[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF52976.1

[Show Plain Result]


## Summary of Sequence Search
    1::398
  189::347     4e-09  32%  470 aa  CYCA_ECOLI RecName: Full=D-serine/D-alanine/glycine transporter;
  189::347     4e-09  32%  470 aa  CYCA_ECO57 RecName: Full=D-serine/D-alanine/glycine transporter;
  194::375     5e-07  30%  463 aa  YTNA_BACSU RecName: Full=Uncharacterized amino acid permease ytnA;
  208::334     1e-06  27%  462 aa  YBXG_BACSU RecName: Full=Uncharacterized transporter ybxG;
  199::322     1e-06  31%  444 aa  CADB_ECOLI RecName: Full=Probable cadaverine/lysine antiporter;
  199::322     1e-06  31%  444 aa  CADB_ECOL6 RecName: Full=Probable cadaverine/lysine antiporter;
  199::322     1e-06  31%  444 aa  CADB_ECO57 RecName: Full=Probable cadaverine/lysine antiporter;
  206::339     2e-06  25%  470 aa  YBGF_BACSU RecName: Full=Uncharacterized amino acid permease ybgF;
  189::337     3e-06  25%  467 aa  MMUP_ECOLI RecName: Full=Probable S-methylmethionine permease;
  252::392     3e-06  27%  574 aa  MEU22_SCHPO RecName: Full=Probable amino-acid permease
  225::358     9e-06  34%  533 aa  LAT2_RAT RecName: Full=Large neutral amino acids transporter small
  224::357     9e-06  34%  535 aa  LAT2_PONAB RecName: Full=Large neutral amino acids transporter
  223::356     9e-06  34%  531 aa  LAT2_MOUSE RecName: Full=Large neutral amino acids transporter
  224::357     9e-06  34%  535 aa  LAT2_HUMAN RecName: Full=Large neutral amino acids transporter
  213::332     9e-06  28%  469 aa  GABP_BACSU RecName: Full=GABA permease;AltName: Full=4-amino
  188::325     3e-05  24%  439 aa  POTE_ECOLI RecName: Full=Putrescine-ornithine antiporter;AltName:
  188::325     3e-05  24%  439 aa  POTE_ECOL6 RecName: Full=Putrescine-ornithine antiporter;AltName:
  224::357     3e-05  33%  535 aa  LAT2_RABIT RecName: Full=Large neutral amino acids transporter
  119::346     3e-05  25%  489 aa  ANSP1_MYCTU RecName: Full=L-asparagine permease 1;AltName:
  119::346     3e-05  25%  489 aa  ANSP1_MYCBO RecName: Full=L-asparagine permease 1;AltName:
   76::334     5e-05  30%  466 aa  GABP_ECOLI RecName: Full=GABA permease;AltName: Full=4-amino
  134::331     6e-05  24%  461 aa  PUUP_ECOLI RecName: Full=Putrescine importer;
  273::426     1e-04  28%  608 aa  DIP5_YEAST RecName: Full=Dicarboxylic amino acid permease;
  184::335     1e-04  23%  461 aa  YIFK_ECOLI RecName: Full=Probable transport protein yifK;
  209::345     3e-04  25%  489 aa  LYSP_ECOLI RecName: Full=Lysine-specific permease;
  185::396     3e-04  24%  457 aa  AROP_SHIFL RecName: Full=Aromatic amino acid transport protein
  184::395     3e-04  24%  456 aa  AROP_ECOL6 RecName: Full=Aromatic amino acid transport protein
  185::396     3e-04  24%  457 aa  AROP_ECO57 RecName: Full=Aromatic amino acid transport protein
  232::331     3e-04  30%  530 aa  AAA1_RAT RecName: Full=Asc-type amino acid transporter 1;       
  232::331     3e-04  30%  530 aa  AAA1_MOUSE RecName: Full=Asc-type amino acid transporter 1;        
  191::324     4e-04  25%  435 aa  POTE_HAEIN RecName: Full=Putrescine-ornithine antiporter;AltName:
  201::335     5e-04  21%  461 aa  YIFK_SALTY RecName: Full=Probable transport protein yifK;
  201::335     5e-04  21%  461 aa  YIFK_SALTI RecName: Full=Probable transport protein yifK;
  179::333     7e-04  21%  447 aa  YVBW_BACSU RecName: Full=Uncharacterized amino acid permease yvbW;
  268::426     9e-04  23%  602 aa  GAP1_YEAST RecName: Full=General amino-acid permease GAP1;
  297::423     9e-04  24%  590 aa  CAN1_YEAST RecName: Full=Arginine permease;
    1::398

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxGLFGFSLSAAIAAWTGVAIPWWIVGLVGWVFVALMGVSNVELSAKVLGVLVALEFXXXXXXXXXXXXH
CYCA_ECOLI      ----------------------------------------------------------------------
CYCA_ECO57      ----------------------------------------------------------------------
YTNA_BACSU      ----------------------------------------------------------------------
YBXG_BACSU      ----------------------------------------------------------------------
CADB_ECOLI      ----------------------------------------------------------------------
CADB_ECOL6      ----------------------------------------------------------------------
CADB_ECO57      ----------------------------------------------------------------------
YBGF_BACSU      ----------------------------------------------------------------------
MMUP_ECOLI      ----------------------------------------------------------------------
MEU22_SCHPO     ----------------------------------------------------------------------
LAT2_RAT        ----------------------------------------------------------------------
LAT2_PONAB      ----------------------------------------------------------------------
LAT2_MOUSE      ----------------------------------------------------------------------
LAT2_HUMAN      ----------------------------------------------------------------------
GABP_BACSU      ----------------------------------------------------------------------
POTE_ECOLI      ----------------------------------------------------------------------
POTE_ECOL6      ----------------------------------------------------------------------
LAT2_RABIT      ----------------------------------------------------------------------
ANSP1_MYCTU     -------AIATYLQRWTFTVVPQWILALIALTVVLSMNLISVEWFGKVLALMAFLVVGTVFLAGRYPVDG
ANSP1_MYCBO     -------AIATYLQRWTFTVVPQWILALIALTVVLSMNLISVEWFGKVLALMAFLVVGTVFLAGRYPVDG
GABP_ECOLI      --GSFSTYADKAIGRWAGYTIGWWVPGIPIWLFLALTG-SNL-LSVKNYGVIAILAFIFLGAVAISGFYP
PUUP_ECOLI      ---------------------PWWVVTFVAILTAANLKSVNLVANFNTLFVLVQISIMVVFIFLVVQGLH
DIP5_YEAST      ----------------------------------------------------------------------
YIFK_ECOLI      ----------------------------------------------------------------------
LYSP_ECOLI      ----------------------------------------------------------------------
AROP_SHIFL      ----------------------------------------------------------------------
AROP_ECOL6      ----------------------------------------------------------------------
AROP_ECO57      ----------------------------------------------------------------------
AAA1_RAT        ----------------------------------------------------------------------
AAA1_MOUSE      ----------------------------------------------------------------------
POTE_HAEIN      ----------------------------------------------------------------------
YIFK_SALTY      ----------------------------------------------------------------------
YIFK_SALTI      ----------------------------------------------------------------------
YVBW_BACSU      ---------------------------------------------------------------------H
GAP1_YEAST      ---------------------------------------------------------------------H
CAN1_YEAST      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SPEGISTATLHAEDFFVPGIGVLLAFSIAAFMGFESGAIYSEETKDPSKTVSRATYIAVGIIAIFYAAST
CYCA_ECOLI      SPTGVEASFAHLWNWFPKGLGFFAGFQIAAFVGIELVGTTAAETKDPEKSLPRAIN-SIPIRIIMFYVFA
CYCA_ECO57      SPTGVEASFAHLWNWFPKGLGFFAGFQIAAFVGIELVGTTAAETKDPEKSLPRAIN-SIPIRIIMFYVFA
YTNA_BACSU      --------------FFPHGLGVLLSLQMVAYLGIEMIGVTAGEVKNPQKSLAKAIDTVFWRILIFYVGAL
YBXG_BACSU      ---------------------------IAAYQGVELIGITAGEAKDPQNTLRNAIQSIIWRILIFYIGAI
CADB_ECOLI      -----------------------------AFVGVESAAVSTGMVKNPKRTVPLATMLGTGLAGIVYIAAT
CADB_ECOL6      -----------------------------AFVGVESAAVSTGMVKNPKRTVPLATMLGTGLAGIVYIAAT
CADB_ECO57      -----------------------------AFVGVESAAVSTGMVKNPKRTVPLATMLGTGLAGIVYIAAT
YBGF_BACSU      ---------------FVPILMTMLSVNFA-FSGTELIGIAAGESVDPDKTIPKAIKTTVWRLSLFFVGTI
MMUP_ECOLI      ---GLSNIT--AEGWFPHGGLPILMTMVAAFSGTELIGIAAGETENPRKVIPVAIRTTIARLIIFFIGTV
MEU22_SCHPO     ------------------GLCAVSVIAIFSLSGTELVGLAASEAKNPQKTVPAAVKQIFWRIFLFYIVAL
LAT2_RAT        ------------ENFQEPDIGVALAFLQGSFAGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFAN
LAT2_PONAB      ------------ENFQEPDIGVALAFLQGSFAGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFAN
LAT2_MOUSE      ------------ENFQEPDIGVALAFLQGSFAGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFAN
LAT2_HUMAN      ------------ENFQEPDIGVALAFLQGSFAGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFAN
GABP_BACSU      -------------------------------MGTEIVAIAAGETSNPIESVTKATRSVVWRIIVFYVGSI
POTE_ECOLI      ---------------FFSAVGSSIAMTLWAFLGLESACANTDVVENPERNVPIAVLGGTLGAAVIYIVST
POTE_ECOL6      ---------------FFSAVGSSIAMTLWAFLGLESACANTDVVENPERNVPIAVLGGTLGAAVIYIVST
LAT2_RABIT      ------------DNFQEPDIGLILAFLQGSFAGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFAN
ANSP1_MYCTU     HSTGLSLWNNHGGLFLIVTSGVVFAYSAVELVGTAAG-----ETAEPEKIMPRAINSVVARIAIFYVGSV
ANSP1_MYCBO     HSTGLSLWNNHGGLFLIVTSGVVFAYSAVELVGTAAG-----ETAEPEKIMPRAINSVVARIAIFYVGSV
GABP_ECOLI      YAEVSGISRLWDSGGFMPGFGAVLSITMFSFMGAEIVTIAAAESDTPEKHIVRATNSVIWRISIFYLCSI
PUUP_ECOLI      KGEGVGTVWISENAHLIPIIATIVCFS---FLGFDAVTTLSEETPDAARVIPKAIFLTAVYGGVIFIAAS
DIP5_YEAST      -----STAITGGKGKFVSFVAVFV-YSLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTV
YIFK_ECOLI      ---GFSNLTEHGGFFAGGWKGFLTALCIASYQGVELIGITAGEAKNPQVTLRSAVGKVLWRILIFYVGAI
LYSP_ECOLI      ------------------GVAMIVGFS---FQGTELIGIAAGESEDPAKNIPRAVRQVFWRILLFYVFAI
AROP_SHIFL      -----SVSNLWDQGGFLPGLVMMMAIIMFSFGGLELVGITAAEADNPEQSIPKATNQVIYRILIFYIGSL
AROP_ECOL6      -----SVSNLWDQGGFLPGLVMMMAIIMFSFGGLELVGITAAEADNPEQSIPKATNQVIYRILIFYIGSL
AROP_ECO57      -----SVSNLWDQGGFLPGLVMMMAIIMFSFGGLELVGITAAEADNPEQSIPKATNQVIYRILIFYIGSL
AAA1_RAT        --------------WMTPSVGHLLAFGSFAFSGWNFLNYVTEELVDPRKNLPRAIFISIPLVTFVYTFTN
AAA1_MOUSE      --------------WMTPSVGHLLAFGSFAFSGWNFLNYVTEELVDPRKNLPRAIFISIPLVTFVYTFTN
POTE_HAEIN      -------------------IGVSISMTLWAFLGLESACANADAVENPEKNVPIAVLGGTLGAAVIYIVST
YIFK_SALTY      ------------------GFLTALCIVVASYQGVELIGITAGEAKNPQVTLRSAVGKVLWRILIFYVGAI
YIFK_SALTI      ------------------GFLTALCIVVASYQGVELIGITAGEAKNPQVTLRSAVGKVLWRILIFYVGAI
YVBW_BACSU      TASGFSNLTDHGGFFPHGGTGLITAMLVVIYSGTEIIGVTLAETKNPEKVVPKAVRSTLTRIVAFYLLPF
GAP1_YEAST      DPGAFAGDTPGAKFKGVCSVFVTAAFS---FAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSL
CAN1_YEAST      ------------------------------FQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSL


                         +         .         .         .         .         *         .:210
query           WALAMGVGPSAIIDESRIYGPDLVFVWLASFSPALSNVAHLLFVTSIXXXXXXXXXXXXRYFFALGRSKV
CYCA_ECOLI      LIVIMSVTPSSVVPEKSPFVELFVLVGL----PAAASVINFVVLTSAASSANSGVFSTSRMLFGLAQEGV
CYCA_ECO57      LIVIMSVTPSSVVPEKSPFVELFVLVGL----PAAASVINFVVLTSAASSANSGVFSTSRMLFGLAQEGV
YTNA_BACSU      FVI-MSIYPWQEIGSQ---GSPFVLTFQKVGIPSAAGIINFVVLTAALSSCNSGIFSTGRMLFNLAEQKE
YBXG_BACSU      FVI-VTVYP---WDELNSLGSPFVSTFSKIGITAAAGIINFVVITAAMSGCNSGIFSAGRMLYTLGVNGQ
CADB_ECOLI      QVLS-GMYPSSVMAASAISASTILGNWAA---PLVSAFTAFACLTSLGSWMMLVGQAGVR----AANDGN
CADB_ECOL6      QVLS-GMYPSSVMAASAISASTILGNWAA---PLVSAFTAFACLTSLGSWMMLVGQAGVR----AANDGN
CADB_ECO57      QVLS-GMYPSSVMAASAISASTILGNWAA---PLVSAFTAFACLTSLGSWMMLVGQAGVR----AANDGN
YBGF_BACSU      FVLS-GLIP---IQDAGVIKSPFVAVFDRVGVPYAADIMNFVILTAILSAANSGLYASSRMLWSLSKEKT
MMUP_ECOLI      FVLAALIPMQQVGVEKSPF----VLVFEKVGIPYAADIFNFVILTAILSAANSGLYASGRMLWSLSNERT
MEU22_SCHPO     FMLTLVV-PSDLSDNSNVLSPFVIAIQLANIR-ALPSIMNVVILLSTLSVGNSASYAASRALFALAKNGY
LAT2_RAT        IAYVTAMSPQELLASNAVFGEKLVMAWIMPISVALSGVNGSLFTSS-------------RLFFAGAREGH
LAT2_PONAB      VAYVTAMSPQELLASNAVFGEKLVMAWIMPISVALSGVNGSLFTSS-------------RLFFAGAREGH
LAT2_MOUSE      IAYVTAMSPQELLASNAVFGEKLVMAWIMPISVALSGVNGSLFTSS-------------RLFFAGAREGH
LAT2_HUMAN      VAYVTAMSPQELLASNAVFGEKLVMAWIMPISVALSGVNGSLFTSS-------------RLFFAGAREGH
GABP_BACSU      -AIVVALLP---WNSANILESPFVAVLEHIGVPAAAQIMNFIVLTAVLSCLNSGLYTTSRMLYSLAERNE
POTE_ECOLI      NVIAGIVPNMELANSTAPFG--LAFAQM--FTPEVGKVIMALMVMSCCGSLLGWQFTIAQVFKSSSDEGY
POTE_ECOL6      NVIAGIVPNMELANSTAPFG--LAFAQM--FTPEVGKVIMALMVMSCCGSLLGWQFTIAQVFKSSSDEGY
LAT2_RABIT      VAYITAMSPQELLASNAVFGEKLVMAWIMPISVALSGVNGSLFTSS-------------RLFFAGAREGH
ANSP1_MYCTU     XXXXXXXPYTAYAGES----PFVTFFSKIGFHGA-GDLMNIVVLTAALSSLNAGLYSTGRVMHSIAMSGS
ANSP1_MYCBO     XXXXXXXPYTAYAGES----PFVTFFSKIGFHGA-GDLMNIVVLTAALSSLNAGLYSTGRVMHSIAMSGS
GABP_ECOLI      FVVV------ALIPWNM---PGLKAVGSYRSVLELLNIPHCVILLSVTSCLNSALYTASRMLYSLSRRGD
PUUP_ECOLI      FFMQL-----FFPDISRFKDPDAALPEIALYVGGKLFQSIFLCTTFVLASGLASHASVSRLLYVMGRDNV
DIP5_YEAST      FLLGMCVAPRLLSTKSAAASPFVVAIQNSGIEPHIFNACVLVFVFS---ACNSDLYVSSRNLYALAIDGK
YIFK_ECOLI      FVIVT-IFPWNEIGSN---GSPFVLTFXXXXXXXXXXXXNFVVLTAALSGCNSGMYSCGRMLYALAKNRQ
LYSP_ECOLI      LIISLIIDPSLLVKDISVSPFTLVFQHAGLLSAAA--VMNAVILTAVLSAGNSGMYASTRMLYTLACDGK
AROP_SHIFL      -AVLLSLMPWTRVTADT---SPFVLIFHELGDTFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGN
AROP_ECOL6      -AVLLSLMPWTRVTADT---SPFVLIFHELGDTFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGN
AROP_ECO57      -AVLLSLMPWTRVTADT---SPFVLIFHELGDTFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGN
AAA1_RAT        VAYFTAMSPQELLSSNAVFGEKLLFSWVMPVSVALS----------------------------------
AAA1_MOUSE      VAYFTAMSPQELLSSNAVFGEKLLFSWVMPVSVALS----------------------------------
POTE_HAEIN      NVIAGIVPNLELANSTAPFG--LAFAHM--FDETVGKVIMGLMVMSCFGSLLGWQFTIAQVFKSSAEEGY
YIFK_SALTY      FVIVT-IFPWNEIGSN---GSPFVLTFXXXXXXXXXXXXNFVVLTAALSGCNSGMYSCGRMLYALAKNRQ
YIFK_SALTI      FVIVT-IFPWNEIGSN---GSPFVLTFXXXXXXXXXXXXNFVVLTAALSGCNSGMYSCGRMLYALAKNRQ
YVBW_BACSU      FIIVSLIPWNQV---NSVPESPFVMVFKMVGIPGADHIMNAVILLAIISSMNSGLYGSSRILYTQASDGR
GAP1_YEAST      LMIGLLVNDKSLIGASSVDAAASPFVIAIKTHKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRF
CAN1_YEAST      LFIGLLVDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKL


                         .         .         .         +         .         .         .:280
query           IPSVFGKLGKNGAPIGGSXXXXXXXXXXXXXXXXXXXNSTLGELFPVTTLFTWFSTAAAFGLVFLMAITS
CYCA_ECOLI      APKAFAKLSKRAVPAKG-----------------------------------------------------
CYCA_ECO57      APKAFAKLSKRAVPAKG-----------------------------------------------------
YTNA_BACSU      APQAYGQLTKGGIP-----------GKXXXXXXXXXXXXXXXXXXXPAKVFTWVTSIATFGAIWTWAI--
YBXG_BACSU      APKFFKKISRNGVPLYGT----------------------------------------------------
CADB_ECOLI      FPKVYGEVDSNGIPKKG-----------------------------------------------------
CADB_ECOL6      FPKVYGEVDSNGIPKKG-----------------------------------------------------
CADB_ECO57      FPKVYGEVDSNGIPKKG-----------------------------------------------------
YBGF_BACSU      LHPTFAKLTSKGTP--------------------------------------------------------
MMUP_ECOLI      LPACFARVTKNGVPL-------------------------------------------------------
MEU22_SCHPO     APKIFNKTNKRGHPI-------------------------------------------------------
LAT2_RAT        LPSVLAMI--------------------------------------------------------------
LAT2_PONAB      LPSVLAMI--------------------------------------------------------------
LAT2_MOUSE      LPSVLAMI--------------------------------------------------------------
LAT2_HUMAN      LPSVLAMI--------------------------------------------------------------
GABP_BACSU      APRRFMKLSKKGVPV-------------------------------------------------------
POTE_ECOLI      FPKIFSRVTKVDAPVQG-----------------------------------------------------
POTE_ECOL6      FPKIFSRVTKVDAPVQG-----------------------------------------------------
LAT2_RABIT      LPSVLAMI--------------------------------------------------------------
ANSP1_MYCTU     APRFTARMSKSGVPYGG-----------------------------------------------------
ANSP1_MYCBO     APRFTARMSKSGVPYGG-----------------------------------------------------
GABP_ECOLI      APAVMGKINRSKTP--------------------------------------------------------
PUUP_ECOLI      FPEVFG----------------------------------------------------------------
DIP5_YEAST      APKIFAKTSRWGVP--------------------------------------------------------
YIFK_ECOLI      LPAAMAKVSRHGVPVAG-----------------------------------------------------
LYSP_ECOLI      APRIFAKLSRGGVP--------------------------------------------------------
AROP_SHIFL      APKALASVDKRGVPV----------------------NTILALVTALCVLINYLAPESAFGLLMAL-VVS
AROP_ECOL6      APKALASVDKRGVPV----------------------NTILALVTALCVLINYLAPESAFGLLMAL-VVS
AROP_ECO57      APKALASVDKRGVPV----------------------NTILALVTALCVLINYLAPESAFGLLMAL-VVS
AAA1_RAT        ----------------------------------------------------------------------
AAA1_MOUSE      ----------------------------------------------------------------------
POTE_HAEIN      FPAFFKKITSKDAPVVG-----------------------------------------------------
YIFK_SALTY      LPAAVAKVSRHGVPVAG-----------------------------------------------------
YIFK_SALTI      LPAAVAKVSRHGVPVAG-----------------------------------------------------
YVBW_BACSU      LPKVFSKLSSKNVPM-------------------------------------------------------
GAP1_YEAST      LPEIFSYVDRKGRPLVG-----------------------------------------------------
CAN1_YEAST      APKFLSRTTKGGVP--------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VAVLFWFRRNHHGYGVFTRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CYCA_ECOLI      ----------------------------------------------------------------------
CYCA_ECO57      ----------------------------------------------------------------------
YTNA_BACSU      ----------------------------------------------------------------------
YBXG_BACSU      ----------------------------------------------------------------------
CADB_ECOLI      ----------------------------------------------------------------------
CADB_ECOL6      ----------------------------------------------------------------------
CADB_ECO57      ----------------------------------------------------------------------
YBGF_BACSU      ----------------------------------------------------------------------
MMUP_ECOLI      ----------------------------------------------------------------------
MEU22_SCHPO     ----------------------------------------------------------------------
LAT2_RAT        ----------------------------------------------------------------------
LAT2_PONAB      ----------------------------------------------------------------------
LAT2_MOUSE      ----------------------------------------------------------------------
LAT2_HUMAN      ----------------------------------------------------------------------
GABP_BACSU      ----------------------------------------------------------------------
POTE_ECOLI      ----------------------------------------------------------------------
POTE_ECOL6      ----------------------------------------------------------------------
LAT2_RABIT      ----------------------------------------------------------------------
ANSP1_MYCTU     ----------------------------------------------------------------------
ANSP1_MYCBO     ----------------------------------------------------------------------
GABP_ECOLI      ----------------------------------------------------------------------
PUUP_ECOLI      ----------------------------------------------------------------------
DIP5_YEAST      ----------------------------------------------------------------------
YIFK_ECOLI      ----------------------------------------------------------------------
LYSP_ECOLI      ----------------------------------------------------------------------
AROP_SHIFL      ALVINWFRRAKQEQGVVTR---------------------------------------------------
AROP_ECOL6      ALVINWFRRAKQEQGVVTR---------------------------------------------------
AROP_ECO57      ALVINWFRRAKQEQGVVTR---------------------------------------------------
AAA1_RAT        ----------------------------------------------------------------------
AAA1_MOUSE      ----------------------------------------------------------------------
POTE_HAEIN      ----------------------------------------------------------------------
YIFK_SALTY      ----------------------------------------------------------------------
YIFK_SALTI      ----------------------------------------------------------------------
YVBW_BACSU      ----------------------------------------------------------------------
GAP1_YEAST      ----------------------------------------------------------------------
CAN1_YEAST      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CYCA_ECOLI      ------------------------------------------------
CYCA_ECO57      ------------------------------------------------
YTNA_BACSU      ------------------------------------------------
YBXG_BACSU      ------------------------------------------------
CADB_ECOLI      ------------------------------------------------
CADB_ECOL6      ------------------------------------------------
CADB_ECO57      ------------------------------------------------
YBGF_BACSU      ------------------------------------------------
MMUP_ECOLI      ------------------------------------------------
MEU22_SCHPO     ------------------------------------------------
LAT2_RAT        ------------------------------------------------
LAT2_PONAB      ------------------------------------------------
LAT2_MOUSE      ------------------------------------------------
LAT2_HUMAN      ------------------------------------------------
GABP_BACSU      ------------------------------------------------
POTE_ECOLI      ------------------------------------------------
POTE_ECOL6      ------------------------------------------------
LAT2_RABIT      ------------------------------------------------
ANSP1_MYCTU     ------------------------------------------------
ANSP1_MYCBO     ------------------------------------------------
GABP_ECOLI      ------------------------------------------------
PUUP_ECOLI      ------------------------------------------------
DIP5_YEAST      ------------------------------------------------
YIFK_ECOLI      ------------------------------------------------
LYSP_ECOLI      ------------------------------------------------
AROP_SHIFL      ------------------------------------------------
AROP_ECOL6      ------------------------------------------------
AROP_ECO57      ------------------------------------------------
AAA1_RAT        ------------------------------------------------
AAA1_MOUSE      ------------------------------------------------
POTE_HAEIN      ------------------------------------------------
YIFK_SALTY      ------------------------------------------------
YIFK_SALTI      ------------------------------------------------
YVBW_BACSU      ------------------------------------------------
GAP1_YEAST      ------------------------------------------------
CAN1_YEAST      ------------------------------------------------