------------------------
PARE_RICPR      ------NYSAKDIEVLDGLEPVRKRPGMYIGGTDSNAMHHLVSEVLDNAMDEAVAGFASIIMIKMHQDHS
GYRB_FLEEL      ----------------------------------------------------------------------
PARE_RICTY      ------NYSAKDIEVLDGLEPVRKRPGMYIGGTDSNAMHHLVSEVLDNAMDEAVAGFASIIMIKMHQDHS
PARE_PSEAE      -------YNADAIEVLSGLDPVRKRPGMYTDTTRP---NHLAQEVIDNSVDEALAGHAKSVQVILHQDNS
PARE_ECOLI      -------YNADAIEVLTGLEPVRRRPGMYTDTTRP---NHLGQEVIDNSVDEALAGHAKRVDVILHADQS
PARE_SALTY      -------YNADAIEVLTGLEPVRRRPGMYTDTTRP---NHLGQEVIDNSVDEALAGHAKRVDVILHADQS
PARE_SALTI      -------YNADAIEVLTGLEPVRRRPGMYTDTTRP---NHLGQEVIDNSVDEALAGHAKRVDVILHADQS
GYRB_FLEJA      ----------------------------------------------------------------------
PARE_HAEIN      ------NYSAQEITVLKDLEPVQIRPGMYTDTTRP---NHLAQEVIDNSVDEALAGFATKIEVILHPDQS
GYRB_BACCE      ----------------------------------------------------------------------
GYRB_BACMY      ----------------------------------------------------------------------
GYRB_SYNY3      MTMTTTNYGADQIQVLEGLEPVRKRPGMYIGSTGPKGLHHLVYEVVDNAIDEALAGYCTHIEIDINADGS
GYRB_ACIBA      ----------------------------------------------------------------------
GYRB_ACIHA      ----------------------------------------------------------------------
GYRB_ACIGB      ----------------------------------------------------------------------
GYRB_ACIJU      ----------------------------------------------------------------------
GYRB_ACILW      ----------------------------------------------------------------------
GYRB_ACIG9      ----------------------------------------------------------------------
GYRB_ACIG3      ----------------------------------------------------------------------
GYRB_ACICA      ----------------------------------------------------------------------
GYRB_ACIG6      ----------------------------------------------------------------------
GYRB_ACIJO      ----------------------------------------------------------------------
PARE_BORBU      ------NYDESKIITLSSLEHIRLRSGMYIGRLGDGGIYVLIKEIIDNSIDEFIMGYGNEIFIKK-ENNL
GYRB_PROMI      MSNT---YDSSSIKVLKGLDAVRKRPGMYIGDTDDTGLHHMVFEVVDNAIDEALAGYCDEIIVTIHSDNS
GYRB_ACIS9      ----------------------------------------------------------------------
GYRB_ACIS6      ----------------------------------------------------------------------
GYRB_ACIGA      ----------------------------------------------------------------------
GYRB_ACIS8      ----------------------------------------------------------------------
GYRB_ACIS7      ----------------------------------------------------------------------
GYRB_RHOCA      ----------------------------------------------------------------------
TOP2_CAEEL      ----------------------------------------------------------------------
TOP2M_CAEEL     ----------------------------------------------------------------------
TOP2M_DICDI     ----------------------------------------------------------------------
TOP2_SCHPO      -------------------EHVLRRPDTYIGSIEPTGLYKIFDEIIVNAADNKVRDNMNTLKVTLPEANV
TOP2_CANAL      ---------------LSQLEHILKRPDTYIGSTIVPGLYKIFDEILVNAADNKIRDPSMKIRVKIAENNI
TOP2_DICDI      ----------------ELLDQILLRPDTYIGSTERQGIYKIFDEILVNAADNKQRGNMKFIKVVIREKGF
TOP2B_MOUSE     ------------------LEHILLRPDTYIGSVEPLGLYKIFDEILVNAADNKQRDNMTCIKVSIPESNI
TOP2B_HUMAN     ------------------LEHILLRPDTYIGSVEPLGLYKIFDEILVNAADNKQRDNMTCIKVSIPESNI
TOP2B_CRILO     ------------------LEHILLRPDTYIGSVEPLGLYKIFDEILVNAADNKQRDNMTCIKVSIPESNI
TOP2B_CHICK     ------------------LEHILLRPDTYIGSVEPLGLYKIFDEILVNAADNKQRDNMTCIKISIPESNI
TOP2_PLAFK      ----------------------------------------------------------------------
TOP2_PICGU      ---------------LSQLEHILKRPDTYIGSTGVEGLYKIFDEILVNAADNKIRDPSMRIKVNIAENNT
TOP2_MIMIV      ----------------------------------------------------------------------
TOP2A_PIG       ----------------------------------------------------------------------
TOP2A_HUMAN     ----------------------------------------------------------------------
TOP2_BOMMO      ------------------------------------GLYKIYDEILVNAADNKQRDDVIKIDINQ-ETNT
TOP2A_MOUSE     ----------------------------------------------------------------------
TOP2_PENCH      ---------------LTQLEHIIKRPDTYVGSTERTGLYKIFDEIVVNAADNKQNDNMDEIRVTIRESGE
TOP2_PEA        ----------------------------------------------------------------------
TOP2_ARATH      ------------------LEHILLRPDTYIGSTYVPGLYKIFDEILVNAADNKQRAKMDSVQVVIVEQNL
TOP2A_CRIGR     ------------------LEHILLRPDTYIGSTFVPGLYKIFDEILVNAADNKQRDPKMSIRVTIPENNL
TOP2A_RAT       ------------------LEHILLRPDTYIGSTFVPGLYKIFDEILVNAADNKQRDPKMSIRVTMMRNNL
TOP2A_CHICK     ------------------LEHILLRPDTYIGSTFVPGLYKIFDEILVNAADNKQRDKSMSIKVTIPENNT
TOP2_DROME      ------------------------------------GLYKIFDEILVNAADNKQRDNTIKIDIDP-ERNM
TOP2_IIV3       ----------------------------------------------------------------------
TOP2_CANGA      ------------------LEHILKRPDTYIGSVEIQGLFKIFDEILVNAADNKVRDPSMKIDVTINEENF
TOP2_YEAST      ------------------LEHILKRPDTYIGSVETQGLFKIFDEILVNAADNKVRDPSMKIDVNIAEEHT
TOP2_IIV6       ----------------------------------------------------------------------
TOP2_TRYBB      ---------------LTPIEHVLTRPEMYIGSLDPMFIYHMVWETVKLNVDEILSARMTYIRVTITDTGE
TOPL_BPT4       ----------NEIKILSDIEHIKKRSGMYIGSSANEGLVKLIDEIIDNSVDEGIRTKANKINVTI-KNNQ
TOP2_LEICH      ----------------------------------------------------------------------
TOP2_ASFP4      ----------------------------------------------------------------------
TOP2_ASFWA      ----------------------------------------------------------------------
TOP2_ASFK5      ----------------------------------------------------------------------
TOP2_ASFB7      ----------------------------------------------------------------------
TOP2_ASFM2      ----------------------------------------------------------------------
TOP2_TRYCR      --------EASKYKKLTPIDHVLIRPEMYVGSVDTHGLLKIVDEILLNASDNIAGGRMTYIRVHITEAGE
TOP2_CRIFA      --------DASKYQKLTPIDHVLLRPEMYVGSIETQSIPKMVWEAADNINNSVRGARMTYISIKISDSGE
TOPS_BPT4       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXRGIPVDMHPSGAPTVQVVMTQLHAGGKFDSDSYAVSGGLHGVGISVVNALSTRVEADIKLHGK
GYRB_MYCSM      VEVRDDGRGIPVEMHATGMPTIDVVMTQLHAGGKFDGETYAXXXXXXXXXXXXXNALSTRLEATVLRDGY
GYRB_MYCS2      VEVRDDGRGIPVEMHATGMPTIDVVMTQLHAGGKFDGETYAXXXXXXXXXXXXXNALSTRLEATVLRDGY
GYRB_MYCPA      VEVADNGRGIPVAMHATGAPTVDVVMTQLHAGGKFENSGYNXXXXXXXXXXXXXNALSTRLEVNIARDGY
GYRB_MYCTU      VEVADDGRGIPVATHASGIPTVDVVMTQLHAGGKFDSDAYAIXXXXXXXXXXXXNALSTRLEVEIKRDGY
GYRB_MYCTA      VEVADDGRGIPVATHASGIPTVDVVMTQLHAGGKFDSDAYAIXXXXXXXXXXXXNALSTRLEVEIKRDGY
GYRB_MYCLE      VEVADNGRGIPVAVHATGVPTVDVVMTQLHAGGKFGGSGYNXXXXXXXXXXXXXNALSTRVEVDIKRDGY
GYRB_STRCO      XXXXXXXXXIPVGIVPSGKPAVEVVLTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSTRVAVEVKTDGY
GYRBS_STRSH     XXXXXXXXXIPVGIVPSGKPAVEVVLTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSTKVAVEVKTDGY
GYRB_BACSU      ITVVDNGRGIPVGIHEKGRPAVEVIMTVLHAGGKFDGSGYKVSGGLHGVGASVVNALSTELDVTVHRDGK
GYRBR_STRSH     XXXXXXXXXIPVGMHPEKRPAVEVVLTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSTRLSAEIWTDGH
GYRB_CLOAB      VTVSDDGRGMPIGIHHKKKPTVEVIMTILHAGGKFGGGAYRVSGGLHGVGASVVNALSETCEVEVKTEGH
GYRB_HALSQ      VSVTDNGRGIPVGTHEQDRPALEVIMTVLHAGGKFDNKSYQVSGGLHGVGVTVVNALSSELEVEVKHDGA
GYRB_BACHD      ITVTDNGRGIPVGIHEKGRPAVEVIMTVLHAXXXXXXXXXXXXXXXXXXXASVVNALSTMLEVEVHREGK
GYRB_MYCGE      TRVEDDGRGIPVDIHPTNRSTVETVFTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSSFKVWVFRQNK
GYRB_STAES      IKVTDNGRGIPVDIQEKGRPAVEVILTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSQDLEVYVHRNGT
GYRB_STAEQ      IKVTDNGRGIPVDIQEKGRPAVEVILTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSQDLEVYVHRNGT
GYRB_MYCGA      VEVEDDGRGIPVDIHETNKSTVETVLTILHAGGKFDSDTYSMSGGLHGVGASVVNALSSSVNRDYKIHYI
GYRB_BACAN      IRVTDNGRGIPVGIQEKGRPAVEVIMTVLHAXXXXXXXXXXXXXXXXXXXASVVNALSTELEVFVHREGK
GYRB_MYCPN      TIVEDDGRGIPVDIHPTNRSTVETVFTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSSFKVWVAREHQ
GYRB_TREDE      VRVEDNGRGIPVDIHPTEKSALELVLTRLHAGGKFDKGSYKXXXXXXXXXXXXXNALSVWMEAKVYKDGF
GYRB_MYCHO      IEVEDNGRGMPTGIHSGTKKSVETILTVLHAGGKFDGSNYKVSGGLHGVGASVVNALSSEFEVWVKRDGK
GYRB_STRR6      ITVVDDGRGIPVDIQETGRPAVETVFTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSTQLDVHVHKNGK
GYRB_STRPN      ITVVDDGRGIPVDIQETGRPAVETVFTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSTQLDVHVHKNGK
GYRB_STRP3      ITVVDDGRGIPVDIQKTGRPAVETVFTVLHAGGKFGGGSYKXXXXXXXXXXXXXNALSTQLDVRVYKNGQ
GYRB_STAAN      IKVTDNGRGIPVDIQEKGRPAVEVILTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSQDLEVYVHRNET
GYRB_STAAM      IKVTDNGRGIPVDIQEKGRPAVEVILTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSQDLEVYVHRNET
GYRB_BORHE      VTVNDNGRGIPTDVHEEGISALELVLTKLHSGGKFNKGTYKVSGGLHGVGISVVNALSSFLAVIVSRDGK
GYRB_TREPA      VRVEDNGRGIPVDVHPEGVSALEVVLTKLHAGGKFDKKSYKXXXXXXXXXXXXXNALSLWVEVTVYRDGA
GYRB_STRP8      ITVVDDGRGIPVDIQATGRPAVETVFTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSTQLDVRVYKNGQ
GYRB_STRP6      ITVVDDGRGIPVDIQATGRPAVETVFTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSTQLDVRVYKNGQ
GYRB_STAAW      IKVTDNGRGIPVDIQEKGRPAVEVILTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSQDLEVYVHRNET
GYRB_STAAU      IKVTDNGRGIPVDIQEKGRPAVEVILTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSQDLEVYVHRNET
GYRB_STAAS      IKVTDNGRGIPVDIQEKGRPAVEVILTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSQDLEVYVHRNET
GYRB_STAA3      IKVTDNGRGIPVDIQEKGRPAVEVILTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSQDLEVYVHRNET
GYRB_THEMA      VEVEDNGRGIPVDIHPEGRSALEVVFTVLHAGGKFSKDSYKIXXXXXXXXXXXXNALSEWLEVRVHRDGK
GYRB_STAAR      IKVTDNGRGIPVDIQEKGRPAVEVILTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSQDLEVYVHRNET
GYRB_STAAC      IKVTDNGRGIPVDIQEKGRPAVEVILTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSQDLEVYVHRNET
GYRB_STRP1      ITVVDDGRGIPVDIQATGRPAVETVFTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSTQLDVRVYKNGQ
GYRB_BORBU      ITVIDNGRGIPTDIHEEGISALELVLTKLHSGGKFNKGTYKVSGGLHGVGISVVNALSSFLEVYVNRDGK
GYRB_CHLMU      ISVSDNGRGIPVQIHEKESAALEVVLTVLHAGGKFDKDSYKVSGGLHGVGVSCVNALSEKFIANVFKDGQ
GYRB_SPICI      ITVIDNGRGIPIEIHPTKVSTLETVFTILHAGGKFDSNTYKISGGLHGVGASVVNALSKYLKVEVRKNNK
GYRB_CHLPN      IVIVDNGRGIPIEVHERESAALEVVLTVLHAGGKFDKDSYKVSGGLHGVGVSCVNALSEKLVATVFKDKK
GYRB_ARCFU      ASVEDNGRGIPTEMHELGKSALEIVMTKLHAGGKFSKKVYRXXXXXXXXXXXXXNALSEWLEVWVKRNGK
PARE_BACSU      ISVQDRGRGMPTGMHKLGKPTPEVILTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLTVTIERDGF
GYRB_CAMJE      CIVSDNGRGIPVDMHPTNMPTLTVVLTVLHAGGKFDKDTYKXXXXXXXXXXXXXNALSKKLVATVERNGE
GYRB_MYCAT      IEVIDNGRGMPVDIHPTTKKSVETILTVLYAGGKFDSTNYKXXXXXXXXXXXXXNALSDSFEVWVKRGGK
GYRB_SHIFL      VSVQDDGRGIPTGIHPEGVSAAEVIMTVLHAGGKFDDNSYKXXXXXXXXXXXXXNALSQKLELVIQREGK
GYRB_ECOLI      VSVQDDGRGIPTGIHPEGVSAAEVIMTVLHAGGKFDDNSYKXXXXXXXXXXXXXNALSQKLELVIQREGK
GYRB_ECO57      VSVQDDGRGIPTGIHPEGVSAAEVIMTVLHAGGKFDDNSYKXXXXXXXXXXXXXNALSQKLELVIQREGK
PARE_STAAW      ISIEDNGRGMPTGIHKSGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLEVEIHRDGN
PARE_STAAU      ISIEDNGRGMPTGIHKSGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLEVEIHRDGN
PARE_STAAN      ISIEDNGRGMPTGIHKSGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLEVEIHRDGS
PARE_STAAM      ISIEDNGRGMPTGIHKSGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLEVEIHRDGS
PARE_STAAC      ISIEDNGRGMPTGIHKSGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLEVEIHRDGN
PARE_STAA8      ISIEDNGRGMPTGIHKSGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLEVEIHRDGN
GYRB_CHLTR      ISISDNGRGIPIQIHEKESAALEVVLTVLHAGGKFDKDSYKVSGGLHGVGVSCVNALSEKFIAKVFKDGQ
GYRB_SALTY      VSVTDDGRGIPTGIHPEGVSAAEVIMTVLHAGGKFDDNSYKXXXXXXXXXXXXXNALSQKLELVIQRDGK
GYRB_SALTI      VSVTDDGRGIPTGIHPEGVSAAEVIMTVLHAGGKFDDNSYKXXXXXXXXXXXXXNALSQKLELVIQRDGK
PARE_STAAR      ISIEDNGRGMPTGIHKSGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLEVEIHRDGN
PARE_STAAS      ISIEDNGRGMPTGIHKSGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLEVEIHRDGN
GYRB_ORYSJ      VSVTDNGRGIPTDIHPQTKKSVETVLTLMHAGGKFSKSGYTXXXXXXXXXXXXXNALSEALEVTVWRDGK
GYRB_AQUAE      VTVEDDGRGIPVDIHPTGKPAVEMVFTMLGAGGKFEKKVYTYSGGLHGVGASVVNALSEWLIVEVYRDGK
PARE_STRPN      LTVQDHGRGMPTGMHAMGIPTVEVIFTILHAGGKFGQGGYKTXXXXXXXXXXXXNALSSWLEVEITRDGA
GYRB_HAEIN      VSVQDDGGGIPVDIHPEGVSAAEVIMTVLHAGGKFDDNSYKXXXXXXXXXXXXXNALSDKLQLTIRRQGH
GYRB_NICBE      VSIADNGRGIPTELHPTKKSSLETVLTVLHAGGKFXXXXXXXXXXXXXXXXXXXNALSQALEVTIWRDGK
GYRB_PSEAE      ITVRDNGRGIPVDIHKEGVSAAEVIMTVLHAGGKFDDNTYKXXXXXXXXXXXXXNALSHELRLTIRRHNK
GYRB_VIBPA      VSVSDDGRGIPTEMHPEEVSAAEVIMTVLHAGGKFDDNSYKXXXXXXXXXXXXXNALSEKVVLTIHRGGH
PARE_MYCGA      IIVTDNGRGIPVGKNATNLSTVDTVYTVLHAGGKFDDQAYKVSGGLHGVGASVVNALSRKLIVTVHRDGG
GYRB_RICCN      VTVSDNGRGIPVEIHEEGISAAEVIMTQLHAGGKFDQNAYKVAGGLHGVGVSVVNALSEWLELRIWRNNK
GYRB_VIBCH      VSVSDDGRGIPTEMHPEEVSAAEVIMTVLHAGGKFDDNSYKXXXXXXXXXXXXXNALSEKVLLTIYRGGK
GYRB_MYCCT      ITVIDNGRGIPTGMHKTGKPTPEVIFSVLHAGGKFDSTAYKXXXXXXXXXXXXTNALSKRFKADKKIHEI
PARE_MYCGE      ITVSDDGRGIPYEIHQSNISTIDTVFTFLHAGGKFDDQSYKLAGGLHGVGASVVNALSDHLEVTVKRNGQ
GYRB_MYXXA      LSVQDNGRGIPVGPHPKGKDTLEVVLTELHAGSKFGNGAYKVSGGLHGVGVTCVNFLSEWFKVRVHRNGI
GYRB_BUCAI      VSVKDDGRGIPTDIHPENISAAEVILTVLHSGGKFDNASYQISGGLHGVGISVVNALSEKLELIIDKNKK
GYRB_PSEPU      ISVRDNGRGIPVDVHKEGVSAAEVIMTVLHAGGKFDDNSYKXXXXXXXXXXXXXNALSEKLVLTVRRSGK
GYRBM_ARATH     VSVVDNGRGIPTDLHPATKKSLETVLTVLHAGGKFXXXXXXXXXXXXXXXXXXXNALSEALEVSVWRDGM
GYRB_RICFE      VTVSDNGRGIPVEIHQEGISAAEVIMTQLHAGGKFDQNSYKXXXXXXXXXXXXXNALSEWLELRIWRNNK
GYRB_RICBR      VTVSDNGRGIPVEIHEEGISAAEVIMTQLHAGGKFDQNSYKXXXXXXXXXXXXXNALSDWLELRIWRNNT
GYRB_BUCBP      ISIQDDGRGIPTDIHDEGISAAEVIMTVLHAGGKFDNTSYKXXXXXXXXXXXXXNALSKKLELFIYRDKK
GYRB_BUCAP      VSIKDDGRGIPTDIHPEEKSAAEVIMTVLHSGGKFDNASYKISGGLHGVGISVVNALSEKLELIIXXXXX
GYRBP_ARATH     VSISDNGRGIPTDLHPAGKSSLETVLTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSEALEVIVRRDGM
PARE_STAES      ISIEDNGRGMPTGIHASGKPTAEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLEVEIHRDGN
PARE_STAEQ      ISIEDNGRGMPTGIHASGKPTAEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLEVEIHRDGN
GYRB_HELPY      CIVEDNGRGIPVDIHPTEKPACTVVLTILHAGGKFDNDTYKXXXXXXXXXXXXXNALSKRLIMTIKKEGQ
GYRB_HELPJ      CIVEDNGRGIPVDIHPTEKPACTVVLTILHAGGKFDNDTYKXXXXXXXXXXXXXNALSKRLIMTIKKEGQ
GYRB_RICPR      VTVSDNGRGIPVEIHEEGISAAEVIMTQLHAGGKFDQQSYKIXXXXXXXXXXXXNALSEWLELRIWRNNK
GYRB_RICTY      VTVSDNGRGIPVEIHEEGISAAEVIMTQLHAGGKFDQHSYKIXXXXXXXXXXXXNALSEWLELRIWRNNK
GYRB_NEIGO      VSVADNGRGMPTGIHPKGRSAAEVIMTVLHAGGKFDNNSYKIXXXXXXXXXXXXNALSDWVTLTIYRDGK
GYRB_CAUCR      VTVTDDGRGIPVDMHEGGVSAAEVIMTQLHAGGKFDQNSYKXXXXXXXXXXXXXNALSDWLELLIHRNGK
GYRB_CAUCN      VTVTDDGRGIPVDMHEGGVSAAEVIMTQLHAGGKFDQNSYKXXXXXXXXXXXXXNALSDWLELLIHRNGK
PARE_CAUCR      LSVKDDGRGMPVDPHPKGKSALEVIMTVLHAGGKFTGKAYETSGGLHGVGASVVNALSERVEVTVWRDGF
GYRB_BARBK      LTVTDNGRGIPIENHPQDKSTLEVIMTHLHSGGKFDGKAYQTSGGLHGVGISVVNALSDDMEVEVARERK
PARE_RICCN      ITIFDNGRGIPIDNHPKDKSALEVILTTLHSGGKFSNNVYHTAGGLHGVGISVVNALSKHLEIKVYKQGK
PARE_MYCPN      ITVSDNGRGIPFETHSSKISTIDTVFTYLHAGGKFDNDSYKIAGGLHGVGASVVNALSDQLQVTVKRQGK
PARE_RICFE      ITIFDNGRGIPIDNHPKDKSALEVILTTLHSGGKFSNNVYHTAGGLHGVGISVVNALSKHLEIKVYKQGK
GYRB_CYTAU      -----------------------------------DKDSYKVSGGLHGVGVSCVNALSTDMKVTVYSHGK
PARE_RICBR      ITISDNGRGIPIDNHPKNKSALEVILTTLHSGGKFSSNVYQTAGGLHGVGVSVVNALAEHLEIKVYKQGK
GYRB_CYTHU      -----------------------------------DKDSYKVSGGLHGVGVSCVNALSTDMKVTVYSHGK
PARE_RICPR      ITIFDNGRGIPIDNHPKDKSALEVILTTLHSGSKFSNNVYHTSGGLHGVGISVVNALSKHFKIKVYKQGK
GYRB_FLEEL      -----------------------------------DKDTYKVSGGLHGVGVSCVNALSSLLVATVHREGK
PARE_RICTY      ITIFDNGRGIPIDNHPKNKSALEVILTTLHSGSKFSNNVYHTAGGLHGVGISVVNALSKHLKIEVYQQGK
PARE_PSEAE      LEVIDDGRGMPVDIHPEGVPGVELILTKLHAGGKFSNKNYQFSGGLHGVGISVVNALSTRVEVRVKRDAN
PARE_ECOLI      LEVIDDGRGMPVDIHPEGVPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVNVRRDGQ
PARE_SALTY      LEVIDDGRGMPVDIHPEGVPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVTVRRDGQ
PARE_SALTI      LEVIDDGRGMPVDIHPEGVPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVTVRRDGQ
GYRB_FLEJA      -----------------------------------DKNTYKVSGGLHGVGVSCVNALSTVLHVTVHREGK
PARE_HAEIN      IEVTDNGRGMPVDIHPTGVSGVEVILTKLHAGGKFSNKNYEFAGGLHGVGISVVNALSERVDIQVKRNGE
GYRB_BACCE      -----------------------------HAGGKFDGGGYKVSGGLHGVGASVVNALSTELEVFVHREGK
GYRB_BACMY      -----------------------------HAGGKFDGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGK
GYRB_SYNY3      VTVVDNGRGIPTDIHPTGRSALETVLTVLHAXXXXXXXXXXXXXXXXXXXXXXXNALSEWVEVKVWRQGK
GYRB_ACIBA      ------------------------------------------------------NALSSKLHLTIYRAGQ
GYRB_ACIHA      ------------------------------------------------------NALSSKLQLTIHRAGQ
GYRB_ACIGB      ------------------------------------------------------NALSSKLELTIHRAGH
GYRB_ACIJU      ------------------------------------------------------NALSKKLHLTIQRAGQ
GYRB_ACILW      ------------------------------------------------------NALSEKLELTIHRAGK
GYRB_ACIG9      ------------------------------------------------------NALSEKLELTIHRAGK
GYRB_ACIG3      ------------------------------------------------------NALSSKLHLIINRAGQ
GYRB_ACICA      ------------------------------------------------------NALSSKLHLMISRAGQ
GYRB_ACIG6      ------------------------------------------------------NALSKKLHLIIHRAGQ
GYRB_ACIJO      ------------------------------------------------------NALSRKLELTIHRAGH
PARE_BORBU      ISIRDYGRGIPLGK-------VIESVSVINTGAKYNDDVFQFSVGLNGVGTKAVNALSSKFLVRSTRNGK
GYRB_PROMI      VSVRDDGRGIPTGIHEEGVSAAEVIMTVLHAGGKFDDNSYKXXXXXXXXXXXXXNALSEKLELTIHRDGK
GYRB_ACIS9      ------------------------------------------------------NALSKKLHLTIHRAGQ
GYRB_ACIS6      ------------------------------------------------------NALSKKLHLTIHRAGQ
GYRB_ACIGA      ------------------------------------------------------NALSSKLELTIHRAGH
GYRB_ACIS8      ------------------------------------------------------NALSSKLELTVQRAGQ
GYRB_ACIS7      ------------------------------------------------------NALSSKLQLTIHRAGQ
GYRB_RHOCA      ----------------------------------------------------------------------
TOP2_CAEEL      ----------------------------------------------------------------------
TOP2M_CAEEL     ----------------------------------------------------------------------
TOP2M_DICDI     ----------------------------------------------------------------------
TOP2_SCHPO      ISIYNNGKGIPIEIHDKEKIYIELIFGNLLTSSNYDDNQKKVTGGRNGYGAKLCNIFSTEFVVEMKKYKQ
TOP2_CANAL      IEVMNDGKGIPIEMHTKENMYIELIFGNLLTSSNYDDDQKKVTGGRNGFGAKLCNIFSTQFEVETKLYKQ
TOP2_DICDI      ISVTNDGAGIPIQVHSEHKIYIELIFGNLLTSSHYDDSEKRLTGGRNGFGAKLANIFSTKADSKSKKLYK
TOP2B_MOUSE     ISIWNNGKGIPVVEHKVEKVYVPLIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETAC--K
TOP2B_HUMAN     ISIWNNGKGIPVVEHKVEKVYVPLIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETAC--K
TOP2B_CRILO     ISIWNNGKGIPVVEHKVEKVYVPLIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETAC--K
TOP2B_CHICK     ISIWNNGKGIPVVEHKVEKVYVPLIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKVETACKEY-K
TOP2_PLAFK      ----------------------------------------------------------------------
TOP2_PICGU      ISVMNDGKGIPIEIHKKEKIYIELIFGNLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFTADLQVYKQ
TOP2_MIMIV      ----------------------------------------------------------------------
TOP2A_PIG       ----------------------------------------------------------------------
TOP2A_HUMAN     ----------------------------------------------------------------------
TOP2_BOMMO      ISVYNNGSGIPVVMHKDEKMYVPMIFGHLLTSSNYNDEEEKVTGGRNGYGAKLCNIFSTKVETASKQYKK
TOP2A_MOUSE     ----------------------------------------------------------------------
TOP2_PENCH      ISVWNNGRGIPIEMHSKEKMYVELIFGHLLTSSNYDDTQMKVTGGRNGFGAKLCNVFST--EFTIETQDS
TOP2_PEA        ----------------------------------------------------------------------
TOP2_ARATH      ISVCNSGAGVPVEIHQEGIYVPEMIFGHLLTSSNYDDNVKKTTGGRNGYGAKLTNIFSTEIETADGKRLK
TOP2A_CRIGR     ISIWNNGKGIPVVEHKVEKMYVPLIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTRF--TVETASK
TOP2A_RAT       ISIWNNGKGIPVVEHKVEKMYVPLIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETKMFKQ
TOP2A_CHICK     ISVWNNGKGIPVVEHKVEKVYVPLIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETKLFKQ
TOP2_DROME      VSVWNNGQGIPVTMHKEQKMYVPMIFGHLLTSSNYNDDEKKVTGGRNGYGAKLCNIFSTSFTVETKSFKQ
TOP2_IIV3       ----------------------------------------------------------------------
TOP2_CANGA      IEVRNDGKGIPIEIHEKEKIYIELIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTELETADPKNGR
TOP2_YEAST      IEVKNDGKGIPIEIHNKENIYIEMIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFTADLNV-GQ
TOP2_IIV6       ----------------------------------------------------------------------
TOP2_TRYBB      ITIENDGAGIPIVRHKLYIP--EMVFGHLLTSSNYDDDNQNAVAGRHGYGAKLTNILSLSFSVCCRTNGR
TOPL_BPT4       VTVEDNGRGIPQAMTPTGEPGPVAAWTIPKAGGNFGDDKERVTGGMNGVGSSLTNIFSVMFVGETGDGQN
TOP2_LEICH      ----------------------------------------------------------------------
TOP2_ASFP4      ----------------------------------------------------------------------
TOP2_ASFWA      ----------------------------------------------------------------------
TOP2_ASFK5      ----------------------------------------------------------------------
TOP2_ASFB7      ----------------------------------------------------------------------
TOP2_ASFM2      ----------------------------------------------------------------------
TOP2_TRYCR      ITIENDGAGIPIKEHKLYIP--EMVFGHLLTSSNYDDTSQNAVAGRHGYGAKLTNILSHRFSVCCRTKGK
TOP2_CRIFA      IMVENDGAGLPIKEHKMYIP--EMVFGHLLTSSNYNNDASSTTAGRHGYGAKLTNILSTKFSVVCRTAGR
TOPS_BPT4       ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           HWYQNFEKSVPDELIEGGNARGTGTTIRFWPDAEIXXXXXXXXXXISRRLQEMAFLNKGLTITLTDNRXX
GYRB_MYCSM      EWFQYYDRSVPXXXXXXXXXXXXXXXIRFWADPEIFETTDYNFETVARRLQEMAFLNKGLTIELTDERVT
GYRB_MYCS2      EWFQYYDRSVPXXXXXXXXXXXXXXXIRFWADPEIFETTDYNFETVARRLQEMAFLNKGLTIELTDERVT
GYRB_MYCPA      EWSQYYDHAVPGTLKQGEATKRTGTTIRFWADPDIFETTEYDFETVARRLQEMAFLNKGLTINLTDERVT
GYRB_MYCTU      EWSQVYEKSEPLGLKQGAPTKKTGSTVRFWADPAVFETTEYDFETVARRLQEMAFLNKGLTINLTXXXXX
GYRB_MYCTA      EWSQVYEKSEPLGLKQGAPTKKTGSTVRFWADPAVFETTEYDFETVARRLQEMAFLNKGLTINLTXXXXX
GYRB_MYCLE      EWSQFYDKAVPGILKQGEATEATGTTIRFWADPDIFETTKYDFGTVARRIQEVAFLNKGLTINLVDERVK
GYRB_STRCO      RWTQEYKLGVPTASLARHEAEETGTTVTFWADGDIFETTDYSFETLSRRFQEMAFLNKGLKINLTDERXX
GYRBS_STRSH     RWTQDYKLGVPTRRCAQNEATDTGTTVTFWADPDVFETTEYSFETLSRRFQEMAFLNKGLTLKLTDERES
GYRB_BACSU      IHRQTYKRGVPVTDLEIGETDHTGTTTHFVPDPEIFSETTEYDYDLANRVRELAFLTKGVNITIEDKREG
GYRBR_STRSH     RWTQDYRDGAPTAPLARHEATSTGTSLTFWADGDIFETTEYSFETLARRHQEMAFLNGGLTLTLTDERSS
GYRB_CLOAB      IWKQTYHRGVASPFEKIGDSDEHGTKIYFKPDPEIFEDTEYDYDTLSQRLRELAFLNKGIKIELTDERHD
GYRB_HALSQ      VWTHRFEVGEPERVRDLEPGEDTGTTIRFWPDDGIFETTEFDFKTLENRLRELAFLNSGVEISLSDERTD
GYRB_BACHD      VHYQKFHRGVPAADLEVGTTDRTGTKIHFKPDGDIFTETTVFEYDLASRLRELAFLNKGLRIKITDMRE-
GYRB_MYCGE      KYFLSFSKVIGDLVQEGNSEKEHGTIVEFVPDFSVMEKSDYKQTVIVSRLQQLAFLNKGIRIDFVDNRKQ
GYRB_STAES      IYHQAYKQGVPQDLKEIGDTDKTGTAIRFKADKEIFTETTVYNYELQKRIRELAFLNKGIQITLKDER--
GYRB_STAEQ      IYHQAYKQGVPQDLKEIGDTDKTGTAIRFKADKEIFTETTVYNYELQKRIRELAFLNKGIQITLKDER--
GYRB_MYCGA      EFKDGGVPLKPLEII-GTDSKKQGTRIQFVPDFSIMEQFEYDETIIADRIEQLAFLNKGIKFIFNDERT-
GYRB_BACAN      IHYQKYERGIPADLKVIGDTDQTGTITRFKPDPEIFQETTVYEFDLATRMRELAFLNRNIKLTIEDKR--
GYRB_MYCPN      QYFLAFHNGIGDLVNEGKCDKEHGTKVEFVPDFTVMEKSDYKQTVIASRLQQLAFLNKGIQIDFVDERRQ
GYRB_TREDE      EHYAKFEKSILEPVKKIGETEKSGTVIRWAVDPSIFTETTVYNFEVATRLRELAFLNSKISITMRDERLS
GYRB_MYCHO      LHYQQFRNGKPLEVIGNFSEVETGTTIKFHPDYTIMEKENFFFDTIIDHSKQIAYLNKGLKITV------
GYRB_STRR6      IHYQEYRRGVVADLEIVGDTDKTGTTVHFTPDPKIFTETTIFDFDLNKRIQELAFLNRGLQISITDKRQG
GYRB_STRPN      IHYQEYRRGVVADLEIVGDTDKTGTTVHFTPDPKIFTETTIFDFDLNKRIQELAFLNRGLQISITDKRQG
GYRB_STRP3      IHYQEFKRAVVADLEVIXXXXXXXXXXHFTPDPEIFTETTQFDYSVAKRIQELAFLNRGLKISITDKRSG
GYRB_STAAN      IYHQAYKKGVPQDLKEVGTTDKTGTVIRFKADGEITETTVYNYETLQQRIRELAFLNKGIQITLXXXXXX
GYRB_STAAM      IYHQAYKKGVPQDLKEVGTTDKTGTVIRFKADGEITETTVYNYETLQQRIRELAFLNKGIQITLXXXXXX
GYRB_BORHE      LFKQTYSRGIPTSEVDIGVSSARGTKVTFLADSEIFETLEYDFETLSKRLRELAFLNDKIRISIEDRR--
GYRB_TREPA      EYYQKFNVGMPLAPVEKGVSEKRGTIIRWQADPSIFKETVAYDFDVLTRLRELAFLNSTVVIQLRDERLA
GYRB_STRP8      IHYQEFKRAVVADLEXXXXXXXXXXXXHFTPDPEIFTETTQFDYSVAKRIQELAFLNRGLKISITDKRSG
GYRB_STRP6      IHYQEFKRAVVADLEXXXXXXXXXXXXHFTPDPEIFTETTQFDYSVAKRIQELAFLNRGLKISITDKRSG
GYRB_STAAW      IYHQAYKKGVPQDLKEVGTTDKTGTVIRFKADGEITETTVYNYETLQQRIRELAFLNKGIQITLXXXXXX
GYRB_STAAU      IYHQAYKKGVPQDLKEVGTTDKTGTVIRFKADGEITETTVYNYETLQQRIRELAFLNKGIQITLXXXXXX
GYRB_STAAS      IYHQAYKKGVPQDLKEVGTTDKTGTVIRFKADGEITETTVYNYETLQQRIRELAFLNKGIQITLXXXXXX
GYRB_STAA3      IYHQAYKKGVPQDLKEVGTTDKTGTVIRFKADGEITETTVYNYETLQQRIRELAFLNKGIQITLXXXXXX
GYRB_THEMA      IYRQRYERGKPVTPVEVGETDKHGTIVRFKPDPLIFSETEFDPDILEHRLREIAFLVPGLKIEFEDR---
GYRB_STAAR      IYHQAYKKGVPQDLKEVGTTDKTGTVIRFKADGEITETTVYNYETLQQRIRELAFLNKGIQITLXXXXXX
GYRB_STAAC      IYHQAYKKGVPQDLKEVGTTDKTGTVIRFKADGEITETTVYNYETLQQRIRELAFLNKGIQITLXXXXXX
GYRB_STRP1      IHYQEFKRAVVADLEVIXXXXXXXXXXHFTPDPEIFTETTQFDYSVAKRIQELAFLNRGLKISITDKRSG
GYRB_BORBU      IFRQTFSKGIPTSKVEVGESSVTGTKVTFLADSEIFETLDYNFDVLEKRLKELAFLNDKIYISIEDKRIG
GYRB_CHLMU      AYSMEFSKGAPLTALQVGSTDKRGTEILFYPDPTVFSTCVFDRAILMKRLRELAFLNRGITIIFEDDRDA
GYRB_SPICI      KYVMEFHNGILTPIKXXXXXXXXXXXXXFLPDEKIFKETTIFSFSIQNRIKQLVFLNKGLEISLVDLR--
GYRB_CHLPN      CYQMEFSRGIPVTPLQYVSVSDRGTEIVFYPDPKIFSTCTFDRSILMKRLRELAFLNRGITIVFEDDRDV
GYRB_ARCFU      IYYQKYQRGSRSEVL--GETKEHGTTVRFKPDREIFETTEFKYEIVAQRLKELAYLNRGLKIILFDER--
PARE_BACSU      VYQQRFENGGKPSLEXXXXXXXXXXXXHFKPDPTMFSTTTYNFETLSERLRESAFLLKGLKIELIDER--
GYRB_CAMJE      IYRQEFEGKVISEFGVIGKSKKTGTTIEFWPDDQIFEVTEFDYEILAKRFRELAYLNPKITINFKDNRVG
GYRB_MYCAT      FYYQKYINGKPLEVIGEVNKDETGTRIKFHPDYQIMDKVAFDFGTIIDHAKQIAYLNKGLSISCED----
GYRB_SHIFL      IHRQIYEHGVPQALAVTGETEKTGTMVRFWPSLETFTNVTEFEYEIAKRLRELSFLNSGVSIRLRDKRDG
GYRB_ECOLI      IHRQIYEHGVPQALAVTGETEKTGTMVRFWPSLETFTNVTEFEYEIAKRLRELSFLNSGVSIRLRDKRDG
GYRB_ECO57      IHRQIYEHGVPQALAVTGETEKTGTMVRFWPSLETFTNVTEFEYEIAKRLRELSFLNSGVSIRLRDKRDG
PARE_STAAW      IYHQSFKNSPSSGLXXXXXXXXXXXXXXFKPDDTIFKASTSFNFDVSERLQESAFLLKNLKITLNDLR--
PARE_STAAU      IYHQSFKNSPSSGLXXXXXXXXXXXXXXFKPDDTIFKASTSFNFDVSERLQESAFLLKNLKITLNDLR--
PARE_STAAN      IYHQSFKNSPSSGLXXXXXXXXXXXXXXFKPDDTIFKASTSFNFDVSERLQESAFLLKNLKITLNDLR--
PARE_STAAM      IYHQSFKNSPSSGLXXXXXXXXXXXXXXFKPDDTIFKASTSFNFDVSERLQESAFLLKNLKITLNDLR--
PARE_STAAC      IYHQSFKNSPSSGLXXXXXXXXXXXXXXFKPDDTIFKASTSFNFDVSERLQESAFLLKNLKITLNDLR--
PARE_STAA8      IYHQSFKNSPSSGLXXXXXXXXXXXXXXFKPDDTIFKASTSFNFDVSERLQESAFLLKNLKITLNDLR--
GYRB_CHLTR      AYSMEFSRGAPLTTLQVGPTDKRGTEVLFYPDPAIFSTCVFDRAILMKRLRELAFLNRGVTIVFEDDRDT
GYRB_SALTY      IHRQIYEHGVPQALAVTGDTDKTGTMVRFWPSHETFTNVTEFEYEIAKRLRELSFLNSGVSIRLRDKRDG
GYRB_SALTI      IHRQIYEHGVPQALAVTGDTDKTGTMVRFWPSHETFTNVTEFEYEIAKRLRELSFLNSGVSIRLRDKRDG
PARE_STAAR      IYHQSFKNSPSSGLXXXXXXXXXXXXXXFKPDDTIFKASTSFNFDVSERLQESAFLLKNLKITLNDLR--
PARE_STAAS      IYHQSFKNSPSSGLXXXXXXXXXXXXXXFKPDDTIFKASTSFNFDVSERLQESAFLLKNLKITLNDLR--
GYRB_ORYSJ      EYRQNYSRGLTSRTLSDESSSRQGTRIRFWPDKHIFTTTMDFDFNIAGRIRELAFLNPELTIALTK----
GYRB_AQUAE      IYRMAFKRGVVEPLHVVGETKKRGTKVSFKPDPEIFETTEIKFDIVEKRVRELAYLNPEVKFELTDERLG
PARE_STRPN      VYKQRFENGGKPKKIGTAPKSKTGTKVTFMPDATIFSTTDFKYNTISERLNESAFLLKNVTLSLTDKRT-
GYRB_HAEIN      VHEQFYHLGEPQSLTVIGETEATGTTVRFWPSSDIFAITTFDYKILAKRLRELSFLNSGVSIRLIDKRDG
GYRB_NICBE      EYQQKYSRGKPDLPVEMRDRQGTA--IRFWPDKEVFTTEMQFDYNIAGRIRELAFLNPELTIALKK----
GYRB_PSEAE      VWEQVYHHGVPQPLREVGETDGSGTEVHFKPSPETFSNIHFSWDILAKRIRELSFLNSGVGILLRDERTG
GYRB_VIBPA      IHTQTYRHGEPEALAVVGDTDKTGTQIRFWPSAETFSNTEFHYDILAKRLRELSFLNSGVSIKLIDER--
PARE_MYCGA      MYYQDGGKII-QPLKKVGNSTKHGTIVQFWPDPTIFKNIQFNPYMIKERLHESSFLFKGLKIVFVD----
GYRB_RICCN      EYLMRFNNGITEAAVVKENIDKKGTEVTFFPSVETFTNIEFDFGTIEHRLRELAFLNSGVKILLVDNRF-
GYRB_VIBCH      IHSQTYHHGVPQALAXXXXXXXXXXXXXFWPSAQTFTNIEFHYDILAKRLRELSFLNSGVSIKLTDEREE
GYRB_MYCCT      EFKNGGKLEKPLTFIN--TTYKTGTTINFLPDDTIFSNAKFNFSLISERLKESALLNSGLKITLSDL---
PARE_MYCGE      IYQSVYXXXXXXXXXXXXXXDTTGTTVSFHADPKVFKKAQFDSNIIKSRLKELSFLFAKLKLTFTDQK--
GYRB_MYXXA      VYEQAYAQGVPDTPPEVGTTDKRGTHIAFKPDATVMELVEFNFETLSQRLRELAFLNAGLHIVVRDERTN
GYRB_BUCAI      KYQQIYRHGKPENLSXXXXXXXXXXYIRFWPSYKTFTNNIKFQYEISKRLRELSFLNSNIAIYLEDNRT-
GYRB_PSEPU      IWEQTYVHGVPQAMAVVGESETTGTHIHFKPSAETFKNIHFSWDILAKRIRELSFLNSGVGILLKDERSG
GYRBM_ARATH     EHKQNYSRGKPITTLTCRESKGTGTSIRFWPDKEVFTTAIEFDHNIAGRIRELAFLNPKVTISLKKE---
GYRB_RICFE      EYLIRFNNGITEAAVVNEDINKKGTEVTFFPSVETFTNIEFDFGTIEHRLRELAFLNSGVKILLVDNRF-
GYRB_RICBR      EHLIRFNNGITEAAVVKENVDKKGTEVTFFPSVETFTNIEFDFSIIEHRLRELAFLNSGVKILLTDNRF-
GYRB_BUCBP      IYYQIYKNGYPNTLSXXXXXXXXXXXXRFWPNLEIFTNVTQFNWEISKRLRELSFLNSNVSIYLDDAKKH
GYRB_BUCAP      XXXXXXXXGNPESLCIIGATEITGTYIRFWPSYKIFTNKTQFQYEISKRLRELSFLNSNILIHLKDNR--
GYRBP_ARATH     EFQQKYSRGKPVTTLTPPESRGTGTCIRFWPDKEFTTAIQFDHNTIAGRIRELAFLNPKVTISLKK----
PARE_STAES      IYTQNFKNGIPXXXXXXXXXXXXXXXXXXXPDSEIFKSTTTFNFDISERLQESAFXXXXXXXXXXXXR--
PARE_STAEQ      IYTQNFKNGIPXXXXXXXXXXXXXXXXXXXPDSEIFKSTTTFNFDISERLQESAFXXXXXXXXXXXXR--
GYRB_HELPY      IYRQEFEKGIPTSELETKSAKESGTTIEFFPDESVMEVVEFQAGILQKRFKEMAYLNDGLKISFKEEK--
GYRB_HELPJ      IYRQEFEKGIPISELETKSAKESGTTIEFFPDESVMEVVEFQAGILQKRFKEMAYLNDGLKISFKEEK--
GYRB_RICPR      EYFIRFNNGITEASIVKENIDKKGTEVTFFPSVGTFTNIEFDFVTIEHRLRELAFLNSGVKILLVDNRF-
GYRB_RICTY      EYFIRFNNGITEASIVKENIDKKGTEVTFFPSVGIFTNIEFDFVTIEHRLRELAFLNSGVKILLIDNRF-
GYRB_NEIGO      EHFVRFVRGETEEPLKVGDSDKKGTTVRFLAGTETFGNIEYSFDILAKRIRELSFLNNGVDIELTDER--
GYRB_CAUCR      VHQMRFERAVTSLKVTGGPKAGTGTEVTFFPSKDTFAFIEFDRKTLEHRLRELAFLNSGVTIWFKDHR--
GYRB_CAUCN      VHQMRFERAVTSLKVTGGPKAGTGTEVTFFPSKDTFAFIEFDRKTLEHRLRELAFLNSGVTIWFKDHR--
PARE_CAUCR      EHLQVFSRGKPGPIQQVAPSKKKGTMVRFKPDDEIFGEGTNFKPALYRMARSKAYLFRGVQIK-------
GYRB_BARBK      LYRQRFSRGIPQSGLEGDVYNRRGTRVCFHPDSQIFGENTAFDPEIYKIARSKAYLFNGVKIRWNCD---
PARE_RICCN      LYSQSYSKGLTDLICEEASKRLRGTSINFTPDPEIFSEKLHFNPKIYELARSKAYLYRGVTIEWAC----
PARE_MYCPN      VYRSVYENGIKQKAHCIGNAKEHGTSVTFRPDPKVFKKIHFDSELIRARLKELAFLFKKLQLTFVD----
PARE_RICFE      LYSQSYSKGLTDLICEEASKRLRGTSINFTPDPEIFSEKLHFNPKIYELARSKAYLYRGVTI--------
GYRB_CYTAU      VHQQEYKKGIPQDVKEIGESEIHGTKVQFLPDDSIFTSSEYKYETIANRLRELSFLNKGIRITLQDHR--
PARE_RICBR      LYKQSYAKGLTELICEEAPKRLKGTSINFIPDPEIFGDKIHFNPKVYELARSKAYLYRGVTI--------
GYRB_CYTHU      VHQQEYKKGIPQDVKEIGESDLHGTKVQFLPDDTIFTSSEYKYETIANRLRELSFLNKGIRITLQDHR--
PARE_RICPR      LYSQSYSKGLTDLISAEASKRLRGTSINFTPDPEIFSEKLHFNPKIYEIARSKAYLYRGVSI--------
GYRB_FLEEL      VFQQKYSTGNPQGAVEVGQSDRTGTTIYFEPDATIFATTEYKYETVSKRLRELSYLNKGIRLTLTDLR--
PARE_RICTY      LYSQSYSKGLTDLISTEVSKRLRGTSINFTPDPEIFSETLHFNPKIYEIARSKAYLYRGVSI--------
PARE_PSEAE      EYRMTFADGFKDEVIGTVGKRNTGTSVHFWPDPKYFDSAKFSVSRLKHVLKAKAVLCPGLSVVFEDK---
PARE_ECOLI      VYFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSPRFSVSRLTHVLKAKAVLCPGVEITFKD----
PARE_SALTY      VYFENGEKVQDLQVVGTCGKRNTGTSVHFWPDESFFDSPRFSVSRLMHVLKAKAVLCPGVEITFKD----
PARE_SALTI      VYFENGEKVQDLQVVGTCGKRNTGTSVHFWPDESFFDSPRFSVSRLMHVLKAKAVLCPGVEITFKD----
GYRB_FLEJA      IFEQEYHRGVPQYAVEIGAXXXXXXXXHFKPDGEIFTETSYNREILAGRLRELAYLNRKIRITLTDER--
PARE_HAEIN      IYKIAFENGSKVEELEXXXXXXXXXXVHFKPNPKYFDSAKFSVSRLRHLLRAKAVLCSGLEIKFIDK---
GYRB_BACCE      IHYQKYERGIPADLKVIGDTDQTGTITRFKPDPEIFQETTVYDFDLATRMRELAFLNRNIKLTIEDKR--
GYRB_BACMY      IHYQKYERGVPADLRVIGETDRTGTITRFKPDSEIFTETTEYEFDLATRMRELAFLNRNIKLTIEDKR--
GYRB_SYNY3      EHFQRFERGNPIGTLEATPNEGTGTQVSFLPDTQIFKDGIEFDYHLASRLKELAYLNAGVRITFGDRRA-
GYRB_ACIBA      IHEQEYHHGDPQYPLRVGETDNTGTTVRFWPSAETFSQTIFNVEILARRLRELSFLNAGVRIVLRDERIN
GYRB_ACIHA      EHQQEYHHGDPQYPLRVGETDRTGTIVRFWPSAETFSQTIFNVDILARRLRELSFLNAGVRIVLRDERV-
GYRB_ACIGB      IHQQEYKHGDPVYPLKVGDVETTGTIVRFWPSTETFSQTIFNVDILARRLRELSFLNAGVRIVLRDERVA
GYRB_ACIJU      IHEQEYCHGDPQYPLKVGETDKTGTTVRFWPSELTFSQTIFSVDILARRLRELSFLNAGVRIVLRDERV-
GYRB_ACILW      QEYRHGDSQYPLKVV--GDTNRTGTRVRFWPSAETFSQTIFNVDILARRLRELSFLNAGVRIVLRDER--
GYRB_ACIG9      QEYRHGDSQYPLKVV--GDTNRTGTRVRFWPSAETFSQTIFNVDILARRLRELSFLNAGVRIVLRDER--
GYRB_ACIG3      VHEQEYHHGDPQYPLRVGETDSSGTTVRFWPSELTFSQTIFNVEILARRLRELSFLNAGVRIVLRDERIN
GYRB_ACICA      VHEQEYQHGDPQYPLRVGETDKSGTTVRFWPSELTFTQTIFNVEILARRLRELSFLNAGVRIVLRDERIN
GYRB_ACIG6      THEQEYDSQYPLKVI--GETDKSGTVIRFWPSELTFSQTIFSVEILARRLRELSFLNAGVRIVLRDERVN
GYRB_ACIJO      IHQQEYKHGDPVPLXXXXXXXXXXXXXRFWPSAETFSQTIFNVDILARRLRELSFLNAGVRIVLRDERIH
PARE_BORBU      SFEALFSKGKLLESREIKSSDKDGTYVEFLADSEIFGKYSYSEDFLKRRFFHYACLNKGLIINYNDQ---
GYRB_PROMI      IHQQIYRSGVPDDRLKVGETDKSGTFVRFWPSLD------------------------------------
GYRB_ACIS9      IHEQEYAHGDPQYPLKVGETDTSGTTVRFWPSEWTFSQTIFSVDILARRLRELSFLNAGVRIVLRDER--
GYRB_ACIS6      IHEQEYAHGDPQYPLKVGETDTSGTTVRFWPSELTFSQTIFSVDILARRLRELSFLNAGVRIVLRDER--
GYRB_ACIGA      IHQQEYKHGDPVYPLKVGDIETTGTTVRFWPSAETFSQTIFNVDILARRLRELSFLNAGVRIVLRDER--
GYRB_ACIS8      IHEQEYQHGVPQPLRVVGQTERTGTKVRFWPSAETFSQTIFNVDILARRLRELSFLNAGVRIVLCDER--
GYRB_ACIS7      IHEQEYQHGDPQPLKXXXXXXXXXXXXRFWPSGDTFSQTIFNVDILARRLRELSFLNAGVKIVLRDER--
GYRB_RHOCA      ----------------------------------------------------------------------
TOP2_CAEEL      ----------------------------------------------------------------------
TOP2M_CAEEL     ----------------------------------------------------------------------
TOP2M_DICDI     ----------------------------------------------------------------------
TOP2_SCHPO      TWYDNMSRK-SEPVITSLKKPDEYTKITFKPDLAMDKIDDDMVSIIKRRIYDMAGTVRETKVYLNNER--
TOP2_CANAL      SWTNNMS-NVSKPKITTLRTKKEYTKITFRPDLDMDCLDNDLLSVLRRRVYDLCGTVKNCNIYLNDKRLN
TOP2_DICDI      QTFTNNMRSKEDPKITSYQNKTDYTKITFYPELDMVEFDDDLVALLSKRVYDIAGCNPTLKVSL------
TOP2B_MOUSE     EYKHSFKQTWMNNMMKTSEAKEDYTCITFQPDLKMEKLDKDIVALMTRRAYDLAGSCKGVKV--------
TOP2B_HUMAN     EYKHSFKQTWMNNMMKTSEAKEDYTCITFQPD--------------------------------------
TOP2B_CRILO     EYKHSFKQTWMNNMMKTSEAKEDYTCITFQPDLKMEKLDKDIVALMTRRAYDLAGSCKGVKV--------
TOP2B_CHICK     HWMNNMMKTSEPKIFEGDDY----TCITFQPDLKMENLDKDIVSLMTRRAYDLAGSCKGVKVMLNGKK--
TOP2_PLAFK      ----------------------------------------------------------------------
TOP2_PICGU      TWTNNM-ANXXXXXXXXXXXXXEYTKVTFKPDLSKFHMEMLDDDILSRRVYDLCGTVKDCNIYLNDKKL-
TOP2_MIMIV      ----------------------------------------------------------------------
TOP2A_PIG       ----------------------------------------------------------------------
TOP2A_HUMAN     ----------------------------------------------------------------------
TOP2_BOMMO      HWGSNMTKASEPKIKDSGK-DDDFTKIVFSPDLKMEKLEDDIVLLMSRRAYDVAASSQGVKVYLNGER--
TOP2A_MOUSE     ----------------------------------------------------------------------
TOP2_PENCH      RQKKKYKQTWTENMTKMGKAKITDTKVTFKPD--------------------------------------
TOP2_PEA        ----------------------------------------------------------------------
TOP2_ARATH      KYKQVFENNMSEPVITKCNKSENWTKVTFKPD--------------------------------------
TOP2A_CRIGR     EYKKMFKQTWMDNMGRAGDMEEDYTCITFQPDLKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNK--
TOP2A_RAT       TWMDNMGRAGDMELKPFSGE--DYTCITFQPDLKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNR--
TOP2A_CHICK     TWTDNMGKAGEMTLFDGEDY----TCVTFQPDLKMTILDKDIVALMSRRAYDIAGSTKDVKVFLNGKR--
TOP2_DROME      TWGNNMGKA-SDVQIKDFN--GTDTRITFSPDLKMDRLDEDIVALMSRRAYDVAASSKGVSVFLNGNK--
TOP2_IIV3       ----------------------------------------------------------------------
TOP2_CANGA      KYVQTWENNM------------------------------------------------------------
TOP2_YEAST      KYVQKWENNM------------------------------------------------------------
TOP2_IIV6       ----------------------------------------------------------------------
TOP2_TRYBB      EWQDHMRKATAPRVSNVGTKEKNVTRVKFLPDYE------------------------------------
TOPL_BPT4       NIVVRCSNGMENKSWEDIPGKWKGTRVTFIPD--------------------------------------
TOP2_LEICH      ----------------------------------------------------------------------
TOP2_ASFP4      ----------------------------------------------------------------------
TOP2_ASFWA      ----------------------------------------------------------------------
TOP2_ASFK5      ----------------------------------------------------------------------
TOP2_ASFB7      ----------------------------------------------------------------------
TOP2_ASFM2      ----------------------------------------------------------------------
TOP2_TRYCR      EWHDHMRRATAPRVSNVDPKEKNLTRVKFLPDYE------------------------------------
TOP2_CRIFA      EFHMSW----------------------------------------------------------------
TOPS_BPT4       ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXXXXXXXSLDEIDNETELVEETTDAXXXXXXXXXXXIFHYPNGLEDYVQYLNRSKTNI
GYRB_MYCSM      AEEV----------------VDDVVKDTAEAPKTADAEATGPSKVKHRVFHYPGGLVDYVKHINRTKTPI
GYRB_MYCS2      AEEV----------------VDDVVKDTAEAPKTADAEATGPSKVKHRVFHYPGGLVDYVKHINRTKTPI
GYRB_MYCPA      NEEV----------------VDEVVSDTAXXXXXXXXXXXXXHKVKHRTFHYPGGLVDFVKHINRTKNPI
GYRB_MYCTU      XXXXXXXXXXXXXXAPKSAS--------ERAAEST-----APHKVKSRTFHYPGGLVDFVKHINRTKNAI
GYRB_MYCTA      XXXXXXXXXXXXXXAPKSAS--------ERAAEST-----APHKVKSRTFHYPGGLVDFVKHINRTKNAI
GYRB_MYCLE      QDEVVDDVVSDTAEAPVAMTVEEKSTESSAPHKVRHRT-----------FHYPGGLVDFVKHINRTKTPI
GYRB_STRCO      XXXXXXXXXXXXXXXXXVKSVS---------------------------YHYEGGIVDFVTYLNSRKGEV
GYRBS_STRSH     AKAVVGAD----------------------VAGTDSAETPGEEPVRSVTYYYEGGIVDFVKYLNSRKGDI
GYRB_BACSU      ---------------------QERKNE----------------------YHYEGGIKSYVEYLNRSKEVV
GYRBR_STRSH     ARATA--------------AVDEADSDPTAKTVS---------------YRYDGGITDFVVHLNARKGEA
GYRB_CLOAB      K------------------------NE---------------------IFHYEGGLKSFVSYLNRNKEVV
GYRB_HALSQ      -------------------------------ESST--------------FLFEGGIREFVEYLNETKTAL
GYRB_BACHD      -------------------------------EEKSDE------------FHYEGGIASFVEHLNRTRETL
GYRB_MYCGE      NPQSFS-------------------------------------------WKYDGGLVEYIHHLNNEKEPL
GYRB_STAES      --------------------------EEEVREDS---------------YHYEGGIKSYVDLLNENKEPL
GYRB_STAEQ      --------------------------EEEVREDS---------------YHYEGGIKSYVDLLNENKEPL
GYRB_MYCGA      ------------------------DKKTKQE------------------WLYEGGIKQYVENLNASKEPI
GYRB_BACAN      --------------------------EHKQKKE----------------FHYEGGIKSYVEHLNRSKQPI
GYRB_MYCPN      NPQSFS-------------------------------------------WKYDGGLVQYIHHLNNEKEPL
GYRB_TREDE      TP-----------------------------KEVT--------------FAFEGGISQFVSYLNESKQVF
GYRB_MYCHO      ----------------------------ENVEKNI-----------IKVFCFEGGLIDYVKELNKGKKLI
GYRB_STRR6      ------------------------------LEQTKH-------------YHYEGGIASYVEYINENKDVI
GYRB_STRPN      ------------------------------LEQTKH-------------YHYEGGIASYVEYINENKDVI
GYRB_STRP3      -----------------------MEQEEH--------------------FHYEGGIGSYVEFLNDKKDVI
GYRB_STAAN      XXXXXXSYHYEGG----------IKSYVELLNENKEP------------------IHDEPIYIHQSK---
GYRB_STAAM      XXXXXXSYHYEGG----------IKSYVELLNENKEP------------------IHDEPIYIHQSK---
GYRB_BORHE      ------------------------SGKEKFLE-----------------FYFEGGIKAFVDYITNNSKNI
GYRB_TREPA      T--------------------------AKQVE-----------------FAFEGGIRHFVSYLNRGKSVV
GYRB_STRP8      -----------------------MEQEEH--------------------FHYEGGIGSYVEFLNDKKDVI
GYRB_STRP6      -----------------------MEQEEH--------------------FHYEGGIGSYVEFLNDKKDVI
GYRB_STAAW      XXXXXXSYHYEGG----------IKSYVELLNENKEP------------------IHDEPIYIHQSK---
GYRB_STAAU      XXXXXXSYHYEGG----------IKSYVELLNENKEP------------------IHDEPIYIHQSK---
GYRB_STAAS      XXXXXXSYHYEGG----------IKSYVELLNENKEP------------------IHDEPIYIHQSK---
GYRB_STAA3      XXXXXXSYHYEGG----------IKSYVELLNENKEP------------------IHDEPIYIHQSK---
GYRB_THEMA      -----------------------INGEKKT-------------------FKFDGGIVEYVKYLNRGKKAL
GYRB_STAAR      XXXXXXSYHYEGG----------IKSYVELLNENKEP------------------IHDEPIYIHQSK---
GYRB_STAAC      XXXXXXSYHYEGG----------IKSYVELLNENKEP------------------IHDEPIYIHQSK---
GYRB_STRP1      -----------------------MEQEEH--------------------FLYEGGIGSYVEFLNDKKDVI
GYRB_BORBU      K------------------------------EKSSK-------------FYFEGGIKSFVDYLTNDSKAF
GYRB_CHLMU      -------------------GFDKVT------------------------FFYEGGIQSFVSYLNQNKESL
GYRB_SPICI      ----------------------------EEDEEKT------------VLYQFNNGIKDYVLELNKTIGTP
GYRB_CHLPN      -------------------SFDKVT------------------------FFYEGGIQSFVSYLNQNKESL
GYRB_ARCFU      ----------------------------EGKEET---------------FHFEDGIIGLVRSLNRNRKPL
PARE_BACSU      ------------------------NDQRE-------------------VFYYENGIEAFVAYLNEEK-DV
GYRB_CAMJE      KHES---------------------------------------------FHFEGGISQFVTDLNKKEALT
GYRB_MYCAT      ------------------ITKNTIRN-----------------------FCFEGGIIDYVSELNRGKKVI
GYRB_SHIFL      KEDH---------------------------------------------FHYEGGIKAFVEYLNKNKTPI
GYRB_ECOLI      KEDH---------------------------------------------FHYEGGIKAFVEYLNKNKTPI
GYRB_ECO57      KEDH---------------------------------------------FHYEGGIKAFVEYLNKNKTPI
PARE_STAAW      -------------------------SGKERQEH----------------YHYEEGIKEFVSYVNEGKEVL
PARE_STAAU      -------------------------SGKERQEH----------------YHYEEGIKEFVSYVNEGKEVL
PARE_STAAN      -------------------------SGKERQEH----------------YHYEEGIKEFVSYVNEGKEVL
PARE_STAAM      -------------------------SGKERQEH----------------YHYEEGIKEFVSYVNEGKEVL
PARE_STAAC      -------------------------SGKERQEH----------------YHYEEGIKEFVSYVNEGKEVL
PARE_STAA8      -------------------------SGKERQEH----------------YHYEEGIKEFVSYVNEGKEVL
GYRB_CHLTR      -------------------GFDKV------------------------VFFYEGGIQSFVSYLNQNKEIL
GYRB_SALTY      KEDH---------------------------------------------FHYEGGIKAFVEYLNKNKTPI
GYRB_SALTI      KEDH---------------------------------------------FHYEGGIKAFVEYLNKNKTPI
PARE_STAAR      -------------------------SGKERQEH----------------YHYEEGIKEFVSYVNEGKEVL
PARE_STAAS      -------------------------SGKERQEH----------------YHYEEGIKEFVSYVNEGKEVL
GYRB_ORYSJ      ---------------------EEDDLQVQHNE-----------------YCYAGGLVEYVKWLNTDKKSL
GYRB_AQUAE      KHL---------------------------------------------IYKFDRGIEELVKYLNEGKEPL
PARE_STRPN      ---------------------------NEAIE-----------------FHYENGVQDFVSYLNEDKEIL
GYRB_HAEIN      SEDH---------------------------------------------FHYEGGIQAFVEYLNKNKNPI
GYRB_NICBE      ---------------------EDIDPEKIQCNE----------------YFYAGGLVEYVKWLNADKKPL
GYRB_PSEAE      K------------------------------EE---------------LFKYEGGLKAFVEYLNTNKTAV
GYRB_VIBPA      ----------------------EADKQDH--------------------FMYEGGIQAFVQHLNTNKTPI
PARE_MYCGA      ------------------------ENNPELSQT----------------FIAKDGILEYLKYVNENKKSI
GYRB_RICCN      -------------------------EEVKEVE-----------------FYYTGGIEAYVKYIDRAKHAI
GYRB_VIBCH      ---------------------DKKDH-----------------------FMYEGGIQAFVTHLNRNKTPI
GYRB_MYCCT      -----------------------ISNR--YVE-----------------YQFQDGLVEFVKELVDDKTPV
PARE_MYCGE      ------------------------------TNKTT-------------VFFSTSGLVQFLDEINNTVETL
GYRB_MYXXA      KEHD---------------------------------------------FKFDGGISSFVEYLNKSKQTL
GYRB_BUCAI      ----------------------SIKN----------------------CYHYKGGIKAFIKFLNAKKTPI
GYRB_PSEPU      K------------------------------EE---------------FFKYEGGLRAFVEYLNTNKTPV
GYRBM_ARATH     ---------------------DDDPEKTQYSE-----------------YSFAGGLTEYVSWLNTDKNPI
GYRB_RICFE      -------------------------EEAKEVE-----------------FYYTGGIEAYVKYIDRAKHAV
GYRB_RICBR      -------------------------EEVKEVE-----------------FYYTGGIEAYVKYLDRAKHAV
GYRB_BUCBP      I------------------------NEN---------------------FYQQGGLKEFIIYLNKNKKPI
GYRB_BUCAP      ---------------------------TNLEEK----------------YHYKGGIKAFIKFLNKNKFPI
GYRBP_ARATH     ---------------------EDDDPERDVYSE----------------YFYAGGLTEYVSWLNTDKKPL
PARE_STAES      ----------------SGKEREEIYHYEEGIKE-------------------------FVSYVNEGKEVL
PARE_STAEQ      ----------------SGKEREEIYHYEEGIKE-------------------------FVSYVNEGKEVL
GYRB_HELPY      ---------------------------TQLQET----------------YFYEDGLKQFVK--DSAKKEL
GYRB_HELPJ      ---------------------------TQLQET----------------YFYKDGLKQFVK--DSAKKEL
GYRB_RICPR      -------------------------EEVKKVE-----------------FYYTGGIEAYVQYIDRAKHAI
GYRB_RICTY      -------------------------EEVKKVE-----------------FFYTGGIEAYVQYIDRAKHAI
GYRB_NEIGO      ------------------------DGKHES-------------------FALSGGVAGFVQYMNRKKTPL
GYRB_CAUCR      --------------------------DVEPWEEK---------------LFYEGGIEAFVRHLDKAKTPL
GYRB_CAUCN      --------------------------DVEPWEEK---------------LFYEGGIEAFVRHLDKAKTPL
PARE_CAUCR      ------------------WSCDPSRIHDQTPPEAT--------------FHFPNGLADFLAERTKGLTTI
GYRB_BARBK      -----------------PAALKDAKNIPE-----------------KDVFYFPDGLKDYLSLSLKNKHLV
PARE_RICCN      ----------------------EVEVQSDIPKKA--------------LISFPNGLKDYLSSKITLDNLV
PARE_MYCPN      --------------------------ETGSGEKE--------------VFFTEAGISQYLDELNADSKQI
PARE_RICFE      ----------------------EWECEVEVPSDIPKKA----------LINFPNGLKDYLSSKITLDNLI
GYRB_CYTAU      ----------------------EVDADGKSEIET---------------FHSEGGLREFVEYVDSTRERL
PARE_RICBR      ------------------------EWECE-IEASSDVPKKA-------LINFPNGLKDYLSSKITPDDLI
GYRB_CYTHU      ----------------------QVDAEGKSEIE---------------MFHSEGGLREFVDYLDSTREKL
PARE_RICPR      ----------------------EWECEVEVPSDIPKKA----------LINFPNGLKDYLSSKISLDNLV
GYRB_FLEEL      ----------------------ETDEQRHLYEE----------------FFSEGGLKEFVEHLDSTRQPL
PARE_RICTY      ----------------------EWECEVEVPSDIPKKA----------LINFPNGLKDYLSSKISLDNLV
PARE_PSEAE      -------------------------NTGERVE-----------------WHFEDGLRSYLTDAVAELPRL
PARE_ECOLI      ----------------------EINNTEQR-------------------WCYQDGLNDYLAEAVNGLPTL
PARE_SALTY      ----------------------EVNNSEQR-------------------WCYQDGLNDYLGEAVNGLPTL
PARE_SALTI      ----------------------EVNNSEQR-------------------WCYQDGLNDYLGEAVNGLPTL
GYRB_FLEJA      ----------------------EKDEQGNVLSEP---------------FYSEGGIMEFVQMLDRNRNSL
PARE_HAEIN      ------------------------------VNNTQD------------IWLYEDGLSDYIEAVNGFETLP
GYRB_BACCE      --------------------------ERKQKKE----------------FHYEGGIKSYVEHLNRSKQPI
GYRB_BACMY      --------------------------EHKQKKE----------------FHYEGGIKSYVEHLNRSKQPI
GYRB_SYNY3      ---------------------DSLKEEQ---------------------FYYEGGIREYVTYMTTDKTPL
GYRB_ACIBA      LEH---------------------------------------------VYDYEGGLSEFVKYINEGKNHL
GYRB_ACIHA      ----------------------NLEN----------------------VYDYEGGLSEFVRYINEGKTHL
GYRB_ACIGB      LEH---------------------------------------------VFDYEGGLSEFVKYINQGKTHL
GYRB_ACIJU      ----------------------NLEN----------------------VYDYEGGLSEFVKYINEGKTHL
GYRB_ACILW      -----------------------INAE--------------------HVFDYEGGLSEFVKYINEGKTHL
GYRB_ACIG9      -----------------------INAE--------------------HVFDYEGGLSEFVKYINEGKTHL
GYRB_ACIG3      LEH---------------------------------------------VYDYEGGLSEFVKYINEGKTHL
GYRB_ACICA      LEH---------------------------------------------VYDYEGGLSEFVKYINEGKTHL
GYRB_ACIG6      FEH---------------------------------------------VYDYEGGLSEFVKYINEGKTHL
GYRB_ACIJO      AEH---------------------------------------------VFDYEGGLSEFVKYINQGKTHL
PARE_BORBU      ------------------------------------------------IFESKNGLLDFLNSEIKSDDLL
GYRB_PROMI      ----------------------------------------------------------------------
GYRB_ACIS9      ----------------------------------------------------------------------
GYRB_ACIS6      ----------------------------------------------------------------------
GYRB_ACIGA      ----------------------------------------------------------------------
GYRB_ACIS8      ----------------------------------------------------------------------
GYRB_ACIS7      ----------------------------------------------------------------------
GYRB_RHOCA      ---------------------------------------------------------EFVKYLDRSKTAV
TOP2_CAEEL      ------------------------------------------------------GFEDYVQYTSQFNNEG
TOP2M_CAEEL     -----------------------------------------------------DGFEDYVKMFNDSSSLL
TOP2M_DICDI     ----------------------------------------------------------------------
TOP2_SCHPO      -----------------------------------------------------SGFKKYVEYLSDTKPDE
TOP2_CANAL      ------------------------------------------------ISSFKGYVEMYVKAIKERSPEP
TOP2_DICDI      -------------------------NDEEL------------------------GIRSFEKYINLYPDEE
TOP2B_MOUSE     ----------------------------------------------------------------------
TOP2B_HUMAN     ----------------------------------------------------------------------
TOP2B_CRILO     ----------------------------------------------------------------------
TOP2B_CHICK     ----------------------------------------------------------------------
TOP2_PLAFK      ----------------------------------------------------------------------
TOP2_PICGU      ----------------------SIRNFKSYVEMYVNAIRERSPDPVA-----PEG-----------ETRN
TOP2_MIMIV      ----------------------------------------------------------------------
TOP2A_PIG       ------------------------------------------------------GFRSYVDLYLKDKVDE
TOP2A_HUMAN     ------------------------------------------------------GFRSYVDMYLKDKLDE
TOP2_BOMMO      ------------------LKINKFKDYVDL---------------------YIKGKDD---------ENG
TOP2A_MOUSE     ----------------------------------------------------------------------
TOP2_PENCH      ----------------------------------------------------------------------
TOP2_PEA        ----------------------------------------------------------------------
TOP2_ARATH      ----------------------------------------------------------YLSAANKSRTE-
TOP2A_CRIGR     ----------------------------------------------------------------------
TOP2A_RAT       ----------------------------------------------------------------------
TOP2A_CHICK     ----------------------------------------------------------------------
TOP2_DROME      ----------------------------------------------------------------------
TOP2_IIV3       ----------------------------------------------------------------------
TOP2_CANGA      ------------------------------------------------IRNFKNYVELYLKSLEKMRSDT
TOP2_YEAST      ----------------------------------------------------------------------
TOP2_IIV6       ---------------------------------------------------------DYTKLFKLEKESI
TOP2_TRYBB      ----------------------------------------------------------------------
TOPL_BPT4       ----------------------------------------------------------------------
TOP2_LEICH      ----------------------------------------------------------------------
TOP2_ASFP4      --------------------------------------------------------------LSAPNSTI
TOP2_ASFWA      --------------------------------------------------------------LSAPNGTI
TOP2_ASFK5      -------------------------------------------------------------------STI
TOP2_ASFB7      --------------------------------------------------------------LSAPNSTI
TOP2_ASFM2      --------------------------------------------------------------LSAPNSTI
TOP2_TRYCR      ----------------------------------------------------------------------
TOP2_CRIFA      ----------------------------------------------------------------------
TOPS_BPT4       ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           HPSIVSFEAKGDDHEVEVAMQWNSSYKESVHTFANTINTREGGTHEEGFRSALTSLMNRYAREHKLLKEK
GYRB_MYCSM      QQSIIDFDGKGPGHEVEIAMQWNAGYSESVHTFANTINTHEGGTHEEGFRAALTSVVNRYAXXXXXXXXX
GYRB_MYCS2      QQSIIDFDGKGPGHEVEIAMQWNAGYSESVHTFANTINTHEGGTHEEGFRAALTSVVNRYAXXXXXXXXX
GYRB_MYCPA      HQSIIDFGGKGPGHEVEIAMQWNGGYSESVHTFANTINTHEGGTHEEGFRSALTSVVNKYAXXXXXXXXX
GYRB_MYCTU      HSSIVDFSGKGTGHEVEIAMQWNAGYSESVHTFANTINTHEGGTHEEGFRSALTSVVNKYAKDRKLLKDK
GYRB_MYCTA      HSSIVDFSGKGTGHEVEIAMQWNAGYSESVHTFANTINTHEGGTHEEGFRSALTSVVNKYAKDRKLLKDK
GYRB_MYCLE      QQSIIDFDGKGAGHEVEVAMQWNGGYSESVHTFANTINTHEGGTHEEGFRSALTSVVNKYAXXXXXXXXX
GYRB_STRCO      HPTVIDLEAEDKDKSLEVAMQWNGGYTEGVYSFANIIHTHEGGTHEEGFRAALTSLINKYARDKKLLREK
GYRBS_STRSH     HPTVIDIDAEDKERSVEIAMQWNSQYSEGVYSFANTIHTHEGGTHEEGFRAAMTGLVNRYAREKKFLREK
GYRB_BACSU      HEEPIYIEGEKDGITVEVALQYNDSYTSNIYSFTNNINTYEGGTHEAGFKTGLTRVINDYARKKGLIKEN
GYRBR_STRSH     HPSVITIAAEDTERSAEIALQWNGQYTDSVYSYANAIHTHEGGTHEEGFRTALTTVVNRYAREKRLLRDK
GYRB_CLOAB      FKEPIYVEGSIDNYSVEIALQYNDGYNENIFSFANNIHTIEGGTHLAGFKTALTRVINDYAKKFGYLKEN
GYRB_HALSQ      HDDVIYYDDESEGIEVEIAMQATDELQGSIHAFANNINTREGGTHLTGFKTALTRVVNDYANSHDMLDDL
GYRB_BACHD      HETPIHIEGEKQGVYVEIAVQYNDGFTSNIYSFANNINTHEGGTHESGFKTGLTRVINDYARKHNLFKES
GYRB_MYCGE      FNEVIADEVNRDENKVEVAFQYNKTYNQSIFSFCNNINTTEGGTHVEGFRNALVKIINRFAVENKFLKDS
GYRB_STAES      HDEPIYIHQSKDDIEVEIALQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGTQSKIIKED
GYRB_STAEQ      HDEPIYIHQSKDDIEVEIALQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGTQSKIIKED
GYRB_MYCGA      IPQIIYGEKKTKNLEVEVAFQYTNGYYNSTYSFCNNIHTNQGGTHEEGFKNALYKIINRYALEKKFIKET
GYRB_BACAN      HEEPVYVEGSKDGIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDA
GYRB_MYCPN      FEDIIFGESRDESYKVEVAFQYNKTYNQSIFSFCNNINTTEGGTHVEGFRNALVKIINRFAVENKFLKET
GYRB_TREDE      PKSPVFIEGEKNDILCEVAIQYNDGYNENLLSFVNDINTREGGTHLEGFKTALTRVMNDFLKKYKLVKDK
GYRB_MYCHO      VPEVIYAEGNGQDVIVEVAMQYNEAYTNSIVSYANNIQTIDGGTHEQGFYDALVRIYNNYAETNKLFKTS
GYRB_STRR6      FDTPIYTDGEMDDITVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTALTRVINDYARKNKLLKDN
GYRB_STRPN      FDTPIYTDGEMDDITVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTALTRVINDYARKNKLLKDN
GYRB_STRP3      FETPIYTDGELEGIAVEVAMQYTTSYQETVMSFANNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKEN
GYRB_STAAN      -----------DDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEE
GYRB_STAAM      -----------DDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEE
GYRB_BORHE      QNEPYFIEGSCDDVIVSVGLKWTEGYSDHILSFVNNINTREGGTHVAGFKSGFLKAMSEAFRDSKISKKD
GYRB_TREPA      PERPLYIEGSKSDVLVEVALQYHDGYTENVQSFVNDINTREGGTHLEGFKSALTRVANDFLKKSKLAKER
GYRB_STRP8      FETPIYTDGELEGIAVEVAMQYTTSYQETVMSFANNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKEN
GYRB_STRP6      FETPIYTDGELEGIAVEVAMQYTTSYQETVMSFANNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKEN
GYRB_STAAW      -----------DDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEE
GYRB_STAAU      -----------DDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEE
GYRB_STAAS      -----------DDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEE
GYRB_STAA3      -----------DDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEE
GYRB_THEMA      HDVIVKTKNGEDEVIVEIAFQYTDSYSEDIVSFANTIKTVDGGTHVTAFKSTLTRLMNEYGKKHNFLK-K
GYRB_STAAR      -----------DDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKED
GYRB_STAAC      -----------DDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEE
GYRB_STRP1      FETPIYTDGELEGIAVEVAMQYTTSYQETVMSFANNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKEN
GYRB_BORBU      QSEPYYIDGFINDVIVNVGLKWTESYSDNILSFVNNINTREGGTHVMGFRSGLTKAMNEAFKNSKISKKD
GYRB_CHLMU      FPTPIYIQGRGDDGDIEAALQWNSGYSELIYSYANNIPTRQGGTHLTGFSTALTRAVNSYIKSHNLAKSD
GYRB_SPICI      LNDVFYVEGIEDNIVVEFGLQYNDNYSENIFSFCNNINTHEGGTHEEGARLAIVREIXXXXXXXXXXXXN
GYRB_CHLPN      EPIYICGTRVGDDGEIEAALQWNSGYSELVYSYANNIPTRQGGTHLTGFSTALTRVINTYIKAHNLAKNN
GYRB_ARCFU      HEPIY-IETTKDGVSVEVAIQFTDSDVENIQAFANNINTSEGGSHVVGFRAGLTRAVNEYGKKH--LKKF
PARE_BACSU      LSEVVSFEGEHHSIEVDFAFQFNDGYSENILSFVNNVRTKDGGTHESGAKTAMTRAFNEYARKVALLKEK
GYRB_CAMJE      --KAIFFSVDEEDVNVEVALLYNDTYSENLLSFVNNIKTPDGGTHEAGFRMGLTRVISNYIEANASAREK
GYRB_MYCAT      IPDIIYAEGNAQDVIVNVAIQYNETYTSNIVSYANNIQTGEGGTHEQGFYDALTRIYNKYAEDNKLFKNN
GYRB_SHIFL      HPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKEGYSKKA
GYRB_ECOLI      HPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKEGYSKKA
GYRB_ECO57      HPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKEGYSKKA
PARE_STAAW      H-DVATFSGEANGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNDYARRINELKTK
PARE_STAAU      H-DVATFSGEANGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNDYARRINELKTK
PARE_STAAN      H-DVATFSGEANGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNDYARRINELKTK
PARE_STAAM      H-DVATFSGEANGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNDYARRINELKTK
PARE_STAAC      H-DVATFSGEANGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNDYARRINELKTK
PARE_STAA8      H-DVATFSGEANGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNDYARRINELKTK
GYRB_CHLTR      FPNPIYMQGSGDDGDIEAALQWNSGYSELIYSYANNIPTRQGGTHLTGFSTALTRAVNSYIKAHNLSKSD
GYRB_SALTY      HPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKEGYSKKA
GYRB_SALTI      HPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKEGYSKKA
PARE_STAAR      H-DVATFSGEANGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNDYARRINELKTK
PARE_STAAS      H-DVATFSGEANGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNDYARRINELKTK
GYRB_ORYSJ      HDPI-AFRKEMDGITVDVSLQWCSSYSDTVLGYANSIRTIDGGTHIDGLKTSLTRTINNFAKKSKTLKDK
GYRB_AQUAE      FKDIIRIQGEKEGVIVDIAFQYVKDYKERIESFVNNIKTVEGGTHVTGFRSGLSKAVIRMAQGLKLAKEL
PARE_STRPN      TP-VLYFEGEDNGFQVEVALQYNDGFSDNILSFVNNVRTKDGGTHETGLKSAITKVMNDYARKTGLLKEK
GYRB_HAEIN      HPKPFYFTAEKDGIGVEVALQWNDGVNENVYCFTNNIPQRDGGTHLAGFRGALTRSLNSYMENEGMLKKE
GYRB_NICBE      H-DVLGFRKEADGITIDMALQWCSAYSDTMLGYANSIRTIDGGTHIDGVKAALTRILNNLGKKSKTIKEK
GYRB_PSEAE      NEVFFNVQREEDGVGVEVALQWNDSFNENLLCFTNNIPQRDGGTHLAGFRSALTRNLNNYIEAEGLAKKF
GYRB_VIBPA      IEKIFHFDLEREDGSVEVAMQWNDGFQENIFCFTNNIPQRDGGTHLAGFRAALTRTLNSFMDKEGFSKKA
PARE_MYCGA      S-KIIPFKGDYEKIVVDGCFQYTDNESELIISFANSVKTSEGGSHENGFKQAMLETINDYSKKYKLINNK
GYRB_RICCN      HPCIVNTENAESGISLELAMHWNDSYHENILCFTNNIRQRDGGTHLSAFKSAITRVITSYLDTTGLNKKA
GYRB_VIBCH      HEKVFHFNQEREDGSVEVAMQWNDGFQENIYCFTNNIPQRDGGTHLAGFRGALTRTLNNYMDKEGFSKKA
GYRB_MYCCT      -TDIITINNESKNIIVEIALQYTEDDNEIILGFANNVKTIDGGTHLVGFKSGLIRAINDYAKDQKILKDK
PARE_MYCGE      GQKTL-IKGEKDGIEVEVVFQFNQSDQETILSFANSIKTFEGGSHENGFCLAISDVINSYCRKYNLLKEK
GYRB_MYXXA      HDKPISFSTEREGVMLDIAMQWNDGYDERIYTFANNINTHEGGSHLSGFKAALTRTLNSYAEKGSLWKDL
GYRB_BUCAI      HTHIFYFRSTKDQIELEIAMQWNNSHQENILCFTNNIPQKDGGTHLAGFRSGMTRTLNLHIEREGYNKKN
GYRB_PSEPU      NSQVFHFSVQREDGVVEVALQWNDSFNENLLCFTNNIPQRDGGTHLVGFRSSLTRSLNSYIEQEGLAKKN
GYRBM_ARATH     H-DVLGFRREINGATVDVALQWCSAYSDTMLGYANSIRTIDGGTHIEGVKASLTRTLNTLAKKSKTVKEK
GYRB_RICFE      HPCIVNTENTESGISLELAMHWNDSYHENILCFTNNIRQRDGGTHLSAFKSAITRVITSYLDTTGLNKKS
GYRB_RICBR      HSCIV---VNADNTELELAMHWNDSYHENILCFTNNIRQRDGGTHLSAFKSGLTRVITAYLENTGLNKKA
GYRB_BUCBP      HSKIFYFSSKKNNVEVEIAMQWNKGFQENIYCYTNNIPQQDGGTHLSGFRSALTRTMNNYLDKEGYXXXX
GYRB_BUCAP      NLNIFYFRCIKNQIELEIAIQWNNSHQENILCFTNNIPQKDGGTHLSGFRAGITRTLNLHIEREGYNKKN
GYRBP_ARATH     H-DVLGFRKEINGSTVDVSLQWCSAYSDTMLGYANSIRTIDGGTHIEGVKASLTRTLNSLAKKLKVIKEK
PARE_STAES      H-DVTTFAGHSNGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNEYARRINEXXXX
PARE_STAEQ      H-DVTTFAGHSNGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNEYARRINEXXXX
GYRB_HELPY      LTPIISFKSMDEETRIEVALAYADDYNENTLSFVNNIKTSEGGTHEAGFKMGLSKAILQYIGNN--IKTK
GYRB_HELPJ      LTPIIAFKSMDEETRIEVALAYADDYNENTLSFVNNIKTSEGGTHEAGFKMGLSKAILQYIDNN--IKTK
GYRB_RICPR      HPCIVVNTVHVESGSLELALHWNDSYHENILCFTNNIRQRDGGTHLSAFKSAITRVITSYLDTTGLNKKT
GYRB_RICTY      HPCIVNTEHVESGISLELAIHWNDSYHENILCFTNNIRQRDGGTHLSAFKSAITRVITSYLDTTGLNKKT
GYRB_NEIGO      HEKIFYAFGEKDGMSVECAMQWNDSYQESVQCFTNNIPQRDGGTHLTALRQVMTRTINSYIEANEVAKKA
GYRB_CAUCR      LKAPIAVKGVKDKVEIDLALWWNDSYHEQMLCFTNNIPQRDGGTHLSAFRAALTRIITSYAESSGILKKE
GYRB_CAUCN      LKAPIAVKGVKDKVEIDLALWWNDSYHEQMLCFTNNIPQRDGGTHLSAFRAALTRIITSYAESSGILKKE
PARE_CAUCR      TPESFAIERQGEAGAVEWAVTWTGEHDGFMQSYCNTVPTPEGGTHESGFRAALTRGLKAYA---ELKGEK
GYRB_BARBK      TAEIFSGKTQSGHGSVEWAIAWHNG-DAYIQSYCNTIPTEEGGTHETGLRQTLLRGLKAYA---ELIGNK
PARE_RICCN      IPGIFAIESKSDRIKLEWAICWNNDSSAFVQSYCNTVPTPQGGTHEQGLKSAILRGLKAYGE--MIGNKK
PARE_MYCPN      AQKIF-VSGTEDDIELEAVFQFIDGEDEKLLSFANSIRTSEGGSHEASFRQSVGDVINNYCRKYNFLKER
PARE_RICFE      IPEIFSIESTPDEIKLEWAICWNNDNSAFIQSYCNTVPTPQGGTHEQGLKSAILRGLKAYGE--MIGNKK
GYRB_CYTAU      IPRPLYMESDKGPIPVEVAMLYNTSYSENVFSYVNNINTVEGGTHVAGFRRALTRTLKSYADKSGMLEKL
PARE_RICBR      TTEIFSVESEQDGIKLEWAICWNNDSSAFIQSYCNTVPTPLGGTHEQGLKSALLRGLKAYGE--MVGNKK
GYRB_CYTHU      IPTPLYMESDKGPIPVEVAMLYNTSYSENVFSYVNNINTIEGGTHVAGFRRALTRTLKSYADKSGMLEKL
PARE_RICPR      IPEIFSIESTVDDIKLEWAICWNNDTSAFMQSYCNTVPTPQGGTHEQGLKSAILRGLKAYSE--MIGNKK
GYRB_FLEEL      LPAPIHVEKTDGDIPVEVALIYNNSYSENVFSYVNNINTHEGGTHVSGFRRALTRTLKSYADKSGMLEKA
PARE_RICTY      IPEIFSIESTMDAIKLEWAICWNNDTSAFMKSYCNTVPTPQGGTHEQGLKSAILRGLKAYSE--MIGNKK
PARE_PSEAE      PDEPFCGNLEGSKEAVSWALLWLPEGGESVQSYVNLIPTAQGGTHVNGLRQGLLDAMREFCEFRNLLP-R
PARE_ECOLI      PEKPFIGNFAGDTEAVDWALLWLPEGGELLESYVNLIPTMQGGTHVNGLRQGLLDAMREFC-EYRNILPR
PARE_SALTY      PEKPFIGNFNGETEAVDWALLWLPEGGELLESYVNLIPTMQGGTHVNGLRQGLLDAMREFC-EYRNILPR
PARE_SALTI      PEKPFIGNFNGETEAVDWALLWLPEGGELLESYVNLIPTMQGGTHVNGLRQGLLDAMREFC-EYRNILPR
GYRB_FLEJA      LPAPIFIEAHDSNVAVEVSLQYNDSFSENIFSYVNNINTIEGGTHVAGFRRAITRVFKTYGDRNKLFEKS
PARE_HAEIN      KKPFVG-EFKGANEAVSWALLWLPEGGELIESYVNLIPTIQGGTHVNGLRQGLLDAIREFCEFRNLLP-R
GYRB_BACCE      HEEPVYVEGSKDGIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDA
GYRB_BACMY      HEEPVYVDGSKDGIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDA
GYRB_SYNY3      HEEIIYTSGEKNDVQVEVALQWCDAYSDTLLGFANNIRTIDGGTHLEGLKAVLTRTLNSVARKRNKLKDG
GYRB_ACIBA      N-EIFHFTADADNGAVEVALQWNDSYQENVRCFTNNIPQKDGGTHLAGFRAALTRGLNQYLENENILKKE
GYRB_ACIHA      N-EIFHFTTDADNGSVEVALQWNDSYQENVRCFTNNIPQKDGGTHLAGFRAALTRGLNSYMENENLLKKE
GYRB_ACIGB      N-EIFHFTTQAENGGVEVALQWNDTYQENVRCFTNNIPQKDGGTHLAGFRAALTRGLNSYMENENLLKKE
GYRB_ACIJU      N-EIFHFTTDADNGGVEVALQWNDSYQENVRCFTNNIPQKDGGTHLAGFRAALTRGLNSYMENENLLKKE
GYRB_ACILW      N-DIFHFTAAQADNTVEVALQWNDSYQENVRCFTNNIPQKDGGTHLAGFRAALTRGLNNYMDSENILKKE
GYRB_ACIG9      N-DIFHFTAAQADNTVEVALQWNDSYQENVRCFTNNIPQKDGGTHLAGFRAALTRGLNNYMDSENILKKE
GYRB_ACIG3      N-EIFHFTADTENGGVEVALQWNESYQENVRCFTNNIPQKDGGTHLAGFRAALTRGLNQYLENENILKKE
GYRB_ACICA      N-EIFHFTADTDSGGVEVALQWNESYQENVRCFTNNIPQKDGGSHLAGFRAALTRGLNQYLENENILKKE
GYRB_ACIG6      N-EIFHFTTDTDSGAVEVALQWNESYQENVRCFTNNIPQKDGGTHLAGFRAALTRGLNQYLESENILKKE
GYRB_ACIJO      N-DIFHFTVQAENGGVEVALQWNDTYQENVRCFTNNIPQKDGGTHLAGFRAALTRGLNSYMENENLLKKE
PARE_BORBU      Y-DIVYYSSK----TLEFAFSHTNNYGETYFSFVNGQYTNDGGTHQTGFREGFVRAINDFLKK-------
GYRB_PROMI      ----------------------------------------------------------------------
GYRB_ACIS9      ----------------------------------------------------------------------
GYRB_ACIS6      ----------------------------------------------------------------------
GYRB_ACIGA      ----------------------------------------------------------------------
GYRB_ACIS8      ----------------------------------------------------------------------
GYRB_ACIS7      ----------------------------------------------------------------------
GYRB_RHOCA      MPDPIYMVGEVRGIGVEVAMWWNDSYHETVLPFTNNIPQRDGGTHLAGFRGALTRTITKYAQDSGIAKRE
TOP2_CAEEL      EPLKIAYEQVGDRWQVALALSEKGFQQVS---FVNSIATTKGGRHVDYVADQMVAKFIDSIK--RKLTKT
TOP2M_CAEEL     HPT--------PRWHVGVAKR-NNFFGESIVSFVNNINTEKGGSHVDYVMDKIVNIIKPIVDSK--LGDP
TOP2M_DICDI     -------------------------------SFVNSINTVKGGTHV----NFLADQIVRYVGEKLKKKHS
TOP2_SCHPO      EPPRVIYEHVNDRWDVAFAVS-DGQFKQV--SFVNNISTIRGGTHVNYVANKIVDAIDEVVKK----ENK
TOP2_CANAL      EPTTIVHEVFNDRWEVAFAVSDGSFNQVS---FVNSIATTSGGTH---VKYVSDQIINKLVESXXXXXXX
TOP2_DICDI      NAPKVYYEKVSDRWELAVTLSKESQFNQV--SFVNSICTVKGGTH---VTHALSNIVTAIQEQVNKKNKG
TOP2B_MOUSE     -------------------------------SFVNSIATTKGGRHVD---YVVDQVVSKLIEVVKKKNKA
TOP2B_HUMAN     -------------------------------SFVNSIATTKGGRHVD---YVVDQVVGKLIEVVKKKNKA
TOP2B_CRILO     -------------------------------SFVNSIATTKGGRHVD---YVVDQVVGKLIEVVKKKNKA
TOP2B_CHICK     -------------------------------SFVNSIATTKGGRHVD---YVVDQVVGKLIEVVKKKNKA
TOP2_PLAFK      ---IVKIHEKQHRWEIVVSKSDGSQFQQV--SFVNSICTTKGGSH---VNYIVEQXXXXXXXXXXXXXXG
TOP2_PICGU      YSTIV-HEVFNDRWEVAFAVSDGSFNQVS---FVNSIATTSGGTHVKYVSQIITKLID--ALTXXXXXXX
TOP2_MIMIV      -------------------------------SFVNSICTSRGGTHEQVVGQIVNGLKTAIVKKAKNVQIK
TOP2A_PIG       TGNPLKIIHEQVNHRWEVCLTMSEKGFQQI-SFVNSIATSKGGRHVD---YVADQIXXXXXXXXXXXXXX
TOP2A_HUMAN     TGNSLKVIHEQVNHRWEVCLTMSEKGFQQI-SFVNSIATSKGGRHVD---YVADQIXXXXXXXXXXXXXX
TOP2_BOMMO      QPLKVVYEKVSDRWEVALTI---SDMGFQQVSFVNSIATTKGGKHVD---TVADSXXXXXXXXXXXXXXX
TOP2A_MOUSE     ----------------------------------------------------------------------
TOP2_PENCH      -------------------------------SFVNSIAITSGGTHVNYIADQICS---KLAEQVKKKNKN
TOP2_PEA        -------------------------------SFVNSIATIKGGTHVDYITNQITT----YIMXXXXXXXX
TOP2_ARATH      DPLPRLTEKVNDRWEVCVSLSEGQFQQVS---FVNSIATIKGGTHVD----YVTSQITNHIXXXXXXXXX
TOP2A_CRIGR     ----------------------------------------------------------------------
TOP2A_RAT       ----------------------------------------------------------------------
TOP2A_CHICK     -------------------------------SFVNSIATTKGGRHVD---YVADQIVTKLIDXXXXXXXX
TOP2_DROME      -------------------------------SFVNSIATYKGGRHVD---HVVDNLIKQLLEVLXXXXXX
TOP2_IIV3       -------------------------------SFVNGQITPAGGQHVTNWSRVIFGALLA-----ALNGKK
TOP2_CANGA      TPSTILYERVSDRWEIAFAVS-DISFKQV--SFVNSIATTTGGTH-------VNYIADQIVRXXXXXXXX
TOP2_YEAST      ----------------------------------------------------------------------
TOP2_IIV6       -----SITEEDGSSEVTIAFVERDGKKKPI-SFVNGLFTKHGGQHVDGFFANLLSVLNKPSKTYKDLK--
TOP2_TRYBB      --------------------------------------------------------------ERELKKEN
TOPL_BPT4       ----------------------------------------------------------------------
TOP2_LEICH      ----------------------------------------------------------------------
TOP2_ASFP4      HTATIKADAKPYSHPLQVAAVVSPKFKKFEHSVINGVNCVKG-EHVTFLKKTINEMVVK--KFQQTIKDK
TOP2_ASFWA      HTATIKADAKPYSHPLQVAAVVSPKFKKFEHSIINGVNCVKG-EHVTFLKKTINEIVVK--KFQQTIKDK
TOP2_ASFK5      YTTTIKADAKPYSHPLQVAAVVSPKFKKFEHSIINGVNCVKG-EHVTFLKKAINEMVVK--KFQQTVKDK
TOP2_ASFB7      HTATIKADAKPYSHPLQVAAVVSPKFKKFEHSIINGVNCVKG-EHVTFLKKTINEMVIK--KFQQTIKDK
TOP2_ASFM2      HTTAIKADAKPYSHPLQVAAVVSPKFKKFEHSIINGVNCVKG-EHVTFLKKTINEMVVK--KFQQTIKDK
TOP2_TRYCR      ---------------------------------------------QEVLQSSLESVEKALKKDNKVID--
TOP2_CRIFA      ----------------------------------------------------------------------
TOPS_BPT4       ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EANLTGDDCREGLSAVISVRVGDPQFEGQTKTKLGNTEIKSFVQRMANEHIGHWLEANPAEAKVIINKAV
GYRB_MYCSM      XPNLTGDDIREGLAAVISVKVAEPQFEGQTKTKLGNTEVKSFVQKICNEQLQHWFEANPAEAKTVVNKAV
GYRB_MYCS2      XPNLTGDDIREGLAAVISVKVAEPQFEGQTKTKLGNTEVKSFVQKICNEQLQHWFEANPAEAKTVVNKAV
GYRB_MYCPA      XPNLTGDDIREGLAAVISVKVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANPADAKVIVNKAV
GYRB_MYCTU      DPNLTGDDIREGLAAVISVKVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANPTDXXXXXXXXX
GYRB_MYCTA      DPNLTGDDIREGLAAVISVKVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANPTDXXXXXXXXX
GYRB_MYCLE      XPNLTGDDIREGLAAVISVKVSEPQFEGQTKTKLGNTEVKSFVQRVCNEQLIHWFEANPVDAKAVVNXXX
GYRB_STRCO      DDNLTGDDIREGLTAIISVKLAEPQFEGQTKTKLGNTEVKTFVQKVVYEHLTDWLDRNPNEAADIIRKGI
GYRBS_STRSH     DDNLAGEDIREGLTAIISVKLGEPQFEGQTKTKLGNTEAKTFVQKIVHEHLTDWFDRHPNEAADIIRKSI
GYRB_BACSU      DPNLSGDDVREGLTAIISIKHPDPQFEGQTKTKLGNSEARTITDTLFSTAMETFMLENPDAAKKIVDKGL
GYRBR_STRSH     DANLSGEDIREGLTAIISVNVGEPQFEGQTKTKLGNTEVRTLLQKIVHEHLADWFDRNPNEAVDIXXXXX
GYRB_CLOAB      DKNLSGEDIREGLTAVVSVKLTEPQFEGQTKTKLGNTEVRGIVDSIISERVSTYLEENPQIGKLVIDKAL
GYRB_HALSQ      DGNLRGEDVREGLTAVISVKHPDPQFEGQTKTKLGNSEVRGIVESVTHQQLGTFFEENPDTATAIISXXX
GYRB_BACHD      DPNLTGEDVREGLTAIISVKIPDPQFEGQTKTKLGNSEARTITDSLFTEHFSRFLIEHPQVARKLVDKGL
GYRB_MYCGE      DEKINRDDVCEGLTAIISIKHPNPQYEGQTKKKLGNTEVRPLVNSVVSEIFERFMLENPQEANAIIRKTL
GYRB_STAES      KDRLSGEDTREGLTAVVSIKHGDPQFEGQTKTKLGNSEVRQVVDRLFSEHFERFLYENPSVGRIIVEKGI
GYRB_STAEQ      KDRLSGEDTREGLTAVVSIKHGDPQFEGQTKTKLGNSEVRQVVDRLFSEHFERFLYENPSVGRIIVEKGI
GYRB_MYCGA      DGKISKEDLSEGLTAIISIKHSEPQYQGQTKDRLGNTEVREFTNSVVSELLERFFLENPEEAAKITAKAV
GYRB_BACAN      DSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGT
GYRB_MYCPN      DEKITRDDICEGLTAIISIKHPNPQYEGQTKKKLGNTEVRPLVNSIVSEIFERFMLENPQEANAIIRKTL
GYRB_TREDE      EEKLTGEDVRAGLTAIVSVKVPEPQFEGQTKTKLGNSDVRGIVDSFVNEKLTLFFEQNPNEVEKVLEKCV
GYRB_MYCHO      SEKITREDVKEGLVAIISIKHTDPIFEGQTKGKLENKDARIATNKILSDSLERYLNENPEIARAIIEKCL
GYRB_STRR6      EDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGI
GYRB_STRPN      EDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGI
GYRB_STRP3      EDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGI
GYRB_STAAN      KDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGI
GYRB_STAAM      KDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGI
GYRB_BORHE      VPSLTLDDFKEGLTAVISIKIPEPQFEGQTKGKLGNSYVKKIVETIVHDGLLKVIDDNLLEVDIILNKAI
GYRB_TREPA      EEKLVGEDVRAGLTVVLSVKIPEPQFEGQTKTKLGNSEVRGIVDSLVGERLTLYFEQNPGVLTKILEKSI
GYRB_STRP8      EDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGI
GYRB_STRP6      EDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGI
GYRB_STAAW      KDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGI
GYRB_STAAU      KDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGI
GYRB_STAAS      KDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGI
GYRB_STAA3      KDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGI
GYRB_THEMA      DDSFQGEDVREGLTAVISVYVKNPEFEGQTKSKLGNEEVKEAVTKAMREELKKIFDANPELVKTILSKIM
GYRB_STAAR      KDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGI
GYRB_STAAC      KDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGI
GYRB_STRP1      EDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGI
GYRB_BORBU      IPNLTGDDFKEGLTAVISVKVPEPQFEGQTKSKLGNSEIRKIVEVVVYEHXXXXXXXXXXXXDTILGXXX
GYRB_CHLMU      KLSLTGEDIREGLVAIVSVKVPNPQFEGQTKQKLGNSDVGSVAQQISGEVLTTFFEENPQIAKTIVDKVF
GYRB_SPICI      EDKFTWDDIKEGMTIIISIRHPEPQYEGQTNQKLLNSEVKKIVSNIVGKGLSSYLLENPEDAXXXXXXXX
GYRB_CHLPN      KLALTGEDIREGLTAVISVKVPNPQFEGQTKQKLGNSDVSSVAQQVVGEALTIFFEENPQIARMIVDKVF
GYRB_ARCFU      EP-VTGVDIREGLTAVISVKVPEPQFEGQTKTKLTNSDVKTVVESAVYSGVLRWLEENPAQAETLLNKFI
PARE_BACSU      DKNLEGTDIREGLSAIISVRIPEEQFEGQTKGKLGTSEARSAVDAIVSEQLAYFLEENRDTATLLVKKAI
GYRB_CAMJE      DNKITGDDVREGLIAIVSVKVPEPQFEGQTKGKLGSTYVRPIVSKASFEYLTKYFEENPIEAKAIMNKAL
GYRB_MYCAT      NEKISREDTKDGLVAIISIKHTDPIFEGQTKGKLENKDARIATNKIISEQLERYMAENPSHAKAIIEKCL
GYRB_SHIFL      KVSATGDDAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKII
GYRB_ECOLI      KVSATGDDAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKII
GYRB_ECO57      KVSATGDDAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKII
PARE_STAAW      DKNLDGNDIREGLTAVVSVRIPEEQFEGQTKSKLGTSEARSAVDSVVADKLPFYLEEKGQLSKSLVXXXX
PARE_STAAU      DKNLDGNDIREGLTAVVSVRIPEEQFEGQTKSKLGTSEARSAVDSVVADKLPFYLEEKGQLSKSLVXXXX
PARE_STAAN      DKNLDGNDIREGLTAVVSVRIPEEQFEGQTKSKLGTSEARSAVDSVVADKLPFYLEEKGQLSKSLVXXXX
PARE_STAAM      DKNLDGNDIREGLTAVVSVRIPEEQFEGQTKSKLGTSEARSAVDSVVADKLPFYLEEKGQLSKSLVXXXX
PARE_STAAC      DKNLDGNDIREGLTAVVSVRIPEEQFEGQTKSKLGTSEARSAVDSVVADKLPFYLEEKGQLSKSLVXXXX
PARE_STAA8      DKNLDGNDIREGLTAVVSVRIPEEQFEGQTKSKLGTSEARSAVDSVVADKLPFYLEEKGQLSKSLVXXXX
GYRB_CHLTR      KLSLTGEDIKEGLVAIVSVKVPNPQFEGQTKQKLGNSDVGSVSQQISGEVLTTFFEENPQIAKTIVDKVF
GYRB_SALTY      KVSATGDDAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLSEYLLENPSDAKIVVGKII
GYRB_SALTI      KVSATGDDAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLSEYLLENPSDAKIVVGKII
PARE_STAAR      DKNLDGNDIREGLTAVVSVRIPEEQFEGQTKSKLGTSEARSAVDSVVADKLPFYLEEKGQLSKSLVXXXX
PARE_STAAS      DKNLDGNDIREGLTAVVSVRIPEEQFEGQTKSKLGTSEARSAVDSVVADKLPFYLEEKGQLSKSLVXXXX
GYRB_ORYSJ      DISLSGEHVREGMTCIIAVKVPNPEFEGQTKTRLGNPEVRRIVEQSVQENLTEYLELHPDVLDSILSKSL
GYRB_AQUAE      KKSFTGEDVREGLTAVVACKVPNPQFEGQTKTKLGNQNVKQIVESITYDFLTSYFEKKRDVLKAIVXXXX
PARE_STRPN      DKNLEGSDYREGLAAVLSILVPEEQFEGQTKDKLGSPLARPVVDGIVADKLTFFLMENGELASNLXXXXX
GYRB_HAEIN      KVATSGDDAREGLVAIISVKVPDPKFSSQTKDKLXXXXXXXXXXXXMNEKMQEYLLENPADAKIIVNQII
GYRB_NICBE      DISLSGEHVREGLTCVISVKVPNPEFEGQTKTRLGNPEVRKVVDQSVQEYLTEYLELHPDVLDSILSKSL
GYRB_PSEAE      KIATTGDDAREGLTAIISVKVPDPKFSSQTKDKLVSSEVKTAVEQEMGKYFADFLLENPNEAKAVVGKMI
GYRB_VIBPA      KTATSGDDAREGLTAVVSVKVPDPKFSSQTKDKLXXXXXXXXXXXXMGEKLSEFLVENPSEAKMVCSKII
PARE_MYCGA      DKGFDWSDLKEGLSVVLSVQVPEKAYEGQTKNKLFTQEVKVAVAKILTQQLFYFLEENQADAKQLIERFX
GYRB_RICCN      KNYFSGEDTREGLCCVLSVKVPDPKFSSQTKDKLVSSEVRPVVENAVYTKVLEWFEEHPXXXXXXXXXXX
GYRB_VIBCH      QAATSGDDAREGLTAVVSVKVPDPKFSSQTKDKLXXXXXXXXXXXXMNEKLADFLAENPSEAKNVCSKII
GYRB_MYCCT      -TKLDSNDLREGLVAIVTVKIPENEYEGQTKSKLGTSDAKTVVEQIVYEFMSYWLIENKVLANKVIENAL
PARE_MYCGE      DKNFQLSEIRQGLNAIIKVNLPEKNFEGQTKSKLFSKEVKNVVYELVQQHYFQFLERNNNDAKLIIDKLL
GYRB_MYXXA      KETPTGEDAREGLSAVISVKLTNPQFEGQTKTKLGNSEVKGLVEQMVNDQLGSFLEETPMVAKKVVAKIG
GYRB_BUCAI      KTTIIGEDVREGLTAIISIKIPDPKFSSQTKDKLVSSEARSVXXXXXXXXXXXXXXXXPSDSKFIIQKII
GYRB_PSEPU      KVATTGDDAREGLTAIISVKVPDPKFSSQTKDKLVSSEVKTAVEQEMNKYFSDFLLENPNEAKAVVGKMI
GYRBM_ARATH     DISLSGEHVREGLTCIVSVKVPNPEFEGQTKTRLGNPEVRKIVDQSVQEYLTEFLELHPDILESIISXXX
GYRB_RICFE      KNDFSGEDTREGLCCVLSVKVPDPKFSSQTKDKLVSSEVRPVVENAVYTKVLEWFEEHPAESKAIIXXXX
GYRB_RICBR      KNAFSGEDTREGICCVLSVKVPDPKFSSQTKDKLVSSEVRPIVENAVYTKVLEWFEEHPADAKLIINKIM
GYRB_BUCBP      XXXXXGDDTREGLTAIISIKINDPKFSSQTKNKLVSSEVKSALESLVNEFLMEFLLENPQESKNIVTKII
GYRB_BUCAP      KTIITGEDTREGLTAIISIKIPDPKFSSQTKDKLVSSEVKSVXXXXXXXXXXXXXXXXXXDAKFIIQKII
GYRBP_ARATH     DISLSGEHVREGLTCIVSVKVPNPEFEGQTKTRLGNPEVRKIVDQSVQEYLTEYLELHPDVLESIISXXX
PARE_STAES      XXXXXXXXIREGLTAIISVRIPEEQFEGQTKSKLGTSEARSAVDSVVSEKLPYYLEEKGQLSKSLVXXXX
PARE_STAEQ      XXXXXXXXIREGLTAIISVRIPEEQFEGQTKSKLGTSEARSAVDSVVSEKLPYYLEEKGQLSKSLVXXXX
GYRB_HELPY      ESRPISEDIKEGLIAVVSLKMSEPLFEGQTKSKLGSSYARALVSKLVYDKIHQFLEENPNXXXXXXXXXX
GYRB_HELPJ      ESRPISEDIKEGLIAVVSLKMSEPLFEGQTKSKLGSSYARALVSKLVYDKIHQFLEENPNXXXXXXXXXX
GYRB_RICPR      KHDFSGEDTREGICCVLSVKVPDPKFSSQTKDKLVSSEVRPVVENAVYTKVLEWFEEHPTXXXXXXXXXX
GYRB_RICTY      KHDFSGEDTREGICCVLSVKVPDPKFSSQTKDKLVSSEVRPVVENAVYTKVLEWFXXXXXXXXXXXXXXX
GYRB_NEIGO      KVETAGDDMREGLTCVLSVKLPDPKFSSQTKDKLVSGEIGPVVNEVINQALTDFLEENPNEAKIITGKIV
GYRB_CAUCR      KVSLGGEDSREGLTCVLSVKVPDPKFSSQTKDKLVSSEVRPAVEGLVSEGLSTWFEEHPNXXXXXXXXXX
GYRB_CAUCN      KVSLGGEDSREGLTCVLSVKVPDPKFSSQTKDKLVSSEVRPAVEGLVSEGLSTWFEEHPNXXXXXXXXXX
PARE_CAUCR      RGTITADDVVAQAGALISVFIKNPEFQGQTKEKLSTSEAQRFVEASLRDPFDLWLSSSPKNAQALLEFVI
GYRB_BARBK      RASITSDDVMASTVVMLSVFIKDPQFVGQTKDRLATTEAQRIVENAIRDPFDHWLANSPHEATKLLNWVI
PARE_RICCN      AANLTIEDILETASVVLSIFIAEPSFQGQTKEKLVSNGVSKPVENIIKDHFDHFLSSDKALATNLLEHVI
PARE_MYCPN      DKNFEASEIREGLNGIIKVNLPEKAFEGQTKSKLFSKEVKAVVQKLTQKHFFQFLERNSVDAKLIVEKLF
PARE_RICFE      AANLTIEDILETASVVLSIFIAEPSFQGQTKEKLVSNGVSKPVENIIKDHFDHFLSSDKALATNLLEHVI
GYRB_CYTAU      KMEVTGDDFREGLTAVISVKVQEPQFEGQTKTKLGNSDVMGAVDQVVGEMLNTYLEENPKEAKIIVQKVI
PARE_RICBR      TANLAIEDILETASVVLSIFIAEPTFQGQTKEKLVSQGVSKPAENIIKDHFDHFLSSNKTIANNLLEHFI
GYRB_CYTHU      KMEVTGDDFREGLTAVISVKVQEPQFEGQTKTKLGNSDVMGAVDQVVGEMLNTYLEENPKEAKIIVQKVI
PARE_RICPR      AANLTIEDILETASIVLSIFIVEPSFQGQTKEKLVSNGVSKLVENIIKDHFDHFLSSDKVLATHLLEHVI
GYRB_FLEEL      KVEITGDDFREGLTAVISIKVAEPQFEGQTKTKLGNSDAIGAVDNAVSEILGYYLEENPREAKLIIQKVI
PARE_RICTY      SANLTIEDIFETASVVLSVFIVEPSFQGQTKEKLVSNGVSKLVENIIKDHFDHFLSSDKVLATHLLEHVI
PARE_PSEAE      GVKLAPEDVWERIAFVLSMKMQEPQFSGQTKERLSSREAAAFVSGVVKDAFSLWLNEHAEIGLQLAELAI
PARE_ECOLI      GVKLSAEDIWDRCAYVLSVKMQDPQFAGQTKERLSSRQCAAFVSGVVKDAFILWLNQNVQAAELLAEMAI
PARE_SALTY      GVKLSAEDIWDRCAYVLSVKMQDPQFAGQTKERLSSRQCAAFVSGVVKDAFSLWLNQNVQAAEQLAEMAI
PARE_SALTI      GVKLSAEDIWDRCAYVLSVKMQDPQFAGQTKERLSSRQCAAFVSGVVKDAFSLWLNQNVQAAEQLAEMAI
GYRB_FLEJA      KIEVTGDDFREGLSAIVSVKVPEPQFEGQTKTKLGNSDVMGVVDSAVADVLNAYLEEHPKEARTVINXXX
PARE_HAEIN      GVKLTADDIWDRCSYILSLKMQDAQFAGQTKERLSSRQSAVFVSGVLKDAFSLWLNQNVQDAEKLAEIAI
GYRB_BACCE      DSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGT
GYRB_BACMY      DSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIIDKGT
GYRB_SYNY3      DSNLGGENIREGLTGVISVKVPDPEFEGQTKTKLGNTEVRGIVDTLVGEALTEFLEFNPGVADAIIXXXX
GYRB_ACIBA      KVNVTGDDAREGLTAIISVKVPDPKFSSQTKEKLVSSEVKPAVEQAMNKEFSAYLLENPQAAKSIAGXXX
GYRB_ACIHA      KVVVSGDDAREGLTAIISVKVPDPKFSSQTKEKLVSSEVKPAVEQAMNKEFSAYLLENPQAAKSIAGXXX
GYRB_ACIGB      KVAVTGDDAREGLTAIVSVKVPDPKFSSQTKEKLVSSEVKPAVEQAMNKAFSEYLLENPQAAKSIAGXXX
GYRB_ACIJU      KVAVSGDDAREGLTAIISVKVPDPKFSSQTKEKLVSSEVKPAVEQAMNKEFSAYLLENPQAAKSIAGKII
GYRB_ACILW      KVAVSGDDAREGLTAIVSVKVPDPKFSSQTKEKLVSSEVKTAVEQAMNKAFSEYLLENPQXXXXXXXXXX
GYRB_ACIG9      KVAVSGDDAREGLTAIVSVKVPDPKFSSQTKEKLVSSEVKTAVEQAMNKAFSEYLLENPQXXXXXXXXXX
GYRB_ACIG3      KVNVTGDDAREGLTAIISVKVPDPKFSSQTKEKLVSSEVKPAVEQAMNKEFSAYLLENPQAAKSIAGXXX
GYRB_ACICA      KVNVTGDDAREGLTAIISVKVPDPKFSSQTKEKLVSSEVKPAVEQAMNKEFSAYLLENPQAAKSIAGXXX
GYRB_ACIG6      KVAVTGDDAREGLTAIISVKVPDPKFSSQTKEKLVSSEVKPAVEQAMNKEFSAYLLENPQAAKSIAGXXX
GYRB_ACIJO      KVAVSGDDAREGLTAIVSVKVPDPKFSSQTKEKLVSSEVKPAVEQAMNKSFSEYLLENPQAAKSIAGXXX
PARE_BORBU      --TYSSTDIREGLVATLSVKIKDPIFESQTKNKLGNIETRGNVAKEVQKIISEILYKDKILAKLIEKKVV
GYRB_PROMI      ----------------------------------------------------------------------
GYRB_ACIS9      ----------------------------------------------------------------------
GYRB_ACIS6      ----------------------------------------------------------------------
GYRB_ACIGA      ----------------------------------------------------------------------
GYRB_ACIS8      ----------------------------------------------------------------------
GYRB_ACIS7      ----------------------------------------------------------------------
GYRB_RHOCA      KIDFTGDDAREGLTCVLSVKVPDPKFSSQTKDKLVSSEVRPAVENLVNEKL-------------------
TOP2_CAEEL      SMNIKPFQIKNHMWVFVNCLIENPTFDSQTK------ETMTLQQKQFGSTCVLSEKFSKAASSVGITDAV
TOP2M_CAEEL     TKSVKPAVIKNNLSIFINCLIENPSFESQTKETL-TTKAKNFIFECDAKKTAEWAEQSGL-IEDIVEEVL
TOP2M_DICDI     DLEIRPMNIKHHLALFVNCLVDNPSFDSQSKETL-TTKPMLFG---STPEIPESLLAQFVKNSKIIERVA
TOP2_SCHPO      KAPVKAFQIKNYVQVFVNCQIENPSFDSQTKETL-TTKVSAF---------GSQCTLSDKFLKAIKKSSV
TOP2_CANAL      XXXXXPQEVRDNMFLFINCLIENPAFTSQTKEQL-TTKVSQFGGKVANDNLINRILKTSIVDKI---RAI
TOP2_DICDI      SADIKPAFIKNHLSVFVNCLIENPHFDSQTKETL-TSKISSFGSRC---------EPSEKFIKRVLDSKS
TOP2B_MOUSE     GVSVKPFQVKNHIWVFINCLIENPTFDSQTKENM-TLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVK
TOP2B_HUMAN     GVSVKPFQVKNHIWVFINCLIENPTFDSQTKENM-TLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVK
TOP2B_CRILO     GVSVKPFQVKNHIWVFINCLIENPTFDSQTKENM-TLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVK
TOP2B_CHICK     GVSVKPFQVKNHIWVFVNCLIENPSFDSQTKENM-TLQPKSFGSKCQLSEKFFKAASNCGIIESILNWVK
TOP2_PLAFK      GMEIKSGHIRNHLWVFVNCLIVNPTFDSQTKETLTTKPVKFGSKCILSDKTINNVLKSPILSNILL---W
TOP2_PICGU      XXXXXPQEVRNNMFVFINCLIENPAFTSQTKEQL-TTRVAQF-------------GGKPSEKIVISDQFI
TOP2_MIMIV      PAMI-----KENLIFFVDATIVNPDFDTQTKEYL--------TKKAAN--FGSKFEVTEKFIKGVIK--T
TOP2A_PIG       XXXXXXHQVKNHMWIFVNALIENPTFDSQTKENM-TLQVKSFGSQLSEKFIKAAIGCGIVES--ILNWVK
TOP2A_HUMAN     XXXXXAHQVKNHMWIFVNALIENPTFDSQTKEQLSEKFIKAAIGCGIVESILNWVKF---KAQVQLNKKC
TOP2_BOMMO      XXXIKPYQVKTHMWLFVNCLIVNPTFDSQTKENM-TLQAKSFGSK-----------CNLSEKFITAVTKC
TOP2A_MOUSE     ----------------VNALIENPTFDSQTKENM-TLQAKSF---------GSTCQLSEKFIKAAIGCGI
TOP2_PENCH      GATLKPAQIRNHIFIFVNALIVNPAFTSQTKEQL-TTKQSQFGSKCVLEEDFY---------KKILKTEV
TOP2_PEA        XXXXXXHTVKNHLWVFVNSLIDNPAFDSQTKETLTTRQLKDVEKSGIVDTLLSWADFKQSKD---LKKTD
TOP2_ARATH      XXXXXXXXXXXXLWVFVNALIDNPAFDSQTKETLSKCELEDFLKKVGKENLLSWADFKQNKD---LKKSD
TOP2A_CRIGR     ----------------VNALIENPTFDSQTKENM-TLQAKSFGSQLSEKFIKAAIGCGIVES--ILNWVK
TOP2A_RAT       --------------------IENPTFDSQTKENM-TLQAKSFGSQLSEKFIKAAIGCGIVES--ILNWVK
TOP2A_CHICK     XXXXXPFQVKNHMWIFVNSLIENPTFDSQTKENM-TLQAKSFGSKLSEKFIKGAVGCGIVES--ILNWVK
TOP2_DROME      XXXXXPFQVRNHLWVFVNCLIENPTFDSQTKENMGSTLSEKFINNMSKSGI---VESVLAWAKFKAQNDI
TOP2_IIV3       NVSLTKADIAPYFQLFIHSKVSKPKFDGQNKNCLKSPKVEAHLDATILKKMLKWKIISTIQDKVVKSKEY
TOP2_CANGA      XXXXXXXXXXXXXMFIINCLIENPAFTSQTKEQL-TTRVKDFGSRISSDYINKIMKTDLA-TKIF---EI
TOP2_YEAST      ----------------INCLIENPAFTSQTKEQL-TTRVKDFGSRIPLEYINKIMKTDLATRMF----EI
TOP2_IIV6       ---LSLKDVTPYFRFFVKSTVDKPQFDCQNKNMLKSPCLKYTIPDKIITKVCKWTELKQSSFEKLLKGKD
TOP2_TRYBB      KVMDTNRVLRHFTILVFLVQV-QPKFDSQNKARLVSTPT---MPRVPRQDVMKYLLRMP-----FLEAHV
TOPL_BPT4       ----------------------------------------------------------------------
TOP2_LEICH      -----------------------PKFDSQSKARLVSTVT---MPRMPKNTLEKYLERMP-----FLEAHV
TOP2_ASFP4      NRKTTLRDSCSNIFIVIVGSIPGIEWTGQRKDEL------SIAENVFKTHYSIPSSFLTSMTKSIVDILL
TOP2_ASFWA      NRKTTLRDSCSNIFIVIVGSIPGIEWTGQRKDEL------SIAENVFKTHYSIPSSFLTSMTKSIVDILL
TOP2_ASFK5      NRKTTLRDSCSNIFVVIVGSIPGIEWTGQRKDEL------SIAENVFKTHYSIPSSFLTSMTRSIVDILL
TOP2_ASFB7      NRKTTLRDSCSNIFVVIVGSIPGIEWTGQRKDEL------SIAENVFKTHYSIPSSFLTSMTRSIVDILL
TOP2_ASFM2      NRKTTLRDSCSNIFVVIVGSIPGIEWTGQRKDEL------SIAENVFKTHY-----SIPSSFLTNMTRSI
TOP2_TRYCR      ----TNRVLRHFMILVFLVQV-QPKFDSQNKARLVSVELMDFLLRMP------FLEAH-------VNTVT
TOP2_CRIFA      -----------------------PKFDSQSKARLVSTVTMPRVPRTA---LDQYLAAMP-----FLEAHM
TOPS_BPT4       ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GSAQARLAARKARDLVRRKSATDLGGLPGKLADCRSKDPEKSELYIVEGDSAGGSAKSGRDSMFQAILPL
GYRB_MYCSM      SSAQARIAARKARELVRRKSATDIGGLPGKLADCRSTDPSKSELYVVEGDSAGGSAKSGRDSMFQAILPL
GYRB_MYCS2      SSAQARIAARKARELVRRKSATDIGGLPGKLADCRSTDPSKSELYVVEGDSAGGSAKSGRDSMFQAILPL
GYRB_MYCPA      SSAQARIAARKARELVRRKSATDLGGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAILPL
GYRB_MYCTU      XXXXXRIAARKARELVRRKSATDIGGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAILPL
GYRB_MYCTA      XXXXXRIAARKARELVRRKSATDIGGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAILPL
GYRB_MYCLE      XXXXXXXXXXXXRELVRRKSATDLGGLPGKLADCRSTDPRSSELYVVEGDSAGGSAKSGRDSMFQAILPL
GYRB_STRCO      QXXXXXXXXXXXXDLTRRKGLLESASLPGKLSDCQSNDPTKCEIFIVEGDSAGGSAKSGRNPQYQAILPI
GYRBS_STRSH     QXXXXXXXXXXXXDLTRRKGLLESASLPGKLSDCQSNDPSKCEIFIVEGDSAGGSAKSGRNPQYQAILPI
GYRB_BACSU      XXXXXXXXXXXXXELTRRKSALEISNLPGKLADCSSKDPSISELYIVEGDSAGGSAKQGRDRHFQAILPL
GYRBR_STRSH     XXXXXXXXXXXXXDLTRRKGLLETAALPGKLSDCQSNDPATSEIFIVEGDSAGGSAKAGRNPQYQAILPI
GYRB_CLOAB      VXXXXXXXXXXXXXXXXXXSVLESTSLPGKLADCSSKDAEECEIYIVEGDSAGGSAKQGRNRRFQAILPL
GYRB_HALSQ      XXXXXXXXXXXXXXLTRRKSALESTSLPGKLADCQSRDPSESELFIVEGDSAGGSAKQGRDRKFQAILPL
GYRB_BACHD      MXXXXXXXXXXXXXXXXXXSALEVSSLPGKLADCSSRDASISEIYIVEGDSAGGSAKQGRDRHFQAILPL
GYRB_MYCGE      LXXXXXXXXXXXXXLTRRKSPFDSGSLPGKLADCTTRDPSISELYIVEGDSAGGTAKTGRDRYFQAILPL
GYRB_STAES      MXXXXXXXXXXXXXXXXXXSALDVSSLPGKLADCSSKNPEESEIFLVEGDSAGGSTKSGRDSRTQAILPL
GYRB_STAEQ      MXXXXXXXXXXXXXXXXXXSALDVSSLPGKLADCSSKNPEESEIFLVEGDSAGGSTKSGRDSRTQAILPL
GYRB_MYCGA      SAMFSRKRSEAALESAR-KSPFESASLPGKLADCTTKDMEISELYIVEGDSAGGSAKSGRDRFYQAILPL
GYRB_BACAN      MXXXXXXXXXXXXELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPL
GYRB_MYCPN      LXXXXXXXXXXXXXLTRRKSPFDSGSLPGKLADCTTRDPSISELYIVEGDSAGGTAKTGRDRYFQAILPL
GYRB_TREDE      XXXXXXXXXXXXXXXXXXXSGLDSFGLPGKLADCSLKDPESCEVYIVEGDSAGGSAKKGRDSKTQAILPL
GYRB_MYCHO      LSQHTRLLEIKAREASRKGNGLDLGNLPGKLADCSSKNAEIRELFIVEGNSAGGSAKMGRDRSIQAILPL
GYRB_STRR6      LXXXXXXXXXXXXXXXXXXSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPI
GYRB_STRPN      LXXXXXXXXXXXXXXXXXXSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPI
GYRB_STRP3      LXXXXXXXXXXXXEVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPI
GYRB_STAAN      MXXXXXXXXXXXXXXXXXXSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPL
GYRB_STAAM      MXXXXXXXXXXXXXXXXXXSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPL
GYRB_BORHE      XXXXXXXXXXXXXXXXXXXXXFESLALPGKLADCASKNPAEREIYIVEGDSAGGSAKMGRDRFSQAILPL
GYRB_TREPA      XXXXXXXXXXXXXXXXXXXSGMDSFGLPGKLADCSLKDPAKCEVYIVEGDSAGGSAKKGRDSKTQAILPL
GYRB_STRP8      LXXXXXXXXXXXXEVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPI
GYRB_STRP6      LXXXXXXXXXXXXEVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPI
GYRB_STAAW      MXXXXXXXXXXXXXXXXXXSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPL
GYRB_STAAU      MXXXXXXXXXXXXXXXXXXSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPL
GYRB_STAAS      MXXXXXXXXXXXXXXXXXXSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPL
GYRB_STAA3      MXXXXXXXXXXXXXXXXXXSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPL
GYRB_THEMA      STKQXXXXXXXXXXXXXXXNVLQNTTLPGKLADCSSTHREKTELFIVEGDSAGGSAKQARDREFQAVLPI
GYRB_STAAR      MXXXXXXXXXXXXXXXXXXSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPL
GYRB_STAAC      MXXXXXXXXXXXXXXXXXXSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPL
GYRB_STRP1      LXXXXXXXXXXXXEVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPI
GYRB_BORBU      XXXXXXXXXXXXXXXXXXXXXFESLALPGKLADCTSKNPLEREIYIVEGDSAGGSAKMGRNRFFQAILPL
GYRB_CHLMU      VXXXXXXXXXXXXXLTIRKSALDSARLPGKLVDCLEKDPEKCEMYIVEGDSAGGSAKQGRDRRFQAILPI
GYRB_SPICI      XXXXATIVAQRAKEITRRKIVMDSFSLPGKLSDCETKDAKIAELYIVEGDSAGGSAKSGRNRKFQAILPL
GYRB_CHLPN      VXXXXXXXXXXXXXLTLRKSALDSARLPGKLIDCLEKDPEKCEMYIVEGDSAGGSAKQGRDRRFQAILPI
GYRB_ARCFU      LNXXXXXXXXXXXXLVKRKNEL-ITTLPGKLADCSSKNPEERELFIVEGESAGGSAKQARDRRFQAILPI
PARE_BACSU      XXXXXXXXXXXXXXXXXXXXXXXXXXLSGKLTPAGSRNPAKNELYLVEGDSAGGSAKQGRDRRFQAVLPL
GYRB_CAMJE      MXXXXXXXXXXXXXLTRKKESLSVGTLPGKLADCQSKDPSESEIYLVEGDSAGGSAKQGRERSFQAILPL
GYRB_MYCAT      LTQRSRLAANAAREASRKKEGSEFGNLPGKLADCSSKNAEVRELFIVEGNSAGGSAKMGRDRATQAILPL
GYRB_SHIFL      DXXXXXXXXXXXXXMTRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPL
GYRB_ECOLI      DXXXXXXXXXXXXXMTRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPL
GYRB_ECO57      DXXXXXXXXXXXXXMTRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPL
PARE_STAAW      XXXXXXXXXXXXXXXXXKKNKRKDTLLSGKLTPAQSKNTEKNELYLVEGDSAGGSAKLGRDRKFQAILPL
PARE_STAAU      XXXXXXXXXXXXXXXXXKKNKRKDTLLSGKLTPAQSKNTEKNELYLVEGDSAGGSAKLGRDRKFQAILPL
PARE_STAAN      XXXXXXXXXXXXXXXXXKKNKRKDTLLSGKLTPAQSKNTEKNELYLVEGDSAGGSAKLGRDRKFQAILPL
PARE_STAAM      XXXXXXXXXXXXXXXXXKKNKRKDTLLSGKLTPAQSKNTEKNELYLVEGDSAGGSAKLGRDRKFQAILPL
PARE_STAAC      XXXXXXXXXXXXXXXXXKKNKRKDTLLSGKLTPAQSKNTEKNELYLVEGDSAGGSAKLGRDRKFQAILPL
PARE_STAA8      XXXXXXXXXXXXXXXXXKKNKRKDTLLSGKLTPAQSKNTEKNELYLVEGDSAGGSAKLGRDRKFQAILPL
GYRB_CHLTR      VXXXXXXXXXXXXXXXXXXSALDSARLPGKLIDCLEKDPEKCEMYIVEGDSAGGSAKQGRDRRFQAILPI
GYRB_SALTY      DXXXXXXXXXXXXXMTRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPL
GYRB_SALTI      DXXXXXXXXXXXXXMTRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPL
PARE_STAAR      XXXXXXXXXXXXXXXXXKKNKRKDTLLSGKLTPAQSKNTDKNELYLVEGDSAGGSAKLGRDRKFQAILPL
PARE_STAAS      XXXXXXXXXXXXXXXXXKKNKRKDTLLSGKLTPAQSKNTEKNELYLVEGDSAGGSAKLGRDRKFQAILPL
GYRB_ORYSJ      NXXXXXXXXXXXXELVRTKSVLKSSSLPGKLADCASSDPEESEIFIVEGDSAGGSAKQGRDRKFQAILPL
GYRB_AQUAE      XXXXXXXXXXXXXXLVRRKSPLEEGVLPGKLADCSETDPSKCEIFLVEGDSAGGSAKQARDRRYQAILPL
PARE_STRPN      XXXXXXXXXXXXXXXSRNXXXXXXXXXXXXXTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPL
GYRB_HAEIN      XXXXXXXXXXXXXXXXXXXGALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKVGRDRKTQAILPL
GYRB_NICBE      NXXXXXXXXXXXXELVRQKSVLKSSSLPGKLADCSATNPEEAEIFIVEGDSAGGSAKQGRDRRFQAILPL
GYRB_PSEAE      DXXXXXXXXXXXXXXXXXXGALDIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRRTQAILPL
GYRB_VIBPA      DXXXXXXXXXXXXXXXXXXGALDLAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKNQAILPL
PARE_MYCGA      XXXXXXXXXXXXXXXXXXXXXXXSERLYGKLTPAQQKNPLQNEIFLVEGDSAGGTAKSGRDKRFQAILPL
GYRB_RICCN      XXXXXXXXXXXXXXXXXXXSALEVSNLPGKLADCHAKDPAISELFIVEGDSAGGTAKQGRDSKIQAILPL
GYRB_VIBCH      DXXXXXXXXXXXXXXXXXXGALDLAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKNQAILPL
GYRB_MYCCT      NXXXXXXXXXXXXSVKGKKNVNKL--MLGKLTPAQGKKRELNELYLVEGDSAGGSAKSGRDRNFQAILPL
PARE_MYCGE      NARKIKEQIKQQRELKKSLSSPQKEKLFGKLAPCQTKKTSEKELFIVEGDSAGGTAKMGRDRIFQAILPL
GYRB_MYXXA      DXXXXXXXXXXXXETVRRKGVLDGGGLPGKLADCQIRDPNESELYIVEGDSAGGSAKQGRDRRNQAILPL
GYRB_BUCAI      XXXXXXXXXXXXXXXXXXXSILDLGALPGKLSDCQENDPKFSEIYLVEGDSAGGSAKQGRNRKNQAILPL
GYRB_PSEPU      DXXXXXXXXXXXXXXXXXXGALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRRTQAILPL
GYRBM_ARATH     XXXXXXXXXXXXXXXXXXXXXXXXXXXPGKLADCSSTDPEVSEIFIVEGDSAGGSAKQGRDRRFQAILPL
GYRB_RICFE      XXXXXXXXXXXXXXXXXXXSALEVSNLPGKLADCHAKDPAISELFIVEGDSAGGTAKQGRDSKIQAILPL
GYRB_RICBR      XXXXXXXXXXXXXXXXXXKSVLEVSNLPGKLADCHAKDPAVSELFIVEGDSAGGTAKQGRDSKIQAILPL
GYRB_BUCBP      ESSXXXXXXXXXXEMTRKKGTLDLIGLPGKLSDCQERDPALSEIYLVEGDSAGGSAKQARNRKNQAILPL
GYRB_BUCAP      NSXXXXXXXXXXXXXXXXXGTLDLGTLPGKLSDCQENDPKLSEIYLVEGDSAGGSAKQGRNRKNQAILPL
GYRBP_ARATH     XXXXXXXXXXXXXXXXXXXXXXXXXXXPGKLADCSSTDPAESEIFIVEGDSAGGSAKQGRDRRFQAILPL
PARE_STAES      XXXXXXXXXXXXXXXXXKKNKRKDTLLSGKLTPAQSKNTDKNELYLVEGDSAGGSAKLGRDRKFQAILPL
PARE_STAEQ      XXXXXXXXXXXXXXXXXKKNKRKDTLLSGKLTPAQSKNTDKNELYLVEGDSAGGSAKLGRDRKFQAILPL
GYRB_HELPY      XXXXXXXXXXXXXELTRKKDNLSVGTLPGKLADCQSKDPLESEIFLVEGDSAGGSAKQGRDRVFQAILPL
GYRB_HELPJ      XXXXXXXXXXXXXELTRKKDNLSVGTLPGKLADCQSKDPLESEIFLVEGDSAGGSAKQGRDRVFQAILPL
GYRB_RICPR      XXXXXXXXXXXXXXXXXXXSALEVSNLPGKLADCHAKDPAISELFIVEGDSAGGTAKQGRDSKIQAILPL
GYRB_RICTY      XXXXXXXXXXXXXXXXXXXSALEVSNLPGKLADCHAKDPAISELFIVEGDSAGGTAKQGRDSKIQAILPL
GYRB_NEIGO      DXXXXXXXXXXXXEITRRKGLMDGLGLPGKLADCQEKDPALSELYLVEGNSAGGSAMQGRDRKFQAILPL
GYRB_CAUCR      XXXXXXXXXXXXXXXXXXXSALDITSLPGKLADCSERDPAKSEIFIVEGDSAGGSAKQARNRDNQAVLPL
GYRB_CAUCN      XXXXXXXXXXXXXXXXXXXSALDITSLPGKLADCSERDPAKSEIFIVEGDSAGGSAKQARNRDNQAVLPL
PARE_CAUCR      ERAEERLKRRKDKE-VSRASATRKLRLPGKLADCAGSAVDGAELFIVEGDSAGGSAKQARDRKYQAILPL
GYRB_BARBK      ERAEERLKRRQDRE-INRKTAVRKLRLPGKLADCSQNSAAGAELFIVEGDSAGGSAKQARNRTNQAILPL
PARE_RICCN      SIAEFRISKKNEKN-ISRKNATQKLRLPGKLADCTRTSPEGTELFIVEGDSAGGSAKQARNRETQAVLPL
PARE_MYCPN      YNXXXXXXXXXXXXXXXNLSNPKAERLFGKLAPAQSKKVAERELFVVEGDSAGGTAKMGRDRFLQAILPL
PARE_RICFE      AIAEFRISKKNEKN-ISRKNATQKLRLPGKLADCTRTTPGGTELFIVEGDSAGGSAKQARNRETQAVLPL
GYRB_CYTAU      LXXXXXXXXXXXXEMVQRKNVLSGSGLPGKLADCSESDPEKCEIYLVEGDSAGGSAKQGRDRKYHAILPL
PARE_RICBR      AIAEFRLN-KKNEKTISRKNATQKLRLPGKLADCTRTSPEGTELFIVEGDSAGGSAKQARNRETQAVLPL
GYRB_CYTHU      LXXXXXXXXXXXXEMVQRKNVLSGSGLPGKLADCSESDPEKCELYLVEGDSAGGSAKQGRDRKYHAILPL
PARE_RICPR      AIAEFRRNKKNERN-ISRKSVTQKLRLPGKLADCTRTSAEGTELFIVEGDSAGGSAKQARNRETQAVLPL
GYRB_FLEEL      LXXXXXXXXXXXXEMVQRKNVMGGTSLPGKLADCSDTNPERCELYLVEGDSAGGSAKQGRDRSFQAILPL
PARE_RICTY      AISEFRRNKKNERN-ISRKNATQKLRLPGKLADCTRTSAEGTELFIVEGDSAGGSAKQARNRETQAVLPL
PARE_PSEAE      SNAGRRLKAGKK---VERKKITQGPALPGKLADCAGQEPMRAELFLVEGDSAGGSAKQARDKEFQAIMPL
PARE_ECOLI      SSAQXXXXXXXXXXXXXLTSGP---ALPGKLADCTAQDLNRTELFLVEGDSAGGSAKQARDREYQAIMPL
PARE_SALTY      ASAQXXXXXXXXXXXXXXTSGP---ALPGKLADCTAQDLNRTELFLVEGDSAGGSAKQARDREYQAIMPL
PARE_SALTI      ASAQXXXXXXXXXXXXXXTSGP---ALPGKLADCTAQDLNRTELFLVEGDSAGGSAKQARDREYQAIMPL
GYRB_FLEJA      XXXXXXXXXXXXXXXVQRKSVLTGSGLPGKLADCSENDPEKCELYLVEGDSAGGTAKQGRNRAFQAILPL
PARE_HAEIN      SSAQXXXXXXXXXXXXXXXSGP---ALPGKLADCGSQDLEKTELFLVEGDSAGGSAKQARDREYQAILPL
GYRB_BACCE      MXXXXXXXXXXXXELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPL
GYRB_BACMY      MXXXXXXXXXXXXELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPL
GYRB_SYNY3      XXXXXXXXXXXXXXXXXXXXXLESSTLPGKLADCSSKDPSESEIFIVEGDSAGG----------------
GYRB_ACIBA      XXXXXXXXXXXXXEMTRRKSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKMQAILPL
GYRB_ACIHA      XXXXXXXXXXXXXEMTRRKSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKMQAILPL
GYRB_ACIGB      XXXXXXXXXXXXXEMTRRKSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKMQAILPL
GYRB_ACIJU      XXXXXXXXXXXXXEMTRRKSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKMQAILPL
GYRB_ACILW      XXXXXXXXXXXXXEMTRRKSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKMQAILPL
GYRB_ACIG9      XXXXXXXXXXXXXEMTRRKSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKMQAILPL
GYRB_ACIG3      XXXXXXXXXXXXXEMTRRKSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKMQAILPL
GYRB_ACICA      XXXXXXXXXXXXXEMTRRKSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKMQAILPL
GYRB_ACIG6      XXXXXXXXXXXXXEMTRRKSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKMQAILPL
GYRB_ACIJO      XXXXXXXXXXXXXEMTRRKSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKMQAILPL
PARE_BORBU      DNERLRKELSSVRKEARERAKKISFKIP-KLKDCKSKQSEQTMIFLTEGDSATGSMVSCRDVYTQAIFSL
GYRB_PROMI      ----------------------------------------------------------------------
GYRB_ACIS9      ------------------KSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKMQAILPL
GYRB_ACIS6      ------------------KSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKMQAILPL
GYRB_ACIGA      ------------------KSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKMQAILPL
GYRB_ACIS8      ------------------KSALDIAGLPGKLADCQEKDPALSELFLVEGDSAGGSAKQGRNRKMQAILPL
GYRB_ACIS7      ------------------KSALDIAGLPGKLADCQEKDPALSELYLVEGDSPGGSAKQGRNRKMQAILPL
GYRB_RHOCA      ----------------------------------------------------------------------
TOP2_CAEEL      MSWVRFKQMDDLNXXXXXXXXXXXXGIP-KLEDANTKNSQQCTLILTEGDSASGLSVVGRDKY--GVFPL
TOP2M_CAEEL     NMKKKKLPGKRVRDIVKLEDA-EWAGITGTA--------EKCTLILTEGDSAKALALAGLEVLGRGVFPL
TOP2M_DICDI     GWALMKQKADLIHSTSGRQSKTTLIKSISKLDDANWAGGLKSKLIITEGDSAAGLSVVGRNSY--GVFPL
TOP2_SCHPO      VEEVLKFATAKADQQLSKGDGGLRSRITGKLEDANTKESHKCVLILTEGDSAKSLAVSGLSVVYYGVFPL
TOP2_CANAL      ANANEDKALQKADGSRKSRIKGQVNLVDANKAG--TKDGHNCTLILTEGLSAAGLSVVGRD--YYGCFPL
TOP2_DICDI      GIVASILEFAQFKDQSALKRXXXXXXXXXKLDDANLAGGTKSELILTEGDSAKSLATAGISVVGKGAFPL
TOP2B_MOUSE     FKAQTQLNKKKIKGIPKLDDANDAGG----------KHSLECTLILTEGDSAKSLAVSGLGVIGRGVFPL
TOP2B_HUMAN     FKAQTQLNKKKIKGIPKLDDANDAGG----------KHSLECTLILTEGDSAKSLAVSGLGVIGRGVFPL
TOP2B_CRILO     FKAQTQLNKKKIKGIPKLDDANDAGG----------KHSLECTLILTEGDSAKSLAVSGLGVIGRGVFPL
TOP2B_CHICK     FKAQTQLNKKKIKGIPKLDDANDAGGKHS--LDCT--------LILTEGDSAKSLAVSGLGVIGRGVFPL
TOP2_PLAFK      AQAKAQVELKKKMKAGSSKARERIIGIP-KLEDANSKYSQECTLILTEGDSAAGLSIVGRDKY--GVFPL
TOP2_PICGU      AKILKTSIADKIRTIVNANEDKEMSKADGKLVDANTKEGYKCTLILTEGDSAAGLTVVGRD--YYGCFPL
TOP2_MIMIV      GVCDQIIANAKAREEANLSKTDGKGRGPEKLYNAHTKEGYKCTLILTEGDSAKTFAMSGLNVIYYGVFPL
TOP2A_PIG       FKAQVQLNKKRIKGIPKLDDANDAGG----------RNSTECTLILTEGDSAKTLAVSGRDKY--GVFPL
TOP2A_HUMAN     SAVKHN----RIKGIPKLDDANDAGG----------RNSTECTLILTEGDSAKTLAVSGRDKY--GVFPL
TOP2_BOMMO      GLVESVLAKFKAQDQLVKKKQSKLKGIP-KLEDANTKNAHLCTLILTEGDSASGLSVVGRD--HYGVFPL
TOP2A_MOUSE     VESILNWVKFKAQIQLNKKCSTKIKGIP-KLDDANSRNSTECTLILTEGDSAKTLAVSGRDKY--GVFPL
TOP2_PENCH      MTNILHFAQQKADQMLKKTDGGRRSRMNNKLTDANTKEGHHCTLILTEGDSAKGLAMAGRAVVLFGVFPL
TOP2_PEA        GTKTQRLRGCKAED------ANEAGG----------RNSEKCTLILTEGDSAKALAMAGLSVVGRGVFPL
TOP2_ARATH      GAKTGRVLVEKLDD------AAEAGGKNSRLCT----------LILTEGDSAKSLALAGRSVLYCGVFPL
TOP2A_CRIGR     FKAQIQL--NKKCSAVKHNR---IKGIP-KLDDANSRNSTECTLILTEGDSAKTLAVSGRDKY--GVFPL
TOP2A_RAT       FKAQIQL--NKKCSAVKHNR---IKGIP-KLDDANSRNSAECTLILTEGDSAKTLAVSGRDKY--GVFPL
TOP2A_CHICK     FKAQTQL--NKKCSAVKH---TKIKGVP-KLDDANSKNSIDCTLILTEGDSAKTLAVSGRDKY--GVFPL
TOP2_DROME      AKTGGRKSS-KIKGIPKLEDANEAGG----------KNSIKCTLILTEGDSAKSLAVSGLGVILYGVFPL
TOP2_IIV3       ------LALKKIE--CRRTPIVKVDGY-----DQANRLGPDSVLIVCEGLSAKSYAVAGKGRTYFGILPL
TOP2_CANGA      ADENANNALKKS-DGSRKSRITDYP----KLEDANTKDGYKCTLILTEGDXXXXXXXXXXXXXYYGCYPL
TOP2_YEAST      ADANEENALKKS-DGTRKSRITNYP----KLEDANTKEGYKCTLVLTEGDXXXXXXXXXXXXXYYGCYPL
TOP2_IIV6       NNIIKTLNDKKRRPKVSVKEANKAGTTLSEKCTLIVCEGLSAKTYAVAGISTGISTKKGRD--WFGILPL
TOP2_TRYBB      STITGQLAQELNKEIGRRMSSKTLLTSITKLVDATSRDPKHTRTLIVEGDSAKALAQNSLSSRYTGVFPX
TOPL_BPT4       ----------------------------------------------------------------------
TOP2_LEICH      NSMDDQLANELNKEIGRRLSSKTLISAITKLVDATSSQPDGRNLIITEGDXXXXXXXXXEQKKYCGVFPX
TOP2_ASFP4      QSISKK-DNHKQVDVDKYTRARNAGGK--RAQDCM--------LLAAEGDSAGKSNPSGPSFDFCGMISL
TOP2_ASFWA      QSISKK-DNHKQVDVDKYTRARNAGGK--RAQDCM--------LLAAEGDSAGKSNPSGPSFDFCGMISL
TOP2_ASFK5      QSISKK-DNHKQIDVDKYTRARNAGGK--KAQDCM--------LLAAEGDSAGKSNPSGPSFDFCGMISL
TOP2_ASFB7      QSISKK-DNHKQVDVDKYTRARNAGGK--RAQDCM--------LLAAEGDSAGKSNPSGPSFDFCGMISL
TOP2_ASFM2      VDILLQSISKKDNHKVDKYTRANAGGK--KAQDCM--------LLAAEGDSAGKSNPSGPSFDFCGMISL
TOP2_TRYCR      GQLADEL--NKEMGAGRRMXXXXXXXXXXXXVDATTRDPRVRTLIVTEGDSAKALAQNSLSSRYTGVFPX
TOP2_CRIFA      NSMDDQLAAELNKEIGTGKXXXXXXXXXXKLVDARSDGKNIRTLIVTEGDXXXXXXXXXEQKKFCGVFPX
TOPS_BPT4       ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RGKILNVEKARLDKVLKNAEVQAIITALGTGIHDEFDINKLRYHKIVLMADADVDGQHIATLLLTLLFRF
GYRB_MYCSM      RGKIINVEKARIDRVLKNTEVQSIITALGTGIHDEFDISKLRYHKIVLMADADVDGQHISTLLLTLLFRF
GYRB_MYCS2      RGKIINVEKARIDRVLKNTEVQSIITALGTGIHDEFDISKLRYHKIVLMADADVDGQHISTLLLTLLFRF
GYRB_MYCPA      RGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEFDITKLRYHKIVLMADADVDGQHISXXXXXXXFRF
GYRB_MYCTU      RGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISXXXXXXXFRF
GYRB_MYCTA      RGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISXXXXXXXFRF
GYRB_MYCLE      RGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEFDISRLRYHKIVLMADADVDGQHISXXXXXXXFRF
GYRB_STRCO      RGKILNVEKARIDRILQNQEIQAMISAFGTGVHEDFDIEKLRYHKIILMADADVDGQHINXXXXXXXXRF
GYRBS_STRSH     RGKILNVEKARIDKILQNTEVQALISAFGTGVHEDFDIEKLRYHKIILMADADVDGQHINXXXXXXXXRF
GYRB_BACSU      RGKILNVEKARLDKILSNNEVRSMITALGTGIGEDFNLEKARYHKVVIMTDADVDGAHIRTLLLTFFYRY
GYRBR_STRSH     RGKILNVEKARIDKVLQNQENQALISAFGTGVHEDFDIAKLRYHKIILMADADVDGQHISXXXXXXXXRF
GYRB_CLOAB      RGKIMNVEKQRIDKILNSEEIKAMATAFGGGIGKDFDVSKLRYHKIIIMTDADVDGAHIRTLILTFFYRY
GYRB_HALSQ      KGKILNVEKHRLDRILENDEIRALITAIGGGVGDEFDIEKARYQRLILMTDADVDGAHIRTLLLTLLYRH
GYRB_BACHD      RGKILNVEKARLDKILANNEIRAIITALGTGIGDDFDIEKARYHKIIIMTDADVDGAHIRTLILTFFYRY
GYRB_MYCGE      RGKILNVEKSNFEQIFNNAEISALVMAIGCGIKPDFELEKLRYSKIVIMTDADVDGAHIXXXXXXXXXXX
GYRB_STAES      RGKILNVEKARLDRILNNNEIRQMITAFGTGIGGEFDISKARYHKIVIMTDADVDGAHIRTLLLTFFYRF
GYRB_STAEQ      RGKILNVEKARLDRILNNNEIRQMITAFGTGIGGEFDISKARYHKIVIMTDADVDGAHIRTLLLTFFYRF
GYRB_MYCGA      RGKVLNVEKANHEKIFKNEEIRTLITAIGAGVNPEFSLDKIRYNKIIIMTDADVDGAHIRILLLTFFFRH
GYRB_BACAN      KGKIINVEKARLDKILSNDEVRXXXXXXXXXXXXDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRY
GYRB_MYCPN      RGKILNVEKSHFEQIFNNVEISALVMAVGCGIKPDFELEKLRYNKIIIMTDADVDGAHIXXXXXXXXXXX
GYRB_TREDE      WGKMLNVEKTRLDKVVNNEKLQPIIATLGTGIGKDFNIEKLRYHKVIIMADADVDGSHIRTLLLTFFFRY
GYRB_MYCHO      RGKVINAEKNSFASVLSNKEIATMIHALGTGINTEFDINKLKYHKIIIMTDADVDGAHITTLLLTFFYRY
GYRB_STRR6      RGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRY
GYRB_STRPN      RGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRY
GYRB_STRP3      RGKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLIYRF
GYRB_STAAN      RGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRF
GYRB_STAAM      RGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRF
GYRB_BORHE      WGKMLNVEKTREDKVITNDKLIPIIASLGAGVGKTFYIEKLRYHKIIIMADADVDGSHIRTLLLTFFFRY
GYRB_TREPA      WGKMLNVEKTRLDKVLHNEKLQPIIATLGTGVGKDFDLTRIRYHKVIIMADADVDGSHIXXXXXXXXXXY
GYRB_STRP8      RGKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLIYRF
GYRB_STRP6      RGKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLIYRF
GYRB_STAAW      RGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRF
GYRB_STAAU      RGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRF
GYRB_STAAS      RGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRF
GYRB_STAA3      RGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRF
GYRB_THEMA      RGKILNVEKSSLDRLLKNEQISDIIVAVGTGIGDDFDESKLRYGRIIIMTDADIDGAHIRTLLLTLFYRY
GYRB_STAAR      RGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRF
GYRB_STAAC      RGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRF
GYRB_STRP1      RGKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLIYRF
GYRB_BORBU      WGKMLNVEKTREDKVITNDKLIPIIASLGAGVGKTFDITKLRYHKIIIMADADVDGSHIRTLLLAFFFRY
GYRB_CHLMU      RGKILNVEKARLQKIFQNQEIGSIIAALGCGITDNFNLSKLRYKRVIIMTDADVDGSHIRTLLLTFFYRH
GYRB_SPICI      RGKILNVEKAKQIKIFENNEINSIITALGAGIKDNFNDKKLRYQKVIIMTDADVDGAHIRILLLTFFYRY
GYRB_CHLPN      RGKILNVEKARLQKIFQNQEIGTIIAALGCGIADNFNLSKLRYRRIIIMTDADVDGSHIRTLLLTFFYRH
GYRB_ARCFU      KGKIINVEKAGMARVLKNDEXXXXXXXXXXXXXXDFDITKARYRRIIIMTDADVDGAHIRTLLLTFFYRY
PARE_BACSU      RGKVINTEKAKLADIFKNEEINTIIHAIGGGVGADFSIDDINYDKIIIMTDADTDGAHIQVLLLTFFYRY
GYRB_CAMJE      RGKILNVEKARLDKILKSEQIQNMITAFGCGIGEDFDLSKLRYHKIIIMTDADVDGSHIQTLLLTFFFRF
GYRB_MYCAT      RGKIINAEKQDFTSVMSNKEVSSMIHALGTGITDEFNINKLKYHKIVIMTDADVDGAHIATLLLTFFYRY
GYRB_SHIFL      KGKILNVEKARFDKMLSSQEVATLITALGCGIRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
GYRB_ECOLI      KGKILNVEKARFDKMLSSQEVATLITALGCGIRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
GYRB_ECO57      KGKILNVEKARFDKMLSSQEVATLITALGCGIRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
PARE_STAAW      RGKVINTEKARLEDIFKNEEINTIIHTIGAGVGTDFKIEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKY
PARE_STAAU      RGKVINTEKARLEDIFKNEEINTIIHTIGAGVGTDFKIEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKY
PARE_STAAN      RGKVINTEKARLEDIFKNEEINTIIHTIGAGVGTDFKIEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKY
PARE_STAAM      RGKVINTEKARLEDIFKNEEINTIIHTIGAGVGTDFKIEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKY
PARE_STAAC      RGKVINTEKARLEDIFKNEEINTIIHTIGAGVGTDFKIEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKY
PARE_STAA8      RGKVINTEKARLEDIFKNEEINTIIHTIGAGVGTDFKIEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKY
GYRB_CHLTR      RGKILNVEKARLQKVFQNQEIGSIIAALGCGIKDNFNLSKLRYKRIIIMTDADVDGSHIRTLLLTFFYRH
GYRB_SALTY      KGKILNVEKARFDKMLSSQEVATLITALGCGIRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
GYRB_SALTI      KGKILNVEKARFDKMLSSQEVATLITALGCGIRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
PARE_STAAR      RGKVINTEKARLEDIFKNEEINTIIHTIGAGVGTDFKIEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKY
PARE_STAAS      RGKVINTEKARLEDIFKNEEINTIIHTIGAGVGTDFKIEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKY
GYRB_ORYSJ      RGKILNIERRDEAALYKNEEIQNLIVALGLGVKGE-DFNKLRYHKIVILTDADVDGAHIRTLLLTFFFRY
GYRB_AQUAE      RGKIINVEKARIDKVLSNDEIKAIVSALGCGIGEDLDLKKLRYHKIILMTDADVDGSHIRTLLLTFFYRF
PARE_STRPN      RGKVVNTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRY
GYRB_HAEIN      KGKILNVEKARFDKMLSSQEVGTLITALGCGIRDEYNPDKLRYHHIIIMTDADVDGSHIRTLLLTFFYRQ
GYRB_NICBE      RGKILNIERKDEAAMYKNEEIQNLILGLGLGVKEDFKKEALRYHKIIILTDADVDGAHIRTLLLTFFFRY
GYRB_PSEAE      KGKILNVEKARFDKMLSSQEVGTLITALGCGIREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFFRQ
GYRB_VIBPA      KGKILNVEKARFDKMLSSQEVATLITALGCGIRDEYNPDKLRYHNIIIMTDADVDGSHIRTLLLTFFYRQ
PARE_MYCGA      RGKVVNVEKSRLQDLLKNEEILSIISCLGCGIGNNFNIKNLKYHKIIIMTDADTDGAHIQVLLLTFFYRY
GYRB_RICCN      RGKILNVERARFDKMLGSDQIGTLITALGISVEREFSLEKLRYHKVIIMTDADVDGSHIRTLLLTFFYRH
GYRB_VIBCH      KGKILNVEKARFDKMLSSQEVATLITALGCGIRDEYNPDKLRYHNIIIMTDADVDGSHIRTLLLTFFYRQ
GYRB_MYCCT      RGKVINSEKAKLVDLLKNEEIQSIINAIGAGVGKDFDISDINYGKIIIMTDADTDGAHIQTLLLTFFYRH
PARE_MYCGE      RGKVLNVEKINNKKAITNEEILTLIFCIGTGILTNFNIKDLKYGKIIIMTDADNDGAHIQILLLTFFYRY
GYRB_MYXXA      RGKILNVEKL-LREMLTSAEIVTLITALGNGIAEDYDPEKARYHRIFLMTDADVDGSHI-----------
GYRB_BUCAI      KGKILNVEKSKFDKMILSQEVASLITALGCGIKNEYNIDKLRYHYIIIMTDADVDGAHIRTLLLTFFYRQ
GYRB_PSEPU      KGKILNVEKARFDKMISSQEVGTLITALGCGIREEYNIDKLRYHNIIIMTDADVDGSHIXXXXXXXXXXQ
GYRBM_ARATH     RGKILNIERKDEAAMYKNEEIQNLILGLGLGVKEDFKKENLRYHKIIILTDADVDGAHIRTLLLTFFFRY
GYRB_RICFE      RGKILNVERARFDKMLGSDQIGTLITALGTGVDNEFSLEKLRYHKVIIMTDADVDGSHIRTLLLTFFYRH
GYRB_RICBR      RGKILNVERARFDKMLGSDQIGTLITALGTGVDNEFSLEKLRYHKVIIMTDADVDGSHIRTLLLTFFYRH
GYRB_BUCBP      KGKILNVEKARYEKMLSSQEVTTLITALGCGIKNEYNPEKLRYHRIIIMTDADVDGSHIRTLLLTFFYRY
GYRB_BUCAP      KGKILNVQKTKFDKIILSQELTSLITALGCSIKSEYSLDKLRYNHIIIMTDADVDGAHIRTLLLTFFYRQ
GYRBP_ARATH     RGKILNIERKDEAAMYKNEEIQNLILGLGLGVKEDFNKENLRYHKIIILTDADVDGAHIRTLLLTFFFRY
PARE_STAES      RGKVINTEKARLEDIFKNEEINTIIHTIGAGVGTDFKIEDSNYNRIIIMTDADTDGAHIQVLLLTFFFKY
PARE_STAEQ      RGKVINTEKARLEDIFKNEEINTIIHTIGAGVGTDFKIEDSNYNRIIIMTDADTDGAHIQVLLLTFFFKY
GYRB_HELPY      KGKILNVEKSHLSKILKSEEIKNMITAFGCGIQESFDIERLRYHKIIIMTDADVDGSHIQTLLMTFFYRY
GYRB_HELPJ      KGKILNVEKSHLSKILKSEEIKNMITAFGCGIQESFDIERLRYHKIIIMTDADVDGSHIQTLLMTFFYRY
GYRB_RICPR      RGKILNVERARFDKMLGSDQIGTLITALGISVEREFSLEKLRYHKVIIMTDADVDGSHIRALLLTFFYRH
GYRB_RICTY      RGKILNVERARFDKMLSSEQIGTLITALGISVEREFSLEKLRYHKVIIMTDADVDGSHIRTLLLTFFYRH
GYRB_NEIGO      KGKILN--------------VATLITALGAGIKEEFNPEKLRYHRIIIMTDADVDGAHIRTLLLTFFYRQ
GYRB_CAUCR      RGKILNVERARFDKMLSSDQIGTLITALGAGIRDDFNPDKVRYHKIVLMTDADVDGAHIRTLLLTFFYRQ
GYRB_CAUCN      RGKILNVERARFDKMLSSDQIGTLITALGAGIRDDFNPDKVRYHKIVLMTDADVDGAHIRTLLLTFFYRQ
PARE_CAUCR      RGKILNVASASGEKFTANKELSDLMLALGAQAGAKYREEDLRYERIIIMTDADVDGAHIASLLITFFYRT
GYRB_BARBK      RGKILNVASAAREKMSSSQTIADLILALGCGTRSKYREEDLRYERIIIMTDADVDGAHIASLLITFFFQE
PARE_RICCN      WGKVLNVASSTLEKIVNNQAIQDLEIALACGSLKNYKKENLRYEKIIIMTDADVDGAHIASLLMTFFFLR
PARE_MYCPN      RGKVLNVXXXXXXXXXXXXXLLTLIFCIGTGIGNNFTIRDRKYDKIIIMTDADNDGAHIQILLLTFFYRY
PARE_RICFE      WGKVLNVASSTLEKIVNNQAIQDLEIALACGSLKNYKEENLRYEKIIIMTDADVDGAHIASLLMTFFFLR
GYRB_CYTAU      RGKILNVEKAQEHRIYENDEIKNMITALGVSFGTELNLTKLRYHKVIIMTDADIDGSHIRTLILTFFFRY
PARE_RICBR      WGKVLNVASSTLEKIVNNQAIQDLEIALACGSMKNYKKENLRYEKIIIMTDADVDGAHIASLLMTFFFLR
GYRB_CYTHU      RGKILNVEKAQEHRIYENDEIKNMITALGVSFGTELNLTKLRYHKVIIMTDADIDGSHIRTLILTFFFRY
PARE_RICPR      WGKVLNVASSTLEKIINNQAIQDLEIALACGSLKNYKKENLRYEKIIIMTDADVDGAHIASLLMTFFFLR
GYRB_FLEEL      RGKILNVEKAQEYKIYDNEEIKNMITAMGVTFGTEEDLTKLRYHKIIIMTDADVDGSHIRTLILTFFFRY
PARE_RICTY      WGKVLNVASSTLEKIINNQAIQDLEIALACGSLKNYKKENLRYEKIIIMTDADVDGAHIASLLMTFFFLR
PARE_PSEAE      RGKILNTWEVDGGEVLASQEVHDIAVAIGVD-PGASDLAQLRYGKICILADADSDGLHIATLLCALFVRH
PARE_ECOLI      KGKILNTWEVSSDEVLASQEVHDISVAIGID-PDSDDLSQLRYGKICILADADSDGLHIATLLCALFVKH
PARE_SALTY      KGKILNTWEVSSDEVLASQEVHDISVAIGID-PDSDDLSQLRYGKICILADADSDGLHIATLLCALFVRH
PARE_SALTI      KGKILNTWEVSSDEVLASQEVHDISVAIGID-PDSDDLSQLRYGKICILADADSDGLHIATLLCALFVRH
GYRB_FLEJA      RGKILNVEKAMEHKIYENEEIKNIFTALGVTIGTEEDLSKLRYHKLIIMTDADVDGSHIATLILTFVFRY
PARE_HAEIN      RGKILNTWEVSPDQVLGSTEIHDIAVALGID-PDSNDLSQLRYGKVCILADADSDGLHIATLLCALFLRH
GYRB_BACCE      KGKIINVEKARLDKILSNDEVRXXXXXXXXXXXXDFDIEKARYHKVIIMTDADVD---------------
GYRB_BACMY      KGKIINVEKARLDKILSNDEVRXXXXXXXXXXXXDFAIEKARYHKVIIMTDADVD---------------
GYRB_SYNY3      ----------------------------------------------------------------------
GYRB_ACIBA      KGKILNVERARFDKMISSQEVGTLITALGCGIREEYNPDKLRYHKII-----------------------
GYRB_ACIHA      KGKILNVERARFDKMISSQEVGTLITALGCGIREEYNPDKLRYHKII-----------------------
GYRB_ACIGB      KGKILNVERARFDKMISSQEVGTLITALGCGIREEYNPDKLRYHKIII----------------------
GYRB_ACIJU      KGKILNVERARFDKMISSQEVGTLITALGCGIREEYNPDKLRYHKII-----------------------
GYRB_ACILW      KGKILNVERARFDRMISSAEVGTLITALGCGIREEYNPDKLRYHKIII----------------------
GYRB_ACIG9      KGKILNVERARFDRMISSAEVGTLITALGCGIREEYNPDKLRYHKIII----------------------
GYRB_ACIG3      KGKILNVERARFDKMISSQEVGTLITALGCGIREEYNPDKLRYHKII-----------------------
GYRB_ACICA      KGKILNVERARFDKMISSQEVGTLITALGCGIREEYNPDKLRYHKII-----------------------
GYRB_ACIG6      KGKILNVERARFDKMISSQEVGTLITALGCGIREEYNPDKLRYHKII-----------------------
GYRB_ACIJO      KGKILNVERARFDKMISSQEVGTLITALGCGIREEYNPDKLRYHKIII----------------------
PARE_BORBU      RGKPQNMFEKNKSEIYKNEELYNMMVALGI----EESIENLRYNKVVIATDADFDGFHIRNXXXXXXXXX
GYRB_PROMI      ----------------------------------------------------------------------
GYRB_ACIS9      KGKILNVERARFDKMISSQEVGTLITALGCGIREEYNPDKLRYHKII-----------------------
GYRB_ACIS6      KGKILNVERARFDKMISSQEVGTLITALGCGIREEYNPDKLRYHKII-----------------------
GYRB_ACIGA      KGKILNVERARFDKMISSQEVGTLITALGCGIREEYNPDKLRYHKII-----------------------
GYRB_ACIS8      KGKILNVERARFDRMISSAEVGTLITALGCGIREEYNPDKLRYHKIV-----------------------
GYRB_ACIS7      KGKILNVERARFDKMISSQEVGTLITALGCGIREEYNPDKLRYHKII-----------------------
GYRB_RHOCA      ----------------------------------------------------------------------
TOP2_CAEEL      RGKLLNVREGNMKQIADNAEVNAMIKILGLQYKKKYDFKTLRYGKLMVMADQDQDGSHIKGLVINFIHHF
TOP2M_CAEEL     KGKLLNVSNLDDARASKNEEISNLLRILGLKFEDSNSITRLRYGRLLILADQDEDGSHIKGLIVNFIHKF
TOP2M_DICDI     RGKLLNVRDVASKQLLSNEEINNLTTILGLSHKNSYDTDELRYGRVMIMADQDHDGSHIKGLVMNFIHYF
TOP2_SCHPO      RGKLLNVREASHSQILNNKEIQAIKKIMGTHKKTYTDVKGLRYGHLMIMTDQDHDGSHIKGLIINYLESS
TOP2_CANAL      RGKLLNVREASADQISKNAEINSLKQIIGKKVYTAENIKSLRYGHIMIMTDQDQDGSHIKGLIINFLETS
TOP2_DICDI      KGKLLNV-RDQSTKVINNDEINNIVTILGLKYGKVYELSDLRYGHLMIMTDQDHDGSHIKGLIINMVHHF
TOP2B_MOUSE     RGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHN
TOP2B_HUMAN     RGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHN
TOP2B_CRILO     RGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHN
TOP2B_CHICK     RGKILNVREASHKQIMENAEINNIIKIVGLSYEDPESLKSLRYGKIMIMTDQDQDGSHIKGLLINFIHHN
TOP2_PLAFK      KGKLLNVRDASFKQLMDNKEIQNIFRIMGLDITDKNDIKGLRYGSLMIMTDQDYDGSHIKGLLINMIHKF
TOP2_PICGU      RGKLLNVREASIEQVSKNAEINSIKQIMGLQHKKRYNIKSLRYGHIMIMTDQDQDGSHIKGLIINFLETS
TOP2_MIMIV      RGKLLNVRDASPKKIADNEEITAIIVGLEQGVYD--DLKGLRYGSIMILADQDVDGYHIKGLIMNFIHCF
TOP2A_PIG       RGKILNVREASHKQIMENAEINNIIKIVGLNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHN
TOP2A_HUMAN     RGKILNVREASHKQIMENAEINNIIKIVGLNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHN
TOP2_BOMMO      EGKPLNVRDASHKQVLENVEINNLIKILGLQYKKKYDLKTLRYGKVMIMADQDQDGSHIKGLIINFIHHN
TOP2A_MOUSE     RGKILNVREASHKQIMENAEINNIIKIVGLNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHN
TOP2_PENCH      RGKLLNVRDASFDQIAKNQEIQNIKNFIGLQHKKEYDTRGLRYGHLMITTDQDHDGSHIKGLLINFLQAQ
TOP2_PEA        RGKLLNVREASSKQIMDNEEIQNIKKILGLQQNKEYNVKSLRYGHLMIMADQDHDGSHIKGLLINFIHSF
TOP2_ARATH      RGKLLNVREASTTQITNNKEIENLKKILGLKQNMKYEVNSLRYGQMMIMTDQDHDGSHIKGLLINFIHSF
TOP2A_CRIGR     RGKILNVREASHKQIMENAEINNIIKIVGLNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHN
TOP2A_RAT       RGKILNVREASHKQIMENAEINNIIKIVGLNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHN
TOP2A_CHICK     RGKMLNVREASHKQIMENAEINNIIKIVGLNYEDRESLKSLRYGKIMIMTDQDQDGSHIKGLLINFIHHN
TOP2_DROME      RGKLLNVREANFKQLSENAEINNLCKIIGLQYKKKYDLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHTN
TOP2_IIV3       RGKFLNVKNTTPLKIGQNKVVSDFIKVLNLKFNLDYNYATLNYGTLLILTDADKDGIHIKGLILNLIHEL
TOP2_CANGA      RGKMLNVREATADQILKNAEIQAIKKIMGLQHRKKYDTKSLRYGHLMIMTDQDHDGSHIKGLIINFIETS
TOP2_YEAST      RGKMLNVREASADQILKNAEIQAIKKIMGLQHRKKYDTKSLRYGHLMIMTDQDHDGSHIKGLIINFLESS
TOP2_IIV6       RGKFLNVRNANNDKMIKNTVVTDLVNAMGLTFGMDYSTQKSR----------------------------
TOP2_TRYBB      XXXXXXXXXXXXXXXXXXXXXQELFCALGLELDKDYDADELRYQRILIMTDQDADGSHIKGLVINAFESL
TOPL_BPT4       ----------------------------------------------------------------------
TOP2_LEICH      XXXXXXXXXXXXXXXXTCKGLQDLFLSLGLELGKEYSPAELRYQRLLVMTDQDADGSHIKGLVINAFESL
TOP2_ASFP4      GGVIMNACKVRNEQLTNNKVLQGIVQVLGLDFNCHYKTQKLRYGCIVACVDQDLDGGKILGLLLAYFHLF
TOP2_ASFWA      GGVIMNACKVRNEQLTNNKVLQGIVQVLGLDFNCHYKTQKLRYGCIVACVDQDLDGGKILGLLLAYFHLF
TOP2_ASFK5      GGVIMNACKVRNEQLTNNKVLQGIVQVLGLDFNCHYKTQKLRYGCIVACVDQDLDGGKILGLLLAYFHLF
TOP2_ASFB7      GGVIMNACKVRNEQLTNNKVLQGIVQVLGLDFNCHYKTQKLRYGCIVACVDQDLDGGKILGLLLAYFHLF
TOP2_ASFM2      GGVIMNACKVRNEQLTNNKVLQGIVQVLGLDFNCHYKTQKLRYGCIVACVDQDLDGGKILGLLLAYFHLF
TOP2_TRYCR      XXXXXXXXXXXXXXXXXXXELQELFCALGLELGKIYDAEELRYQRLLVMTDQDADGSHIKGLVINAFEAL
TOP2_CRIFA      XXXXXXXXXXXXXXXXTCKELQDLFLALGLELGKTYKSPELRYQRLLVMTDQDADGSHIKGLVINAFESL
TOPS_BPT4       --------------------------------------SSMNYANVAIMTDADHDGLGSIYPSLLGFFSN


                         .         .         .         *         .         .         .:630
query           MPDLVAEGHVYLAQPPLYKLKWQRGEPGFAYSDEERDEQLNEGLAAGRKINKDDGIQRYKGLGEMNASEL
GYRB_MYCSM      MKPLVENGHIFLAQPPLYKLKWQRSEPEFAYSDRERDGLLEAGRAAGKKINVDDGIQRYKGLGEMDAKEL
GYRB_MYCS2      MKPLVENGHIFLAQPPLYKLKWQRSEPEFAYSDRERDGLLEAGRAAGKKINVDDGIQRYKGLGEMDAKEL
GYRB_MYCPA      MRPLIEHGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKDDGIQRYKGLGEMDAKEL
GYRB_MYCTU      MRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKEL
GYRB_MYCTA      MRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKEL
GYRB_MYCLE      MRPLIEHGYVFLAQPPLYKLKWQRMDPEFAYSDSERDXXXXXXXXXXXXINKEDGIQRYKGLGEMDAKEL
GYRB_STRCO      MRPLVESGHVYLSRPPLYKIKWGRDDFEYAYSDRERDALIEMGRQAGKRI-REDSVQRFKGLGEMNAEEL
GYRBS_STRSH     MRPLVEAGHVYLSRPPLYKIKWGRDDFEYAYSDRERDALVELGKQNGKRI-KEDSIQRFKGLGEMNAEEL
GYRB_BACSU      MRQIIENGYVYIAQPPLYKVQ-QGKRVEYAYNDKELEELLKT-----LPQTPKPGLQRYKGLGEMNATQL
GYRBR_STRSH     MRPLVEEGHVHLSRPPLYKIKWSREHVEYAYSDRERNTLL-EXXXXXXXXXXXXSIQRFKGLGEMNAEEL
GYRB_CLOAB      MTELISEGHVFIAQPPLYKVTKTRKE-YYAYSDKELEDVLQD--VGGKDKNTD--IQRYKGLGEMNPEQL
GYRB_HALSQ      MRPLIEAGYVYAAQPPLYRVRYR----GNTY--DAMXXXXXXXXXXXXCNGNPTQVQRFKGLGEMNPDQL
GYRB_BACHD      MRPLIEHGYVYIAQPPLYKVQ-QGKDIQYAYGDAELQEILSQ-----LPDKAKPGIQRYKGLGEMNPSQL
GYRB_MYCGE      MYPLVEQGNIFIAQPPLYKVSYSHKDL-YMHTDVQLEQWKSQ------NPNVKFGLQRYKGLGEMDALQL
GYRB_STAES      MRPLIEAGYVYIAQPPLYKLT-QGKQKYYVFNDRELD-KLKQELNPSPKWS----IARYKGLGEMNADQL
GYRB_STAEQ      MRPLIEAGYVYIAQPPLYKLT-QGKQKYYVFNDRELD-KLKQELNPSPKWS----IARYKGLGEMNADQL
GYRB_MYCGA      MFPLIEKGHVYIAQPPLYRVSYNK-QNKYIYSDAQLEEWKNQ------NPNVRYELQRYKGLGEMDDVQL
GYRB_BACAN      MRQIIEHGYIYIAQPPLFKVQ-QGKKIQYAYNEKELEKILAE-LPAQPK----PGIQRYKGLGEMNPTQL
GYRB_MYCPN      MYPLVEQGNIYIAQPPLYKVSYSNKDLYM-----QTDVQLEEW--KQQHPNLKYNLQRYKGLGEMDAIQL
GYRB_TREDE      MPQVIEKGHVYLAMPPLYKISHNKKE-WYVYNDDERDSVLDQ---IGRGNNA--AVQRYKGLGEMDGTQL
GYRB_MYCHO      MKPLIEYGFVYLAQPPLYKITSGKNVE-YAYNDLQKEQ-----IMAKLEDKRNVAIQRYKGLGEMDPEQL
GYRB_STRR6      MKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQL
GYRB_STRPN      MKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQL
GYRB_STRP3      MRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSIGRSKPTVQRYKGLGEMDDHQL
GYRB_STAAN      MRPLIEAGYVYIAQPPLYKLT-QGKQKYYVYNDRELDKLKSE-------LNPTPSIARYKGLGEMNADQL
GYRB_STAAM      MRPLIEAGYVYIAQPPLYKLT-QGKQKYYVYNDRELDKLKSE-------LNPTPSIARYKGLGEMNADQL
GYRB_BORHE      MRELIENGHVYIAMPPLYKLKYENREHYF-YDDLEKEAFLG-SIETGKR--DKVSLQRYKGLGEMNPTQL
GYRB_TREPA      LPQIIEAGYVYLAMPPLYRIAWSKKEL-YVYSDTERDEAL-------ESIGKKSGVQRYKGLGEMDGTQL
GYRB_STRP8      MRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSIGRSKPTVQRYKGLGEMDDHQL
GYRB_STRP6      MRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSIGRSKPTVQRYKGLGEMDDHQL
GYRB_STAAW      MRPLIEAGYVYIAQPPLYKLT-QGKQKYYVYNDRELDKLKSE-------LNPTPSIARYKGLGEMNADQL
GYRB_STAAU      MRPLIEAGYVYIAQPPLYKLT-QGKQKYYVYNDRELDKLKSE-------LNPTPSIARYKGLGEMNADQL
GYRB_STAAS      MRPLIEAGYVYIAQPPLYKLT-QGKQKYYVYNDRELDKLKSE-------LNPTPSIARYKGLGEMNADQL
GYRB_STAA3      MRPLIEAGYVYIAQPPLYKLT-QGKQKYYVYNDRELDKLKSE-------LNPTPSIARYKGLGEMNADQL
GYRB_THEMA      MRPLIEQGRVYIALPPLYRIKAGR-EEFYVYSDQELAEYKEK--LQGKRIE----IQRYKGLGEMNPEQL
GYRB_STAAR      MRPLIEAGYVYIAQPPLYKLT-QGKQKYYVYNDRELDKLKSE-------LNPTPSIARYKGLGEMNADQL
GYRB_STAAC      MRPLIEAGYVYIAQPPLYKLT-QGKQKYYVYNDRELDKLKSE-------LNPTPSIARYKGLGEMNADQL
GYRB_STRP1      MRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSIGRSKPTVQRYKGLGEMDDHQL
GYRB_BORBU      MRDLIENGYIYIAMPPLYKIKYDN-----RIXXXXXXXXXXXXLDSIETKNRNSSLQRYKGLGEMNPTQL
GYRB_CHLMU      MSALIENGCVYIAQPPLYRVS-KKKDFRYILSEKEMDGYLNLGTRESRVVFDD------------TAREL
GYRB_SPICI      MKDLIENGNIYIAQPPLYKVE-NSNQIRYVYSDXXXXXXXXXXXXXXXXYT----IQRYKGLGEMNPEQL
GYRB_CHLPN      MTALIENECVYIAQPPLYKVS-KKKDFRYILSEKEMDSYL------------------------------
GYRB_ARCFU      MRPLIESGYLYIAQPPLYQIK--KGKKSYAYSDEELKRTL-EQVGGGE-------VQRYKGLGEMNPQQL
PARE_BACSU      MKPLIEHGKVFIALPPLYKVSKGSGKKEYAWSDEEMGDVL-------KKVGKGYTIQRYKGLGEMNADQL
GYRB_CAMJE      MNELVANGHIYLAQPPLYLYK----------------------------------IQRYKGLGEMNPEQL
GYRB_MYCAT      MRPLIEYGFVYIAQPPLYKISTAK-VTEYAYNDAQKEEILSK-----LEDSKNISIQRYKGLGEMDPEQL
GYRB_SHIFL      MPEIVERGHVYIAQPPLYKVK--KGKQEQYIKDDEAMDQYQISIA----------IQRYKGLGEMNPEQL
GYRB_ECOLI      MPEIVERGHVYIAQPPLYKVK--KGKQEQYIKDDEAMDQYQISIA----------IQRYKGLGEMNPEQL
GYRB_ECO57      MPEIVERGHVYIAQPPLYKVK--KGKQEQYIKDDEAMDQYQISIA----------IQRYKGLGEMNPEQL
PARE_STAAW      MKPLVQAGRVFIALPPLYKLEKGKGKTEYAWTDEELNKLQKE-------LGKGFTLQRYKGLGEMNPEQL
PARE_STAAU      MKPLVQAGRVFIALPPLYKLEKGKGKTEYAWTDEELNKLQKE-------LGKGFTLQRYKGLGEMNPEQL
PARE_STAAN      MKPLVQAGRVFIALPPLYKLEKGKGKTEYAWTDEELNKLQKE-------LGKGFTLQRYKGLGEMNPEQL
PARE_STAAM      MKPLVQAGRVFIALPPLYKLEKGKGKTEYAWTDEELNKLQKE-------LGKGFTLQRYKGLGEMNPEQL
PARE_STAAC      MKPLVQAGRVFIALPPLYKLEKGKGKTEYAWTDEELNKLQKE-------LGKGFTLQRYKGLGEMNPEQL
PARE_STAA8      MKPLVQAGRVFIALPPLYKLEKGKGKTEYAWTDEELNKLQKE-------LGKGFTLQRYKGLGEMNPEQL
GYRB_CHLTR      MSALIENECVYIAQPPLYRVS-KKKDFRYILSEKEMDGYLLNLGTKESQIVFDDTLRDLRG---------
GYRB_SALTY      MPEIVERGHVYIAQPPLYKVK--KGKQEQYIKDDEAMDQYQISIA----------IQRYKGLGEMNPDQL
GYRB_SALTI      MPEIVERGHVYIAQPPLYKVK--KGKQEQYIKDDEAMDQYQISIA----------IQRYKGLGEMNPDQL
PARE_STAAR      MKPLVQAGRVFIALPPLYKLEKGKGKTEYAWTDEELNKLQKE-------LGKGFTLQRYKGLGEMNPEQL
PARE_STAAS      MKPLVQADRVFIALPPLYKLEKGKGKTEYAWTDEELNKLQKE-------LGKGFTLQRYKGLGEMNPEQL
GYRB_ORYSJ      QKALFDEGCIYVGVPPLYKV--ERGKQAYCYDDADLKELVNT-----FPTNASYHIQRFKGLGEMMPAQL
GYRB_AQUAE      MPKLVEEGYVYIAEPPLYRVK--KGKKEIYIKDDKEFEHLNEIREKGRLVDARE--KEFKG---------
PARE_STRPN      MRPLVEAGHVYIALPPLYKMKGKKEEVAYAWTDGELEE-------LRKQFGKGATLQRYKGLGEMNADQL
GYRB_HAEIN      MPELIERGYVYIAQPPLYKVKKGKQERYIKDADEMEQYELTLAL-----------VQRYKGLGEMNADQL
GYRB_NICBE      QRALFEEGCIYVGVPPLYKV--ERGKQVYYCYDDAELKKVQRSFPSNASYN----IQRFKGLGEMMPAQL
GYRB_PSEAE      MPELIERGYIYIAQPPLYKVK--RGKQEQYIKDDQAMEE-------------------------------
GYRB_VIBPA      MPELIERGYVYIAQPPLYKVK--KGKQEQYIKDEEAMNQYQVSLA-----------QRYKGLGEMNPDQL
PARE_MYCGA      MKELIEQGKVYIALAPLYKISAKNNKSAFAWDDYQLDEL--------RTKYGSYEVQRYKGLGEMNSEQL
GYRB_RICCN      MPELINKGYLYIAQPPLYKVK--KGAAEFYLKNEQ--------------------IQRFKGLGEMNSDQL
GYRB_VIBCH      MPELIERGYIYIAQPPLYKVK--KGKQEQYIKDEEAMNQYQVALA----------IQRYKGLGEMNPDQL
GYRB_MYCCT      MKDLIIHKKVYIALPPLYKITF--NDKSFIYLWDE--EELNK---FNKTNTKKYEIQRYKGLGEMNADQL
PARE_MYCGE      MQPLIELGHVYLALPPLYKLETKRKTVKYLWSDLELE-------SVKLKLN-NFTLQRY