[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF53009.1

[Show Plain Result]


## Summary of Sequence Search
    1::190
   14::182     2e-67  80%  182 aa  PPIA_MYCTU RecName: Full=Probable peptidyl-prolyl cis-trans
   14::182     2e-67  80%  182 aa  PPIA_MYCBO RecName: Full=Probable peptidyl-prolyl cis-trans
   13::182     3e-67  78%  182 aa  PPIA_MYCLE RecName: Full=Probable peptidyl-prolyl cis-trans
    7::172     5e-47  67%  175 aa  PPIB_STRCH RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   13::159     1e-29  56%  174 aa  PPIL1_CRYNE RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  491::643     5e-29  48%  644 aa  PPWD1_BOVIN RecName: Full=Peptidylprolyl isomerase domain and WD
  493::645     2e-28  48%  646 aa  PPWD1_PONAB RecName: Full=Peptidylprolyl isomerase domain and WD
  493::645     2e-28  48%  646 aa  PPWD1_HUMAN RecName: Full=Peptidylprolyl isomerase domain and WD
   33::182     3e-28  56%  215 aa  PPIB_TREPA RecName: Full=Probable peptidyl-prolyl cis-trans
  493::645     5e-28  48%  646 aa  PPWD1_MOUSE RecName: Full=Peptidylprolyl isomerase domain and WD
  292::468     2e-27  58%  470 aa  BPPI_STRP6 RecName: Full=Putative bifunctional
  478::629     6e-27  45%  630 aa  CYP15_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase
   25::180     8e-27  53%  372 aa  PPID_GIBZE RecName: Full=Peptidyl-prolyl cis-trans isomerase D;    
    7::155     2e-26  52%  163 aa  PPIL1_NEUCR RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   16::159     2e-26  54%  166 aa  PPIL1_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   16::159     2e-26  54%  166 aa  PPIL1_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   16::159     2e-26  54%  166 aa  PPIL1_BOVIN RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
    6::150     2e-26  44%  161 aa  PPIL1_ASPFU RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   20::171     1e-25  50%  372 aa  PPID_KLULA RecName: Full=Peptidyl-prolyl cis-trans isomerase D;    
  457::607     2e-25  51%  610 aa  CYP9_SCHPO RecName: Full=Peptidyl-prolyl cis-trans isomerase 9;    
   21::175     2e-25  43%  372 aa  PPID_EMENI RecName: Full=Peptidyl-prolyl cis-trans isomerase D;    
    2::145     7e-25  55%  165 aa  PPIL1_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
    9::150     7e-25  42%  162 aa  PPIL1_EMENI RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   18::165     7e-25  53%  364 aa  PPID_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase D;    
    9::150     9e-25  42%  161 aa  PPIL1_ASPOR RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   26::180     2e-24  51%  375 aa  PPID_NEUCR RecName: Full=41 kDa peptidyl-prolyl cis-trans
    9::150     3e-24  42%  162 aa  PPIL1_ASPNG RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   18::169     4e-24  52%  375 aa  PPID_CRYNE RecName: Full=Peptidyl-prolyl cis-trans isomerase D;    
   52::199     5e-24  47%  212 aa  PPIC_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase C;    
    1::169     6e-24  49%  174 aa  PPID_DICDI RecName: Full=Peptidyl-prolyl cis-trans isomerase D,
   15::170     6e-24  49%  371 aa  PPID_CANGA RecName: Full=Peptidyl-prolyl cis-trans isomerase D;    
   21::176     6e-24  49%  843 aa  CYP1_BRUMA RecName: Full=Peptidyl-prolyl cis-trans isomerase 1;    
   19::162     8e-24  52%  356 aa  PPID_SCHPO RecName: Full=40 kDa peptidyl-prolyl cis-trans
   22::180     8e-24  50%  377 aa  PPID_ASPFU RecName: Full=Peptidyl-prolyl cis-trans isomerase D;    
   33::196     8e-24  51%  212 aa  PPIB_ASPNG RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
    2::149     1e-23  54%  155 aa  PPIL1_SCHPO RecName: Full=Peptidyl-prolyl cis-trans isomerase ppi1;
   34::191     1e-23  52%  209 aa  PPIB_ASPFU RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   16::166     1e-23  50%  470 aa  SDC10_DANRE RecName: Full=Peptidyl-prolyl cis-trans isomerase
   19::167     2e-23  52%  371 aa  PPID_AMAMU RecName: Full=Peptidyl-prolyl cis-trans isomerase D;    
   16::166     4e-23  51%  473 aa  SDC10_BOVIN RecName: Full=Peptidyl-prolyl cis-trans isomerase
  314::469     5e-23  52%  573 aa  PPIL2_CRYNE RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   18::166     5e-23  51%  367 aa  PPID_YARLI RecName: Full=Peptidyl-prolyl cis-trans isomerase D;    
   16::166     7e-23  51%  468 aa  SDC10_RAT RecName: Full=Peptidyl-prolyl cis-trans isomerase
   16::166     7e-23  51%  469 aa  SDC10_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase
    5::162     7e-23  41%  167 aa  PPIL3_GIBZE RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
    2::155     7e-23  45%  162 aa  PPIL1_GIBZE RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   32::174     7e-23  42%  371 aa  PPID_ASPOR RecName: Full=Peptidyl-prolyl cis-trans isomerase D;    
   48::194     9e-23  44%  213 aa  PPIB_SCHMA RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   52::199     2e-22  54%  212 aa  PPIC_BOVIN RecName: Full=Peptidyl-prolyl cis-trans isomerase C;    
   30::183     2e-22  43%  183 aa  PPIH_EMENI RecName: Full=Peptidyl-prolyl cis-trans isomerase H;    
   19::173     2e-22  50%  369 aa  PPID_ASHGO RecName: Full=Peptidyl-prolyl cis-trans isomerase D;    
   46::192     2e-22  44%  213 aa  PPIB_SCHJA RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   28::175     3e-22  45%  181 aa  PPIH_ASPFU RecName: Full=Peptidyl-prolyl cis-trans isomerase H;    
   32::195     3e-22  51%  214 aa  PPIB_EMENI RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
    1::150     3e-22  44%  156 aa  CYPE_DICDI RecName: Full=Peptidyl-prolyl cis-trans isomerase cypE; 
    5::155     3e-22  49%  167 aa  PPIL3_CRYNE RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   15::147     3e-22  53%  162 aa  PPIA_HELPJ RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
   52::187     4e-22  56%  212 aa  PPIC_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase C;    
   49::190     4e-22  53%  207 aa  PPIB_GIBZE RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   16::166     6e-22  47%  473 aa  SDC10_PONAB RecName: Full=Peptidyl-prolyl cis-trans isomerase
   16::166     6e-22  47%  473 aa  SDC10_MACFA RecName: Full=Peptidyl-prolyl cis-trans isomerase
   21::171     6e-22  42%  370 aa  PPID_DEBHA RecName: Full=Peptidyl-prolyl cis-trans isomerase D;    
   16::166     7e-22  47%  472 aa  SDC10_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase
    5::158     7e-22  42%  168 aa  PPIL3_USTMA RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
    5::162     7e-22  39%  167 aa  PPIL3_NEUCR RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   30::206     7e-22  45%  231 aa  PPIB_CRYNE RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   16::166     1e-21  49%  477 aa  SDC10_XENLA RecName: Full=Peptidyl-prolyl cis-trans isomerase
   17::158     1e-21  49%  371 aa  PPID_YEAST RecName: Full=Peptidyl-prolyl cis-trans isomerase CPR6; 
   17::162     1e-21  50%  165 aa  PPIA_STRCH RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
    4::129     2e-21  57%  145 aa  PPI_SYNE7 RecName: Full=Peptidyl-prolyl cis-trans isomerase;       
   41::182     2e-21  53%  201 aa  PPIB_SCHPO RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   16::163     2e-21  43%  169 aa  CYPX_USEUD RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
   44::185     3e-21  55%  203 aa  PPIB_ORPSP RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   16::148     3e-21  52%  163 aa  PPIA_HELPY RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
   19::195     3e-21  45%  197 aa  PPI1_STAES RecName: Full=Putative peptidyl-prolyl cis-trans
   19::195     3e-21  45%  197 aa  PPI1_STAEQ RecName: Full=Putative peptidyl-prolyl cis-trans
   65::204     3e-21  51%  223 aa  CYPH_NEUCR RecName: Full=Peptidyl-prolyl cis-trans isomerase,
   26::181     4e-21  50%  192 aa  PPIB_ASPOR RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   19::195     4e-21  45%  197 aa  PPI1_STAAW RecName: Full=Putative peptidyl-prolyl cis-trans
   19::195     4e-21  45%  197 aa  PPI1_STAAS RecName: Full=Putative peptidyl-prolyl cis-trans
   19::195     4e-21  45%  197 aa  PPI1_STAAR RecName: Full=Putative peptidyl-prolyl cis-trans
   19::195     4e-21  45%  197 aa  PPI1_STAAN RecName: Full=Putative peptidyl-prolyl cis-trans
   19::195     4e-21  45%  197 aa  PPI1_STAAM RecName: Full=Putative peptidyl-prolyl cis-trans
   19::195     4e-21  45%  197 aa  PPI1_STAAC RecName: Full=Putative peptidyl-prolyl cis-trans
   19::195     4e-21  45%  197 aa  PPI1_STAAB RecName: Full=Putative peptidyl-prolyl cis-trans
   19::195     4e-21  45%  197 aa  PPI1_STAA8 RecName: Full=Putative peptidyl-prolyl cis-trans
   19::195     4e-21  45%  197 aa  PPI1_STAA3 RecName: Full=Putative peptidyl-prolyl cis-trans
   29::182     4e-21  41%  182 aa  CYPC_YEAST RecName: Full=Peptidyl-prolyl cis-trans isomerase C,
   23::170     4e-21  52%  466 aa  CYP8_CAEEL RecName: Full=Peptidyl-prolyl cis-trans isomerase 8;    
   17::166     5e-21  38%  369 aa  PPID_CANAL RecName: Full=Peptidyl-prolyl cis-trans isomerase D;    
   49::190     5e-21  53%  285 aa  PPIB_NEUCR RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   96::229     5e-21  55%  248 aa  CYPB_VICFA RecName: Full=Peptidyl-prolyl cis-trans isomerase,
   16::132     6e-21  58%  162 aa  PPIA_CANAL RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
  282::428     8e-21  42%  516 aa  PPIL2_SCHPO RecName: Full=Peptidyl-prolyl cis-trans isomerase cyp8;
   18::167     8e-21  40%  338 aa  CYP11_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase
    5::162     1e-20  40%  170 aa  PPIL3_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
    5::156     1e-20  40%  161 aa  PPIL3_CHICK RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   20::195     1e-20  45%  198 aa  PPI1_STAHJ RecName: Full=Putative peptidyl-prolyl cis-trans
  107::248     1e-20  45%  259 aa  CP20B_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase
    5::155     1e-20  38%  161 aa  PPIL3_DICDI RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   28::181     1e-20  41%  181 aa  PPIH_ASPOR RecName: Full=Peptidyl-prolyl cis-trans isomerase H;    
   40::181     1e-20  55%  201 aa  CYP6_CAEEL RecName: Full=Peptidyl-prolyl cis-trans isomerase 6;    
   16::167     2e-20  39%  491 aa  CWC27_CRYNE RecName: Full=Peptidyl-prolyl isomerase CWC27;       
  284::438     3e-20  45%  533 aa  PPIL2_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   46::193     3e-20  51%  228 aa  PPIB_YARLI RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   33::190     3e-20  50%  226 aa  PPIB_ARTBE RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   18::167     3e-20  41%  361 aa  CYP40_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase
   13::166     3e-20  46%  524 aa  CWC27_RHIOR RecName: Full=Peptidyl-prolyl isomerase cwc27;       
    5::156     4e-20  38%  161 aa  PPIL3_RAT RecName: Full=Peptidyl-prolyl cis-trans isomerase-like 3;
    5::156     4e-20  38%  161 aa  PPIL3_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  284::433     4e-20  47%  520 aa  PPIL2_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
    5::156     5e-20  38%  161 aa  PPIL3_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   16::132     5e-20  57%  162 aa  CYPH_SCHPO RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
  261::428     7e-20  43%  521 aa  PPIL2_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  322::464     7e-20  50%  588 aa  PPIL2_GIBZE RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   58::199     7e-20  51%  216 aa  PPIB_RAT RecName: Full=Peptidyl-prolyl cis-trans isomerase B;      
   48::189     7e-20  44%  209 aa  PPIB1_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase B1;  
   58::205     9e-20  49%  216 aa  PPIB_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   48::189     9e-20  45%  209 aa  PPIB2_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase B2;  
  109::244     9e-20  51%  260 aa  CP20C_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase
   26::162     1e-19  44%  182 aa  PPIH_GIBZE RecName: Full=Peptidyl-prolyl cis-trans isomerase H;    
   19::195     1e-19  45%  197 aa  PPI1_STAS1 RecName: Full=Putative peptidyl-prolyl cis-trans
   19::170     1e-19  47%  309 aa  CYP9_CAEEL RecName: Full=Peptidyl-prolyl cis-trans isomerase 9;    
   58::199     2e-19  50%  216 aa  PPIB_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   32::196     2e-19  40%  225 aa  CYPD_YEAST RecName: Full=Peptidyl-prolyl cis-trans isomerase D;    
   43::184     2e-19  53%  204 aa  CYP5_CAEEL RecName: Full=Peptidyl-prolyl cis-trans isomerase 5;    
   18::132     2e-19  58%  162 aa  PPIA_PARPR RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
    1::125     3e-19  43%  156 aa  PPIH_USTMA RecName: Full=Peptidyl-prolyl cis-trans isomerase H;    
   15::173     3e-19  36%  752 aa  PPIG_RAT RecName: Full=Peptidyl-prolyl cis-trans isomerase G;      
   15::173     3e-19  36%  752 aa  PPIG_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase G;    
   15::173     3e-19  36%  754 aa  PPIG_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase G;    
   30::152     3e-19  43%  370 aa  PPID_HUMAN RecName: Full=40 kDa peptidyl-prolyl cis-trans
   58::199     3e-19  51%  216 aa  PPIB_BOVIN RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   14::152     3e-19  50%  176 aa  CYP6_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase cyp6; 
   30::152     5e-19  42%  370 aa  PPID_BOVIN RecName: Full=40 kDa peptidyl-prolyl cis-trans
   17::140     5e-19  53%  171 aa  PPI2_SYNY3 RecName: Full=Peptidyl-prolyl cis-trans isomerase
   18::154     6e-19  52%  172 aa  CYPH_MAIZE RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
   21::174     8e-19  38%  176 aa  CYP5_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase cyp5; 
   36::183     8e-19  41%  192 aa  CYP1_CAEEL RecName: Full=Peptidyl-prolyl cis-trans isomerase 1;    
  334::483     1e-18  47%  597 aa  PPIL2_NEUCR RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   25::187     1e-18  38%  237 aa  CYPR_DROME RecName: Full=Peptidyl-prolyl cis-trans isomerase,
   24::182     1e-18  40%  234 aa  CYPR_CALVI RecName: Full=Peptidyl-prolyl cis-trans isomerase,
    5::155     1e-18  39%  161 aa  CYP10_CAEEL RecName: Full=Peptidyl-prolyl cis-trans isomerase 10;  
   16::162     2e-18  47%  162 aa  CYPH_YEAST RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
   30::152     2e-18  40%  370 aa  PPID_RAT RecName: Full=40 kDa peptidyl-prolyl cis-trans isomerase; 
   20::142     2e-18  51%  313 aa  CYP9_CAEBR RecName: Full=Peptidyl-prolyl cis-trans isomerase 9;    
   30::152     3e-18  40%  370 aa  PPID_MOUSE RecName: Full=40 kDa peptidyl-prolyl cis-trans
  302::422     4e-18  45%  570 aa  PPIL2_ASPOR RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  315::435     4e-18  53%  579 aa  PPIL2_ASPFU RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   19::167     4e-18  39%  173 aa  PPIH_SCHPO RecName: Full=Peptidyl-prolyl cis-trans isomerase cyp3; 
   33::193     4e-18  48%  205 aa  CYPB_YEAST RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   21::172     5e-18  39% 1453 aa  NKTR_MOUSE RecName: Full=NK-tumor recognition protein;AltName:
   21::172     5e-18  39% 1462 aa  NKTR_HUMAN RecName: Full=NK-tumor recognition protein;AltName:
   12::166     5e-18  47%  463 aa  CYP7_SCHPO RecName: Full=Peptidylprolyl isomerase cyp7;       
   18::166     5e-18  46%  176 aa  CP19C_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase
  290::451     1e-17  44%  582 aa  PPIL2_USTMA RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   37::156     1e-17  45%  178 aa  PPIA_NEOCA RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
   15::130     1e-17  55%  161 aa  PPIA2_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase A2;  
   18::141     1e-17  52%  171 aa  CYPH_SOLLC RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
   12::193     1e-17  43%  548 aa  CWC27_GIBZE RecName: Full=Peptidyl-prolyl isomerase CWC27;       
   14::121     2e-17  59%  143 aa  PPIB_BACSU RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   18::142     2e-17  39%  165 aa  PPIA_PONPY RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   18::142     2e-17  39%  165 aa  PPIA_PAPAN RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   18::142     2e-17  39%  165 aa  PPIA_PANTR RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   18::142     2e-17  39%  165 aa  PPIA_PANPA RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   18::142     2e-17  39%  165 aa  PPIA_MACMU RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   18::142     2e-17  39%  165 aa  PPIA_HYLSY RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   18::142     2e-17  39%  165 aa  PPIA_HYLLE RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   18::142     2e-17  39%  165 aa  PPIA_HYLLA RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   18::142     2e-17  39%  165 aa  PPIA_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   18::142     2e-17  39%  165 aa  PPIA_GORGO RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   18::142     2e-17  40%  164 aa  PPIA_FELCA RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   18::142     2e-17  39%  165 aa  PPIA_CERAE RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
  313::433     2e-17  53%  580 aa  PPIL2_EMENI RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   18::142     2e-17  39%  164 aa  PPIA_SAGOE RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   18::142     2e-17  39%  164 aa  PPIA_RABIT RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   18::142     2e-17  39%  164 aa  PPIA_PIG RecName: Full=Peptidyl-prolyl cis-trans isomerase A;      
   18::142     2e-17  39%  164 aa  PPIA_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   18::142     2e-17  39%  164 aa  PPIA_CRIGR RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   18::142     2e-17  39%  164 aa  PPIA_BOVIN RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   18::142     2e-17  39%  164 aa  PPIA_AOTTR RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   12::193     3e-17  37%  541 aa  CWC27_NEUCR RecName: Full=Peptidyl-prolyl isomerase cwc-27;        
   18::142     4e-17  39%  164 aa  PPIA_RAT RecName: Full=Peptidyl-prolyl cis-trans isomerase A;      
    1::127     4e-17  53%  150 aa  CYPH_ALLCE RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
   49::190     9e-17  49%  207 aa  PPIB_CHICK RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   17::156     9e-17  48%  161 aa  PPIA_SCHMA RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
   18::166     9e-17  49%  172 aa  CYPH_CATRO RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
   18::173     1e-16  42%  173 aa  CYP3_CAEEL RecName: Full=Peptidyl-prolyl cis-trans isomerase 3;    
   16::146     2e-16  50%  163 aa  CYPH_UROFA RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
   49::202     2e-16  34%  204 aa  CP20A_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase
   46::199     2e-16  37%  201 aa  CP19D_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase
   26::141     3e-16  46%  182 aa  PPIH_NEUCR RecName: Full=Peptidyl-prolyl cis-trans isomerase H;    
   18::155     3e-16  39%  172 aa  CP18D_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase
   34::187     4e-16  35%  398 aa  PPID_USTMA RecName: Full=Peptidyl-prolyl cis-trans isomerase D;    
   81::197     8e-16  40%  227 aa  PPIA_DROME RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
   18::142     8e-16  39%  164 aa  PPAL4_HUMAN RecName: Full=Peptidylprolyl cis-trans isomerase A-like
   18::165     8e-16  45%  172 aa  CP18C_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase
   17::147     1e-15  49%  162 aa  PPIA_ECHGR RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
   12::184     1e-15  37%  559 aa  CWC27_ASPFU RecName: Full=Peptidyl-prolyl isomerase cwc27;       
   16::133     1e-15  41%  164 aa  PPIA_HEMPU RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
   19::166     1e-15  46%  174 aa  CP19B_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase
   18::134     2e-15  41%  164 aa  PPIA_BLAGE RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
   21::146     2e-15  41%  172 aa  CYPH_ENCCU RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
    5::163     2e-15  41%  164 aa  PPIB_ECOLI RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
   18::142     2e-15  39%  164 aa  PAL4B_HUMAN RecName: Full=Peptidylprolyl cis-trans isomerase A-like
   18::141     2e-15  49%  171 aa  CYP7_CAEEL RecName: Full=Peptidyl-prolyl cis-trans isomerase 7;    
   25::171     3e-15  36%  177 aa  PPIH_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase H;    
   25::171     3e-15  36%  177 aa  PPIH_BOVIN RecName: Full=Peptidyl-prolyl cis-trans isomerase H;    
   11::141     3e-15  39%  172 aa  CYPH_LUPLU RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
  278::404     3e-15  48%  523 aa  CYP4_CAEEL RecName: Full=Peptidyl-prolyl cis-trans isomerase 4;    
   31::177     3e-15  36%  183 aa  CYP11_CAEEL RecName: Full=Peptidyl-prolyl cis-trans isomerase 11;  
   25::146     7e-15  38%  188 aa  PPIH_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase H;    
   24::166     7e-15  35%  179 aa  PPIH_CRYNE RecName: Full=Peptidyl-prolyl cis-trans isomerase H;    
 2907::3023    9e-15  41% 3053 aa  RBP2_MOUSE RecName: Full=E3 SUMO-protein ligase RanBP2;AltName:
 3078::3194    1e-14  42% 3224 aa  RBP2_HUMAN RecName: Full=E3 SUMO-protein ligase RanBP2;AltName:
   61::177     1e-14  39%  209 aa  PPIF_BOVIN RecName: Full=Peptidyl-prolyl cis-trans isomerase,
   19::166     2e-14  46%  173 aa  CP19A_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase
  939::1055    3e-14  41% 1085 aa  RBP2_BOVIN RecName: Full=E3 SUMO-protein ligase RanBP2;AltName:
   28::151     3e-14  47%  179 aa  PPIE_SCHJA RecName: Full=Peptidyl-prolyl cis-trans isomerase E;    
   18::134     3e-14  39%  164 aa  PPIA1_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase A1;  
   59::175     4e-14  39%  206 aa  PPIF_RAT RecName: Full=Peptidyl-prolyl cis-trans isomerase,
   59::175     4e-14  39%  206 aa  PPIF_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase,
   60::176     4e-14  39%  207 aa  PPIF_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase,
   18::155     4e-14  47%  171 aa  CYPH_BRANA RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
   12::184     1e-13  35%  558 aa  CWC27_EMENI RecName: Full=Peptidyl-prolyl isomerase cwc27;       
  350::491     1e-13  43%  595 aa  PPIL2_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  126::245     2e-13  48%  273 aa  PPIE_SCHMA RecName: Full=Peptidyl-prolyl cis-trans isomerase E;    
   17::133     2e-13  42%  485 aa  CWC27_USTMA RecName: Full=Peptidyl-prolyl isomerase CWC27;       
  184::270     5e-13  42%  301 aa  PPIE_BOVIN RecName: Full=Peptidyl-prolyl cis-trans isomerase E;    
    5::160     6e-13  44%  211 aa  PPIL3_EMENI RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   25::169     6e-13  35%  178 aa  PPIH_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase H;    
  184::270     1e-12  42%  301 aa  PPIE_PONAB RecName: Full=Peptidyl-prolyl cis-trans isomerase E;    
  184::270     1e-12  42%  301 aa  PPIE_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase E;    
  184::270     1e-12  42%  301 aa  PPIE_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase E;    
   19::191     1e-12  41%  393 aa  CYP7_YEAST RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP7; 
  165::283     1e-12  50%  315 aa  PPIE_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase E;    
    7::181     1e-12  38%  188 aa  PPIA_ACIAD RecName: Full=Peptidyl-prolyl cis-trans isomerase;      
   67::214     1e-12  34%  318 aa  CYPR_YEAST RecName: Full=Peptidyl-prolyl cis-trans isomerase CPR4; 
    5::161     3e-12  42%  212 aa  PPIL3_ASPFU RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
    2::164     3e-12  40%  166 aa  PPIB_STRAT RecName: Full=Peptidyl-prolyl cis-trans isomerase cyp18;
    4::168     3e-12  39%  169 aa  PPIB_HAEIN RecName: Full=Peptidyl-prolyl cis-trans isomerase B;    
  153::267     9e-12  46%  300 aa  PPIE_DROME RecName: Full=Peptidyl-prolyl cis-trans isomerase E;    
    2::154     6e-11  37%  446 aa  PPIL4_RHIOR RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  147::305     1e-10  49%  308 aa  PPIB_MYCTU RecName: Full=Probable peptidyl-prolyl cis-trans
  152::299     3e-10  28%  307 aa  PPIL6_BOVIN RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  156::292     7e-10  28%  311 aa  PPIL6_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
  127::294     7e-10  38%  295 aa  PPIB_MYCLE RecName: Full=Probable peptidyl-prolyl cis-trans
   30::185     2e-09  38%  187 aa  PPIA_PSEAE RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   18::171     6e-09  38%  172 aa  CYP2_CAEEL RecName: Full=Peptidyl-prolyl cis-trans isomerase 2;    
    4::146     9e-09  33%  492 aa  PPIL4_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
    1::134     9e-09  29%  327 aa  CWC27_DEBHA RecName: Full=Peptidyl-prolyl isomerase CWC27;       
    4::146     1e-08  32%  492 aa  PPIL4_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   80::226     2e-08  29%  230 aa  CP21C_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase
   31::187     4e-08  32%  190 aa  PPIA_DICD3 RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   32::188     1e-07  33%  190 aa  PPIA_SALTY RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   32::188     1e-07  33%  190 aa  PPIA_ECOLI RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   32::188     1e-07  33%  190 aa  PPIA_ECOL6 RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
   32::188     1e-07  33%  190 aa  PPIA_ECO57 RecName: Full=Peptidyl-prolyl cis-trans isomerase A;    
    2::169     3e-07  32%  504 aa  PPIL4_CRYNE RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
    2::161     2e-06  34%  605 aa  PPIL4_GIBZE RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   66::117     2e-06  52%  246 aa  PPI1_SYNY3 RecName: Full=Probable peptidyl-prolyl cis-trans
    2::154     2e-06  35%  494 aa  PPIL4_NEUCR RecName: Full=Peptidyl-prolyl cis-trans isomerase-like
   32::159     2e-06  37%  196 aa  PPI1_BRUSU RecName: Full=Probable peptidyl-prolyl cis-trans
   32::159     2e-06  37%  196 aa  PPI1_BRUME RecName: Full=Probable peptidyl-prolyl cis-trans
   32::159     3e-06  36%  196 aa  PPI1_BRUAB RecName: Full=Probable peptidyl-prolyl cis-trans
   32::159     3e-06  36%  196 aa  PPI1_BRUA2 RecName: Full=Probable peptidyl-prolyl cis-trans
    6::160     6e-06  28%  356 aa  CWC27_YARLI RecName: Full=Peptidyl-prolyl isomerase CWC27;       
   10::120     2e-05  33%  301 aa  CWC27_YEAST RecName: Full=Peptidyl-prolyl isomerase CWC27;       
   69::210     3e-04  29%  308 aa  CYP8_YEAST RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP8; 
    1::190

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxHVVGISLDVVMMGVMTSKTATAILHTNRGDITIDLFGNHAPETVANFVGLAQGTKEYQAQNAQGDSEG
PPIA_MYCTU      --------------------TATATLHTNRGDIKIALFGNHAPKTVANFVGLAQGTKDYSTQNASGGPSG
PPIA_MYCBO      --------------------TATATLHTNRGDIKIALFGNHAPKTVANFVGLAQGTKDYSTQNASGGPSG
PPIA_MYCLE      -------------------QNATATLHTNRGDIKVALFGNHVPKTVANFVGLAQGTKEYSTQNASGGPSG
PPIB_STRCH      -----------------------ATLKTNRGDIEIRLLPNHAPKTVRNFVELATGQREWVNPETGEKSTD
PPIL1_CRYNE     ---------------------------TSVGSFTVELYTAHAPKTCNNFAKLA---------------ER
PPWD1_BOVIN     ----------------------SAIIHTSMGDIHIKLFPVECPKTVENFCV---------------HSRN
PPWD1_PONAB     ----------------------SAIIHTSMGDIHTKLFPVECPKTVENFCV---------------HSRN
PPWD1_HUMAN     ----------------------SAIIHTSMGDIHTKLFPVECPKTVENFCV---------------HSRN
PPIB_TREPA      --------------GLAVADGIYAVMETNRGTIVLSLFFEKAPLTVCNFVGLAEGTLAVCKGR-------
PPWD1_MOUSE     ----------------------SAIVHTSMGDIHIKLFPVECPKTVENFCV---------------HSRN
BPPI_STRP6      -------------------------IKTNHGDMTLVLFPDHAPKTVANFLGLAK--------------EG
CYP15_RHIOR     ----------------------SAIIRTTSGDIHMRLFPDAAPKAVENFTTHAKNG--------------
PPID_GIBZE      ------------------------------GRITMELYADLVPKTADNFRSLCTGEKGI------GKSGK
PPIL1_NEUCR     -------------------------VETTMGTFTLELYTNHAPKTCKNFATLA---------------DR
PPIL1_MOUSE     -------------------------LETSMGVIVLELYWKHAPKTCKNFAELARRG--------------
PPIL1_HUMAN     -------------------------LETSMGIIVLELYWKHAPKTCKNFAELARRG--------------
PPIL1_BOVIN     -------------------------LETSMGIIVLELYWKHAPKTCKNFAELARRG--------------
PPIL1_ASPFU     ------------------------VFDTSMGSFTVELYNEHAPKTCRNFATLAQRG--------------
PPID_KLULA      ------------------------------GRIVFELYSDVVPKTAENFLKLCEGNSGF----AKSKPDI
CYP9_SCHPO      -----------------------AIIHTTQGDISIKLYPEEAPKAVQNFTTHA---------------EN
PPID_EMENI      ------------------------------GRIAFELFNDVVPKTAENFRALCTGEK------GMGKQGK
PPIL1_RHIOR     ------------------SEREEVILDTSMGSIHIELYWDHAPRTCKNFYELAKRG--------------
PPIL1_EMENI     ---------------------------TSMGSFTVELYNSHAPKTCKNFATLAQRG--------------
PPID_RHIOR      ------------------------------GRIVFELFKDIVPKTAENFRALCTGEK------GEGKSGK
PPIL1_ASPOR     ---------------------------TSMGSFTVELYNSHAPKTCKNFATLAQRG--------------
PPID_NEUCR      ------------------------------GRIVFELYNDIVPKTAENFRALCTGEK------GVGKLGK
PPIL1_ASPNG     ---------------------------TSMGSFTVELYNAHAPKTCKNFATLAQRG--------------
PPID_CRYNE      ------------------------------GRLTFELFDDVVPKTANNFKHLCIGDKTNEAGVKLA----
PPIC_MOUSE      ------------------------------GRIVIGLFGNVVPKTVENFVALATGEKGYG----------
PPID_DICDI      ------------MTGIIRNKVFFQIKQGNTGRVVFELYNDIVPKTAENFRALCTGEKGI------GKSGK
PPID_CANGA      ---------------------------TPKGRIVFELYKDVVPKTAENFLKLCEG----KSGMAKSKPDV
CYP1_BRUMA      ------------------------------GRIVMELYNDIAPRTCNNFLMLCTG----MAGTGKISGKP
PPID_SCHPO      --------------------------------IYFELFDNVVPKTVKNFASLCNGFEK--------DGRC
PPID_ASPFU      ------------------------------GRIALELFNDVVPKTAENFRALCTGEK------GVGKQRK
PPIB_ASPNG      ----------------ITSKVFFDIEHGDKGRVVLGLYGKTVPKTAENFRALATGEKGFG----------
PPIL1_SCHPO     ---------------------ANVELQTSLGKILIELYTEHAPKTCQNFYTLAK--------------EG
PPIB_ASPFU      ----------------ITSKVFFDIEHGDKGRIVLGLYGKTVPKTAENFRALATGEKGFG----------
SDC10_DANRE     ------------------------LLKTSAGDIDIELWSKETPKACRNFVQLCM--------------EG
PPID_AMAMU      ------------------------------GRVAFRLYSDLVPKTAENFRALCTGEK------GLGQSGK
SDC10_BOVIN     ------------------------LLKTTAGDIDIELWSKEAPKACRNFIQLCLEA--------------
PPIL2_CRYNE     ---------------------AYATITTNFGPLNVELHGDRAPKTVYNFVQLAKAGK-------------
PPID_YARLI      ------------------------------GKIYFELFADKVPKTAENFRALCTGEKG----NTQAGIPL
SDC10_RAT       ------------------------LLKTTAGDIDIELWSKEAPKACRNFIQLCLEA--------------
SDC10_MOUSE     ------------------------LLKTTAGDIDIELWSKEAPKACRNFIQLCLEA--------------
PPIL3_GIBZE     -------------------------LHTSHGDIKVEIYCESVPKTAENFLALCGSG--------------
PPIL1_GIBZE     --------------------TTNIVLETTMGSLILELYTTHAPKTCNNFTTLVRRG--------------
PPID_ASPOR      ------------------------------------------PKTAENFRALCTGEK------GMGKQGK
PPIB_SCHMA      --------------------------------IIIGLFGKTVPKTVENFKQLSIGTQLKDGRTAS-----
PPIC_BOVIN      ------------------------------GRIVIGLFGKVVPKTVENFVALATGEKGYG----------
PPIH_EMENI      ------------------------------GRLKLELFADVTPRTAENFRQFCTG----ESKNQQGRPQG
PPID_ASHGO      ------------------------------GRVVFEVYSDVTPKTAENFVRLCAG----DAGECRTKPGV
PPIB_SCHJA      ------------------------------GRIIIGLFGKTVPKTVENFKQLSIGTTLKDGRTAA-----
PPIH_ASPFU      ------------------------------GRIKMELFADVTPRTAENFRRFCTG----ESKNSQGKPQG
PPIB_EMENI      ----------------ITNKVYFDIQHGDEGRIVLGLYGKTVPETAENFRALATGEKGFG----------
CYPE_DICDI      ----------------MTEQTVT--LQTTVGDITLELYYNHAPKACKNFYEL---------------SKR
PPIL3_CRYNE     -------------------------LHTNLGDIKIELFCESVPRTAENFLALC----------ASGQ---
PPIA_HELPJ      ------------------AKTAYATIKTNKGNITLELFYKDAPQAVSNFVTLAK--------------EG
PPIC_HUMAN      ------------------------------GRIVIGLFGKVVPKTVENFVALATGEKGYG----------
PPIB_GIBZE      ------------------------------GRVVMGLYGKTVPETTENFRALATGEKGFG----------
SDC10_PONAB     ------------------------LLKTTAGDIDIELWSKEAPKACRNFIQLCLEA--------------
SDC10_MACFA     ------------------------LLKTTAGDIDIELWSKEAPKACRNFIQLCLEA--------------
PPID_DEBHA      -----------------------------KGRVVFELYNDVVPKTAENFRALCTGEKGA----SESSGKQ
SDC10_HUMAN     ------------------------LLKTTAGDIDIELWSKEAPKACRNFIQLCLEA--------------
PPIL3_USTMA     -------------------------LHTNVGDIKVEVFCDATPRAAENFLGCAAGT--------------
PPIL3_NEUCR     -------------------------LHTTLGDLKIEIFCESVPKTAENFLALC----------ASG----
PPIB_CRYNE      ---VLSPGVDAAKGPVITNKVYFDIEHGGKGRIVMGLYGKTVPKTAENFRALATG------KNSDGEDLG
SDC10_XENLA     ------------------------LLKTTAGEIDIELWSKEAPKACRNFVQLCL--------------EG
PPID_YEAST      -----------------------------QGRIVFELYNDIVPKTAENFLKLCEGN----AGMAKTKPDV
PPIA_STRCH      ------------------------------GRITFNLFDDVVPKTAENFRALATGEKGFG----------
PPI_SYNE7       -----------------------AILETEKGTIRLQFFDNDAPNTVANFVKLSQDG--------------
PPIB_SCHPO      ------------------------------GRVTIGLFGKTVPKTAENFRALATGEKGFG----------
CYPX_USEUD      ------------------------------GRIIMELFPD-VPKTAENFRALCTGEKGIGPSGKKMT---
PPIB_ORPSP      ------------------------------GRIVLGLYGEVVPKTVENFRALATGEKGYG----------
PPIA_HELPY      ------------------AKTAYATIKTNKGNIALELFYKDAPQAVSNFVTLAK--------------EG
PPI1_STAES      ------------------------VMHTNKGDMTFKLFPDIAPKTVENFV---------------THSKN
PPI1_STAEQ      ------------------------VMHTNKGDMTFKLFPDIAPKTVENFV---------------THSKN
CYPH_NEUCR      ----------------------TSEIKAQSGRINFTLYDDVVPKTARNFKELCTG------QNGFG----
PPIB_ASPOR      ------------------------IEHGNKGRVVLGLYGKTVPKTAENFRALATGEKGFG----------
PPI1_STAAW      ------------------------VMHTNKGDMTFKLFPNIAPKTVENFVTHA---------------KN
PPI1_STAAS      ------------------------VMHTNKGDMTFKLFPNIAPKTVENFVTHA---------------KN
PPI1_STAAR      ------------------------VMHTNKGDMTFKLFPNIAPKTVENFVTHA---------------KN
PPI1_STAAN      ------------------------VMHTNKGDMTFKLFPNIAPKTVENFVTHA---------------KN
PPI1_STAAM      ------------------------VMHTNKGDMTFKLFPNIAPKTVENFVTHA---------------KN
PPI1_STAAC      ------------------------VMHTNKGDMTFKLFPNIAPKTVENFVTHA---------------KN
PPI1_STAAB      ------------------------VMHTNKGDMTFKLFPNIAPKTVENFVTHA---------------KN
PPI1_STAA8      ------------------------VMHTNKGDMTFKLFPNIAPKTVENFVTHA---------------KN
PPI1_STAA3      ------------------------VMHTNKGDMTFKLFPNIAPKTVENFVTHA---------------KN
CYPC_YEAST      -----------------------AVNGTKIGRIEFELYDNVVPKTAENFRALCTGEK------------G
CYP8_CAEEL      ------------------------------GRIVFSLWNHCCPRTVENFRAFCTG--ELGKMNGHYAS--
PPID_CANAL      -----------------------------KGRVVFKLYDDVVPKTAANFRSLCTGDKGISPKSGKPLS--
PPIB_NEUCR      ------------------------------GRIVMGLYGKTVPKTAENFRALATGEKGFG----------
CYPB_VICFA      ------------------------------GRIVIGLFGDAVPKTVENFKTLSTGAKGYG----------
PPIA_CANAL      ------------------------------GKITFKLYDDVVPKTAENFRALCTGEKGFG----------
PPIL2_SCHPO     ---------------------------TNHGEINIELHTDYAPHAVYNFVQLAK----------QG----
CYP11_RHIOR     ------------------------------GRIVIELFADQVPKTAENFRALCTGEKGI----GKVSNMP
PPIL3_RHIOR     -------------------------LHTDLGDIKIEVFCEAVPKTAENFLALC----------ASG----
PPIL3_CHICK     -------------------------LHTDVGDIKIELFCERTPKTCENFLALCASN--------------
PPI1_STAHJ      -------------------------MHTNKGDMTFKLFPDIAPKTVENFVTHA---------------KN
CP20B_ARATH     ------------------------------GRIVIGLYGDDVPQTVENFRALCTGEKGFG----------
PPIL3_DICDI     -------------------------LHTSLGDIKVEIFCDSVPLASENFLALCASN--------------
PPIH_ASPOR      ------------------------------GRIKMELFTSITPRTAENFRQFCTG----ESKSPQGRPQG
CYP6_CAEEL      ------------------------------GKIVIGLFGEVVPKTVKNFVELAQR------------AEG
CWC27_CRYNE     ------------------------IIDTTAGEIEVELWGKECPKAVRNFLALTM--------------EG
PPIL2_RHIOR     -------------------KKSYARIITNYGNINVELFSDKKPKTCHNFIELAKTG--------------
PPIB_YARLI      ------------------------------GKIVMGLYGDVVPKTVENFRALCTG------------ETG
PPIB_ARTBE      ----------------ITSKVYFDIEHDGQGRIVMGLYGKTVPKTAENFRALATGEKGFG----------
CYP40_ARATH     ------------------------------GRIVIELYDDVVPKTAENFRLLCTGEK------GLGPNTG
CWC27_RHIOR     ---------------------AKVILHTTSGDIEIELWGKEAPRATRNFIQLCL--------------EG
PPIL3_RAT       -------------------------LHTDVGDIKIEVFCERTPKTCENFLALCASN--------------
PPIL3_MOUSE     -------------------------LHTDVGDIKIEVFCERTPKTCENFLALCASN--------------
PPIL2_HUMAN     -------------------------LHTNKGDLNLELHCDLTPKTCENFIRLCK--KHY-----------
PPIL3_HUMAN     -------------------------LHTDVGDIKIEVFCERTPKTCENFLALCASN--------------
CYPH_SCHPO      ------------------------------GRIVFKLFDDVVPKTAANFRALCTGEKGYG----------
PPIL2_MOUSE     --HEAAVIDEDVLRYQFVKKKGYVRLHTNKGDLNLELHCDLTPKTCENFIKLCK--KQY-----------
PPIL2_GIBZE     --------------------TGFARMETNMGDLTIELYPEFAPKAVWNFIKLSQTG--------------
PPIB_RAT        ------------------------------GRVTFGLFGKTVPKTVDNFVALATGEKGFG----------
PPIB1_RHIOR     ------------------------------GRIVLGLYGKTVPKTAENFKQLATGENGYG----------
PPIB_MOUSE      ------------------------------GRVVFGLFGKTVPKTVDNFVALATGEKGFG----------
PPIB2_RHIOR     ------------------------------GRIVFGLYGKTVPKTAENFKQLATG------QNGYG----
CP20C_ARATH     ------------------------------GRIVMGLFGEVVPKTVENFRALCTGEKKYG----------
PPIH_GIBZE      ------------------------------GRITFELFKDVVPKTAENFRQFCTGESKTPVGRPQG----
PPI1_STAS1      ------------------------IMHTNKGDMTFKLLPDVAPKTVENFVTHA---------------KN
CYP9_CAEEL      ------------------------------GRIEIRLFVEDAPKTCENFRALCTGEVGMTPNN----KAR
PPIB_HUMAN      ------------------------------GRVIFGLFGKTVPKTVDNFVALATGEKGFG----------
CYPD_YEAST      ----------------ITHKVYFDINHGDKGRIVMGLYGLTTPQTVENF---------YQLTISRDPKMG
CYP5_CAEEL      ------------------------------GRIVIGLFGKTVPKTATNFIELAKKPK------------G
PPIA_PARPR      --------------------------------IVFKLYDDVVPKTAANFRELATG------------SRG
PPIH_USTMA      ---------------------------TPAGRLKCELFSDIVPRTSENFRQLCTG--EFRPNHVP---EG
PPIG_RAT        -----------------------AINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKG----TGKSTQKP
PPIG_MOUSE      -----------------------AINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKG----TGKSTQKP
PPIG_HUMAN      -----------------------AINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKG----TGKSTQKP
PPID_HUMAN      ------------------------------GRIVLELFADIVPKTAENFRALCTGEKGI------GHTTG
PPIB_BOVIN      ------------------------------GRVVIGLFGKTVPKTVDNFVALATGEKGFG----------
CYP6_RHIOR      -----------------------AVNGQHSGRMTFKLFSDTVPKTAENFRALCTGEK------GKGISGK
PPID_BOVIN      ------------------------------GRIVLELFADIVPKTAENFRALCTGEKGI------GPTTG
PPI2_SYNY3      ------------------------------GRIVMELFDEVTPKTAENFRALCTGEK------GVGKAGK
CYPH_MAIZE      ------------------------------GRIVMELYANEVPKTAENFRALCTGEK------GVGKSGK
CYP5_RHIOR      ------------------------------GRLTFKLFSDTVPKTAENFRALCTGEK------GTGVSGK
CYP1_CAEEL      ------------------------------GRVTMELFNDVVPKTAENFRALCTGEKGVGEQGV-----A
PPIL2_NEUCR     -------------------------METNLGPLTLELLPEFAPKAVWNFLRL---------------SEK
CYPR_DROME      ----------------VTSRIYMDVKHNKKGRITFGLFGKLAPKTVANF-------RHICLRGINGTS--
CYPR_CALVI      ----------------VTSKIYMDVKHQKKGRIVFGLFGKRAPKTVTNFRHICLR-----------GING
CYP10_CAEEL     -------------------------LHTTSGDIKIELYVDDAPKACENFLALCASD--------------
CYPH_YEAST      ------------------------------GRVVFKLYNDIVPKTAENFRALCTGEKGFG----------
PPID_RAT        ------------------------------GRIVLELFADIVPKTAENFRALCXXXXXXXXXXXXX----
CYP9_CAEBR      ------------------------------GRIEIKLFTSEAPKTCENFRALCTG----EVGMAPNNKAR
PPID_MOUSE      ------------------------------GRIVLELFADIVPKTAENFRALCXXXXXXXXXXXXP----
PPIL2_ASPOR     -----------------------ARISTTSGDINLELQTEYAPKAVWNFIKLAKKG--------------
PPIL2_ASPFU     -----------------------ARISTTLGDVNLELHTEYAPKAVWNFIKLAKKG--------------
PPIH_SCHPO      ------------------------------GRIKIRLFSSIVPKTAENF-------RQFCTGETLGVNQK
CYPB_YEAST      ---------------VITQKVFFDIEHGEEGRIVIGLYGKVCPKTAKNFYKLSTTTNSKKG---------
NKTR_MOUSE      ------------------------------GRIMFQLFSDICPKTCKNFLCLCSXXXXXXXXXXXXXXXX
NKTR_HUMAN      ------------------------------GRIMFQLFSDICPKTCKNFLCLCSXXXXXXXXXXXXXXXX
CYP7_SCHPO      --------------------TGTVILKTTRGDIQIELWCKEVPKACRNFIQLCL--------------EG
CP19C_ARATH     ------------------------------GRVVMELFADVTPRTANNFRALCTG------ENGIGKAKA
PPIL2_USTMA     ------------------SSKAYVRLSTNFGALNLELHCGKAPKTCFNFLQLCKHGK-------------
PPIA_NEOCA      ------------------------------GRIVLELRGDVVPKTVKNFIGLFDK---------------
PPIA2_RHIOR     ------------------------------GRIEFQLFEDVVPKTAKNFRALCTG------------EQG
CYPH_SOLLC      ------------------------------GRVVMELFADTTPKTAENFRALCTGEK------GVGKMGK
CWC27_GIBZE     --------------------TASVIIHTTRGELSVELFAKQAPLTCRNFLQLALDG--------------
PPIB_BACSU      --------------------------------IEFELYPEAAPGTVANFEKLA--------------NEG
PPIA_PONPY      ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
PPIA_PAPAN      ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
PPIA_PANTR      ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
PPIA_PANPA      ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
PPIA_MACMU      ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
PPIA_HYLSY      ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
PPIA_HYLLE      ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
PPIA_HYLLA      ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
PPIA_HUMAN      ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
PPIA_GORGO      ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
PPIA_FELCA      ------------------------------GRVSFDLFADKVPKTAENFRALSTGEKGFG----------
PPIA_CERAE      ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
PPIL2_EMENI     -----------------------ARISTTSGDINLELHTEYAPKAVWNFIKLAKKG--------------
PPIA_SAGOE      ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
PPIA_RABIT      ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
PPIA_PIG        ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
PPIA_MOUSE      ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
PPIA_CRIGR      ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
PPIA_BOVIN      ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
PPIA_AOTTR      ------------------------------GRVSFELFADKVPKTAENFRALSTGEKGFG----------
CWC27_NEUCR     --------------------TASAIIHTTQGEIAVELFAKQTPLTCRNFLQLALDG--------------
PPIA_RAT        ------------------------------GRVCFELFADKVPKTAENFRALSTGEKGFG----------
CYPH_ALLCE      ----------------------------------MELFQDVVPQTAENFRALCTGEK------GMGDRKP
PPIB_CHICK      ------------------------------GRVVIGLFGKTVPKTVENFVALATG------------EXX
PPIA_SCHMA      ------------------------------GRIIFELF-NDVPDTTRNFRELCTHKNNFG----------
CYPH_CATRO      ------------------------------GRIVMELFADTTPRTAENFRALCTGEK------GTGRSGK
CYP3_CAEEL      ------------------------------GRIVMELYDDVVPKTAGNFRALCTG------ENGIGKSGK
CYPH_UROFA      ------------------------------GRIVFELYDDVVPRTTNNFRQLCL------------NPPG
CP20A_ARATH     ------------------------------GRIVMGLFGKTVPKTVENFRALCTGEK-----GIGKNGKA
CP19D_ARATH     ------------------------------GRVVIGLFGKAVPKTAENFRALCTGEK------GVGKSGK
PPIH_NEUCR      ------------------------------GRITFELFKDVVPRTAENFRQFCTG----ESKNNLGRPQG
CP18D_ARATH     ------------------------------GRIEMELFADTTPNTAENFRALCTGEK------GMGKLGK
PPID_USTMA      --------------------------------IVLELYADRVPRTAENFRVLCTNTSKL-ASTGQPLS--
PPIA_DROME      ------------------------------GRIVMELRSDVVPKTAENFRALCTGEKGFG----------
PPAL4_HUMAN     ------------------------------GRISIKQFADKIPKTAENFRALSTGEKGFR----------
CP18C_ARATH     ------------------------------GRIVMELYTDKTPRTAENFRALCTGEK-----GVGGTGKP
PPIA_ECHGR      ------------------------------GRIVFALFDD-VPKTVENFRALCTGEKGFG----------
CWC27_ASPFU     --------------------TASATLHTTFGPIHIALFANQTPLTCKNFL-------QHCLDN-------
PPIA_HEMPU      ----------------------------NLGRIVMELRADVVPKTAENFRALCTGEKGFG----------
CP19B_ARATH     ------------------------------GKIVMELYTDKTPKTAENFRALCTGEK------GVGRSGK
PPIA_BLAGE      ------------------------------GRIVMELRSDVVPKTAENFRALCTGEKGFG----------
CYPH_ENCCU      ------------------------------GRIVMKLEDDIVPKTAKNFRTLCERPK------------G
PPIB_ECOLI      --------------------------HTNHGDIVIKTFDDKAPETVKNFLDYCR--------------EG
PAL4B_HUMAN     ------------------------------GRISIKLFADKILKTAENFRALSTGEKGFR----------
CYP7_CAEEL      ------------------------------GRIVMELYNDIVPKTAENFRALCTGEK------GVGKSGK
PPIH_HUMAN      ------------------------------GRMKIELFADVVPKTAENF-------RQFCTGEFRKDGVP
PPIH_BOVIN      ------------------------------GRMKIELFADVVPKTAENF-------RQFCTGEFRKDGVP
CYPH_LUPLU      -----------------------AIAGNPAGRIVMELYADTTPRTAENFRALCTGEK------GVGRSGK
CYP4_CAEEL      -------------------KNAFVRLVTNFGPLNLELFAPKVPKACENFITHC--------------SNG
CYP11_CAEEL     ------------------------------GTIVIELFADVTPRTAENFRQFCTG--EYKKDGVPNG---
PPIH_MOUSE      ------------------------------GRMKIELFADVVPKTAENF-------RQFCTGEFRKDGVP
PPIH_CRYNE      ---------------------------TPAGRIKMELFDDITPKTAENFRQLCTGEHRINSV-PQG----
RBP2_MOUSE      ------------------------------GRIIMELFSNIVPQTAENFRALCTGEKGFGFKN-------
RBP2_HUMAN      ------------------------------GRITMELFSNIVPRTAENFRALCTGEKGFGFKN-------
PPIF_BOVIN      ------------------------------GRVVLELKADVVPKTAENFRALCTGEKGFG----------
CP19A_ARATH     ------------------------------GRIVMELYADTTPETAENFRALCTGERGIGKQG-----KP
RBP2_BOVIN      ------------------------------GRITMELFSNIVPKTAENFRALCTGEKGFG----------
PPIE_SCHJA      --------------------------NADRGRIVMELRSDIVPRTAENFRALCTGDRGFG----------
PPIA1_RHIOR     ------------------------------GRIVMELRADVVPQTAENFRALCTGEKGFG----------
PPIF_RAT        ------------------------------GRVVLELKADVVPKTAENFRALCTGEKGFG----------
PPIF_MOUSE      ------------------------------GRVVLELKADVVPKTAENFRALCTGEKGFG----------
PPIF_HUMAN      ------------------------------GRVVLELKADVVPKTAENFRALCTGEKGFG----------
CYPH_BRANA      ------------------------------GRIVMELYADTVPETAENFRALCTG------ERGIGKSGK
CWC27_EMENI     --------------------TASATLHTTFGPLHIALFAKQTPLTCRNFL-------QHCMDN-------
PPIL2_ARATH     ---------------------------TTHGDLNIELHCDIAPRACENFITLC---------------ER
PPIE_SCHMA      ------------------------------GRIVMELRSDIVPRTAENFRALCTGERGFG----------
CWC27_USTMA     -------------------------LVTSKGTISIALFPTQAPLACRNFLTLAL--------------EG
PPIE_BOVIN      ----------------------------------------------------------------------
PPIL3_EMENI     -------------------------LHTTHGDLKVELFCEAVPKTAENFIALC----------AAG----
PPIH_RHIOR      ------------------------------GRMKMELFSDIVPRTAENFRQLCTG--EYKRN---GVPQG
PPIE_PONAB      ----------------------------------------------------------------------
PPIE_MOUSE      ----------------------------------------------------------------------
PPIE_HUMAN      ----------------------------------------------------------------------
CYP7_YEAST      ------------------------------GRIVCKLFREKAPKTTENFYKLCAGDVKSPLKDQQYLS--
PPIE_RHIOR      --------------------------NTLAGRIEIELRGDVVPKTAENFRALCTG------------EAG
PPIA_ACIAD      ----------IVLGGLLISAHALANMKTNLGNIEIELYNNKAPISAKNF-------ESYVKNN-------
CYPR_YEAST      -------------------------------DLTFELYGTVVPKTVNNFAMLAHGVKAVIEGKDPNDIHT
PPIL3_ASPFU     -------------------------LHTTHGDLKVELFCEAVPQTAENFLALC----------ACG----
PPIB_STRAT      ---------------------STVELNTSAGRIVLELNDAEAPKTVENFLAYVRSGH-------------
PPIB_HAEIN      -------------------------LHTNFGDIKIKLDFDKAPVTAENFLNYCKDG--------------
PPIE_DROME      ------------------------------GRIVMLLRADVVPKTAENFRQLCTHEQGYG----------
PPIL4_RHIOR     ----------------------SVLIETSLGDIVIDLYTEECPKTTLNFLKLCKVQKDFMAQT--GDPTG
PPIB_MYCTU      ---------------------------TNQGNIGLMLANNESPCTVNSFVSLAQ----------QG----
PPIL6_BOVIN     ------------------------------GRLIFELYSDTCPKTCKNFQILCTGKAGFSQSGIK-----
PPIL6_HUMAN     ------------------------------GRLIFELYCDVCPKTCKNFQVLCTGKAGFSQRGIR-----
PPIB_MYCLE      --------------------TVSASMATNQGNIGLLLNNAESPCTVNSFASLT----------GQG----
PPIA_PSEAE      ------------------------LIATSLGEIEVELDPAKAPISVKNFL-------EYV--------DS
CYP2_CAEEL      ------------------------------GRIVMELYNDIVPKTAENFRALCTGEXXXXXXXXXXXXXX
PPIL4_MOUSE     ------------------------LLETTLGDVVIDLYTEERPRACLNFLKLC---------------KI
CWC27_DEBHA     ------------MSSLEPATTAKVALITTKGPIEIELWAKEVPNITRVFIQNCLDKK-------------
PPIL4_HUMAN     ------------------------LLETTLGDVVIDLYTEERPRACLNFLKLC---------------KI
CP21C_ARATH     -----------------------ATLDTGKGSVTIELFKDTAPNVVDQFMKFCQ---------------D
PPIA_DICD3      ------------------------LLTTSAGNIELALDDQKAPVFVKNFVDYVNSG--------------
PPIA_SALTY      ------------------------LLTTSAGNIELELNSQKAPVSVKNFVDYVNSG--------------
PPIA_ECOLI      ------------------------LLTTSAGNIELELDKQKAPVSVQNFVDYVNSG--------------
PPIA_ECOL6      ------------------------LLTTSAGNIELELDKQKAPVSVQNFVDYVNSG--------------
PPIA_ECO57      ------------------------LLTTSAGNIELELDKQKAPVSVQNFVDYVNSG--------------
PPIL4_CRYNE     ----------------------SVMLETSLGDLIIDLEVDKCPRTCENFIKLCK--LKYYALNAFAQSGD
PPIL4_GIBZE     ----------------------SVLLETSAGDIVIDLLVDHAPKLCENFLKLCK-VKYYNFSPVHGDPLG
PPI1_SYNY3      ---------------------ATVEMMVNGQPIIIEVDGENAPITAGNFVDLVE----------QG----
PPIL4_NEUCR     ----------------------SVLLETSAGDIVIDLLVDYAPKMCENFLKLCKVQKSFSFQT--GDPLG
PPI1_BRUSU      ----------------------TVILKLKDGDVALELRPDLAPKHVAQIKKLVR--------------EG
PPI1_BRUME      ----------------------TVILKLKDGDVALELRPDLAPKHVAQIKKLVR--------------EG
PPI1_BRUAB      ----------------------TVILKLKDGDVALEIRPDLAPKHVAQIKKLVR--------------EG
PPI1_BRUA2      ----------------------TVILKLKDGDVALEIRPDLAPKHVAQIKKLVR--------------EG
CWC27_YARLI     --------------------TAKVVLTTTKGPIEAELFAKEVPLACTRFLQLCKSG--------------
CWC27_YEAST     --------------------TAKCILYTTKGNIAIELWAKECPETCKRFLSML--------------SDG
CYP8_YEAST      --------------------------------ITIDLYGTMVPKTVMTFCQYVDSVKDRLASRHSYSPER


                         .         .         *         .         .         .         .:140
query           PFYNGSVFHRVIDGFMIQXXXXXXXXXXXXXYTFADEFHPELRFDRAYLLAMANAGPGTNGSQFFITVTP
PPIA_MYCTU      PFYDGAVFHRVIQGFMIQXXXXXXXXXXXXXYKFADEFHPELQFDKPYLLAMANAGPGTNGSQFFITVGK
PPIA_MYCBO      PFYDGAVFHRVIQGFMIQXXXXXXXXXXXXXYKFADEFHPELQFDKPYLLAMANAGPGTNGSQFFITVGK
PPIA_MYCLE      PFYDGAVFHRVIQGFMIQXXXXXXXXXXXXXYKFADEFHPELQFDKPYLLAMANAGPGTNGSQFFITVGE
PPIB_STRCH      RLYDGTVFHRVISGFMIQXXXXXXXXXXXXXYKFADEFHPELGFTQPYLLAMANAGPGTNGSQFFLTVSP
PPIL1_CRYNE     GYYNGVIFHRIIPNFMIQXXXXXXXXXXXXSIRFADEIHPELRFVGAGILAMANSGPNTNGSQFFITCAP
PPWD1_BOVIN     GYYNGHTFHRIIKGFMIQTGDPTGTGMGGESIEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVP
PPWD1_PONAB     GYYNGHTFHRIIKGFMIQTGDPTGTGMGGESIEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVP
PPWD1_HUMAN     GYYNGHTFHRIIKGFMIQTGDPTGTGMGGESIEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVP
PPIB_TREPA      PFYQGLTFHRVIKDFMIXXXXXXXXXXXXXXXXXXDECDPALRHDSPGVLSMANAGPGTNGSQFFITHVA
PPWD1_MOUSE     GYYNGHTFHRIIKGFMIQTGDPTGTGMGGESIEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVP
BPPI_STRP6      -YYDGIIFHRIIPEFMIQXXXXXXXXXXXQSISFEDEFSDEL-YNLRGALSMANAGPNTNGSQFFIVPTP
CYP15_RHIOR     -YYDNLIFHRVIKGFMIQTGCPFGDGTGGESIDFEDEFSREFRHDRPYTVSMANAGPNTNGSQFFITVAP
PPID_GIBZE      PLYKGSVFHRVIKQFMIQXXXXXXXXXXXXESIYGNKFDDEIKHEKPFLLSMANAGPNTNGSQFFITTVP
PPIL1_NEUCR     GYYDSTVFHRIIKDFMIQXXXXXXXXXXXSSIKFEDEIHPGLKHTGAGVLSMANAGPNTNGSQFFITLAP
PPIL1_MOUSE     -YYNGTKFHRIIKDFMIQXXXXXXXXXXXASIQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAP
PPIL1_HUMAN     -YYNGTKFHRIIKDFMIQXXXXXXXXXXXASIQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAP
PPIL1_BOVIN     -YYNGTKFHRIIKDFMIQXXXXXXXXXXXASIQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAP
PPIL1_ASPFU     -YYNNVIFHRIIPNFMVQTGDPTGTGRGGSSIKFEDEIHPGLKHTGAGVLSMANSGPNTNGSQFFITLAP
PPID_KLULA      PLYKGSIFHRVIKSFMCQXXXXXXXXXXXXESIYGEKFEDELKHDKPFLLSMANAGANTNGSQCFITCVP
CYP9_SCHPO      GYYDNTIFHRIIKNFMIQXXXXXXXXXXXESIDFEDEISPNLKHDRPFTVSMANSGPNTNGSQFFITTDL
PPID_EMENI      PLFKGSIFHRVIKQFMIQGGDFTAFNGTGGESIYGEKFPDELKHDRPFLLSMANSGPGTNGSQFFITTVP
PPIL1_RHIOR     -YYDGVSFHRIIADFMIQXXXXXXXXXXXXSIRFADEINPGLQHTGAGILSMANAGPNTNGSQFFITLAP
PPIL1_EMENI     -YYNNVIFHRIIPNFMVQTGDPTGTGRGGSSIKFEDEIRSDLKHTGAGILSMANSGPNTNGSQFFITLAP
PPID_RHIOR      PLYQGSLFHRIIKNFMIQXXXXXXXXXXXXESIYGEKFEDELKHEKPFLLSMANAGPGTNGSQFFITTVP
PPIL1_ASPOR     -YYNNVIFHRIIPNFMVQTGDPTGTGRGGSSIKFEDEIRADLKHTGAGILSMANSGPNTNGSQFFVTLAP
PPID_NEUCR      PLYKGSTFHRVIKQFMIQXXXXXXXXXXXXESIYGAKFEDELKHDRPFLLSMANAGPGTNGSQFFVTTVP
PPIL1_ASPNG     -YYNNVIFHRIIPNFMVQTGDPTGTGRGGSSIKFEDEINPNLKHTGAGILSMANSGPNNNGSQFFITLAP
PPID_CRYNE      --YAGSSFHRCIKGFMLQXXXXXXXXXXXXESIYGEKFEDELKHDKPMLLSMANAGPGTNGSQFFITTVP
PPIC_MOUSE      --YKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDELKHYGIGWVSMANAGPDTNGSQFFITLTK
PPID_DICDI      PLYKGSSFHRVIKNFMVQXXXXXXXXXXXXESIYGRTFNDELVKHKIGCLSMANAGKNTNGSQFFITTAE
PPID_CANGA      PLYKGSIFHRVIKDFMIQXXXXXXXXXXXXESIYGEKFEDEIKHDKPFLLSMANAGPNTNGSQAFITCVP
CYP1_BRUMA      LHYKGSTFHRVIKNFMIQXXXXXXXXXXXXESIYGGMFDDEMKHDEPFVVSMANKGPNTNGSQFFITTTP
PPID_SCHPO      LTYKGSRFHRVIKNFMLQXXXXXXXXXXXXESIYGEKFEDELKHDKPFLLSMANAGPNTNGSQFFITTVP
PPID_ASPFU      PLYKGSIFHRVIKQFMIQXXXXXXXXXXXXESIYGEKFPDELKHDRPFLLSMANSGPGTNGSQFFITTVP
PPIB_ASPNG      --YEGSTFHRVIKDFMIQXXXXXXXXXXXXKSIYGEKFADELRHTRKGLLSMANAGKDTNGSQFFITTVP
PPIL1_SCHPO     -YYDGVIFHRVIPDFVIQXXXXXXXXXXXXSIKFDDEIHSDLHHTGAGILSMANAGPNTNSSQFFITLAP
PPIB_ASPFU      --YEGSTFHRVIKSFMIQXXXXXXXXXXXXKSIYGEKFADELRHTRKGLLSMANAGKDTNGSQFFITTVP
SDC10_DANRE     -YYDGTIFHRMVPEFIVQXXXXXXXXXXXESIPFKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGR
PPID_AMAMU      PWYKGSAFHRVIKGFMCQXXXXXXXXXXXXESIYGEKFEDEVHHSRPFLLSMANAGPNTNGSQFFITVSA
SDC10_BOVIN     -YYDNTIFHRVVPGFIVQXXXXXXXXXXXESIPFKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGR
PPIL2_CRYNE     --YDNVVFHRLIPGFMVQXXXXXXXXXXXESYPFRDE-HGEYKHDSRGVLSMANSGPRTNGSQFFFTFRP
PPID_YARLI      HF-KGSSFHRVIKDFMVQXXXXXXXXXXXXESIYGEKFPDEAPHDQPFLLSMANAGPNTNGSQFFITTTE
SDC10_RAT       -YYDNTIFHRVVPGFIVQXXXXXXXXXXXESVPFKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGR
SDC10_MOUSE     -YYDNTIFHRVVPGFIVQXXXXXXXXXXXESIPFKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGR
PPIL3_GIBZE     -YYDKSPFHRVIPKFMAQTGAPATPNPPENPKAFEDEIRPALRHGARGVLSMANKGPGTNGSQFFITFDK
PPIL1_GIBZE     -YYDNTIFHRIIPNFMVQXXXXXXXXXXXSSIKFEDEIDPGLKHTGAGILSMANAGPNTNGSQFFVTLAP
PPID_ASPOR      PLFKGSIFHRVIKQFMIQGGDFTAFNGTGGESIYGEKFPDELKHDKPFLLSMANSGPGTNGSQFFITTVP
PPIB_SCHMA      --YKGSTFHRVIKSFMIQGGDFTNHDGTGGFSIYGDRFPDELRHVGAGWLSMANAGPDTNGSQFFITTVK
PPIC_BOVIN      --YKGSKFHRVIKDFMIQXXXXXXXXXXXXISIYGETFPDELKHYGIGWVSMANAGPDTNGSQFFITLTK
PPIH_EMENI      --YKGSKFHRVIKDFMIQGGDFVNGDGTGSCTIYGTKFSDELRHDRPGLLSMANSGPNTNGCQFFITTTA
PPID_ASHGO      PLYQGSLFHRVIKGFMCQXXXXXXXXXXXXESIYGEKFEDERKHDRPFLLSMANAGPNTNGSQCFITCAP
PPIB_SCHJA      --YKGSTFHRVIKSFMIQGGDFTNHDGTGGFSIYGERFPDELKHVGAGWLSMANAGPNTNGAQFFITTTQ
PPIH_ASPFU      --YKNSKFHRVIKDFMIQGGDFVNGDGTGSCTIFADE-NFVLKHDRAGVLSMANSGPNTNGCQFFITTTA
PPIB_EMENI      --YEGSNFHRVIKDFMIQXXXXXXXXXXXXKSIYGAKFKDELRHTKTGLLSMANAGKDTNGSQFFITTAV
CYPE_DICDI      GYYDNTIFHRLIKDFMIQGGDPLGNGRGGESIKFEDEITKELKHTGAGILSMANSGVNSNGSQFFITFGP
PPIL3_CRYNE     --YDGTLFHRNIRGFMIQXXXXXXXXXXXQSIPFSDEIRQTLRFNNRGMVAMANAGPDTNKSQFFITYAK
PPIA_HELPJ      -FYNGLNFHRVIAGFVAQXXXXXXXXXXXXEHRIKCEVAHNPNKHQRGSISMAHAGRDTGGSQFFLCFVD
PPIC_HUMAN      --YKGSKFHRVIKDFMIQXXXXXXXXXXXXVSIYGETFPDELKHYGIGWVSMANAGPDTNGSQFFITLTK
PPIB_GIBZE      --YEGSAFHRVIKNFMIQXXXXXXXXXXXXXSIYGDRFKDELKHTKKGLLSMANAGRDTNGSQFFITTVV
SDC10_PONAB     -YYDNTIFHRVVPGFIVQXXXXXXXXXXXESIPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGR
SDC10_MACFA     -YYDNTIFHRVVPGFIVQXXXXXXXXXXXESIPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGR
PPID_DEBHA      LHYKGSIFHRIIKDFMCQGGDFTHXXXXXXXXXXXXKFEDELTHDKPFLLSMANAGANTNGSQFFITTVP
SDC10_HUMAN     -YYDNTIFHRVVPGFIVQXXXXXXXXXXXESIPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGR
PPIL3_USTMA     --YNDVKWHRNIKSFMIQTGDPTGTGKGGQSIPFADEIRSSLKFDRRGIVACANAGPDTNKSQFFITYAK
PPIL3_NEUCR     -YYNASPFHRMIPSFMVQTGAPANPSPPENPKTFEDEIRPVLRHNERGIVSMANKGPNTNGSQFFILFDK
PPIB_CRYNE      YGYEGSSFHRIIKNFMIQXXXXXXXXXXXXXSIYGSKFPDELKHTGPGVLSMANAGRDTNGSQFFICTVK
SDC10_XENLA     -YYDNTIFHRVVPEFIIQXXXXXXXXXXXESVPFRDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGR
PPID_YEAST      PLYKGSIFHRVIKDFMCQXXXXXXXXXXXXESIYDEKFEDEVKHDKPFLLSMANAGPNTNGSQAFITCVP
PPIA_STRCH      --YAGSSFHRVITDFMLQXXXXXXXXXXXXKSIYGEKFADELKHDRVGLLSMANAGKNTNGSQFFITTVL
PPI_SYNE7       -FYDGLTFHRVIPGFMSQXXXXXXXXXXXXXYKIPCEINDNPHL--AGTLSMAHAGRNTGGSQFFICHEP
PPIB_SCHPO      --YEGSIFHRVIPNFMXXXXXXXXXXXXXXXSIYGSRFPDELSHQRPGLLSMANAGPDSNGSQFFITTVK
CYPX_USEUD      --YEGSVFHRVIPKFMLQGGDFTLGNGRGGESIYGAKFADENKHTTPGLLSMANAGPGTNGSQFFITTVA
PPIB_ORPSP      --YKNSKFHRVIKDFMIQXXXXXXXXXXXXKSIYGERFADELRHTGPGILSMANAGRDTNGSQFFITTVT
PPIA_HELPY      -FYNGLNFHRVIAGFVAQXXXXXXXXXXXXXHRIKCEVAHNPNKHKRGSISMAHAGRDTGGSQFFLCFVD
PPI1_STAES      GYYDGVTFHRVINDFMVQGGDPTATGMGGESIAFEDEFSLE-AFNLYGALSMANAGPNTNGSQFFIVQMK
PPI1_STAEQ      GYYDGVTFHRVINDFMVQGGDPTATGMGGESIAFEDEFSLE-AFNLYGALSMANAGPNTNGSQFFIVQMK
CYPH_NEUCR      --YKGSSFHRIIPEFMLQXXXXXXXXXXXXKSIYGEKFADEKKHVRPGLLSMANAGPNTNGSQFFVTTVP
PPIB_ASPOR      --YEGSTFHRVIKEFMIQXXXXXXXXXXXXKSIYGEKFKDEIRHTKKGLLSMANAGKDTNGSQFFITTVA
PPI1_STAAW      GYYDGITFHRVINDFMIQGGDPTATGMGGESIAFEDEFSLN-AFNLYGALSMANSGPNTNGSQFFIVQMK
PPI1_STAAS      GYYDGITFHRVINDFMIQGGDPTATGMGGESIAFEDEFSLN-AFNLYGALSMANSGPNTNGSQFFIVQMK
PPI1_STAAR      GYYDGITFHRVINDFMIQGGDPTATGMGGESIAFEDEFSLN-AFNLYGALSMANSGPNTNGSQFFIVQMK
PPI1_STAAN      GYYDGITFHRVINDFMIQGGDPTATGMGGESIAFEDEFSLN-AFNLYGALSMANSGPNTNGSQFFIVQMK
PPI1_STAAM      GYYDGITFHRVINDFMIQGGDPTATGMGGESIAFEDEFSLN-AFNLYGALSMANSGPNTNGSQFFIVQMK
PPI1_STAAC      GYYDGITFHRVINDFMIQGGDPTATGMGGESIAFEDEFSLN-AFNLYGALSMANSGPNTNGSQFFIVQMK
PPI1_STAAB      GYYDGITFHRVINDFMIQGGDPTATGMGGESIAFEDEFSLN-AFNLYGALSMANSGPNTNGSQFFIVQMK
PPI1_STAA8      GYYDGITFHRVINDFMIQGGDPTATGMGGESIAFEDEFSLN-AFNLYGALSMANSGPNTNGSQFFIVQMK
PPI1_STAA3      GYYDGITFHRVINDFMIQGGDPTATGMGGESIAFEDEFSLN-AFNLYGALSMANSGPNTNGSQFFIVQMK
CYPC_YEAST      WGYKGVPFHRIIPDFMIQGGDTDLTNGFGGKSIYGSKFADEKKHDKAGLLSMANAGPNTNGSQFFITTVP
CYP8_CAEEL      --YQGSVFHRVIKGFMIQXXXXXXXXXXXXYSIYGRTFDDELKHKKPYLLSMANRGPDTNGSQFFITSEE
PPID_CANAL      --YKDSIFHRVIKDFMCQGGDFTAPSDHLGTSIYGEKFEDELNHNKPFLLSMANSGPNTNGSQFFITTVP
PPIB_NEUCR      --YEGSTFHRVIKQFMIQXXXXXXXXXXXXXSIYGDKFPDELKHSKKGLLSMANAGKDTNGSQFFITTVI
CYPB_VICFA      --YQGSFFHRIIPNFMIQXXXXXXXXXXXXVSIYGSKFEDE-SFDLKHVLSMANAGPNTNGSQFFICTVP
PPIA_CANAL      --YKGSIFHRVIPQFMLQXXXXXXXXXXXXKSIYGTKFADEKRHDRPGLLSMANAGPNTNGSQFFITTVP
PPIL2_SCHPO     -YYRNTIFHRNIARFMIQGGDPSGTGRGGQSIPFKDEFCNPLKHDDRGIISMANRGKNTNGSQFFILYGP
CYP11_RHIOR     LHYKGSIFHRIIKGFMCQGGDFTHRTGKGGESIYGANF-PDESFSRKHLLSMANRGPNTQTSQFFITTRP
PPIL3_RHIOR     -YYDNNTFHRNIPGFMIQVHEHLHTGDPTGTKKFNDEIRSTLKHNSRGIVSMANSGPNTNGSQFFITYAK
PPIL3_CHICK     -YYNGCVFHRNIKGFMVQTGDPLGTGKGGTSIKFEDEFSEYLKHSVRGVVSMANNGPNTNGSQFFITYGK
PPI1_STAHJ      GYYDGITFHRVINDFMIQGGDPTATGMGGESISFEDEFSLE-AFNLYGALSMANAGPNTNGSQFFVVQMK
CP20B_ARATH     --YKGSTFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTFKDE-NFKLSHVLSMANAGPNTNGSQFFICTIK
PPIL3_DICDI     -YYNNTIFHRNIKGFMIQGGDPTNTGRGGESIQFKDEFPSHLKHNTRGILSMANSGPDTNGSQFFITYGK
PPIH_ASPOR      --YKNSKFHRVIKDFMIQGGDFVNGDGTGSRTIYGTRFQDELKHDQPGLLSMANSGPNTNGCQFFITTTA
CYP6_CAEEL      EGYVGSKFHRVIENFMIQXXXXXXXXXXXXXSIYGERFEDELQHYGPGWLSMANAGEDTNGSQFFITTAK
CWC27_CRYNE     -YYDGVIFHRVVPGFIIQSGDPTGTGMGGESFPFEDEIHGRLKFNRRGLLGMANNGSNSNTSQFFITLDA
PPIL2_RHIOR     -YYNDVIFHRNIKKFMIQXXXXXXXXXXXESIWFPDEIKTTLKHDARGVLSMANRGKDTNGSQFFITYAA
PPIB_YARLI      KGYKGSKFHRVIKNFMIQXXXXXXXXXXXXESIYGRKFPDELKHTKPYKLSMANAGRDTNGSQFFITTVV
PPIB_ARTBE      --YEGSTFHRVIKDFMIQXXXXXXXXXXXXKSIYGNKFEDELRHTKKGVLSMANAGKDTNGSQFFITTAI
CYP40_ARATH     VHYKGNRFHRVIKGFMIQGGDISANDGTGGESIYGDDENFELKHERKGMLSMANSGPNTNGSQFFITTTR
CWC27_RHIOR     -YYDNTIFHRIVPGFLVXXXXXXXXXXXXESVYFPDEFHSRLRFNRRGLVGVANTGQNDNGSQFFITLDR
PPIL3_RAT       -YYNGCVFHRNIKGFMVQTGDPTGTGRGGSSIKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGK
PPIL3_MOUSE     -YYNGCVFHRNIKGFMVQTGDPTGTGRGGSSIKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGK
PPIL2_HUMAN     --YDGTIFHRSIRNFVIQXXXXXXXXXXXESYPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRS
PPIL3_HUMAN     -YYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGK
CYPH_SCHPO      --YAGSTFHRVIPQFMLQXXXXXXXXXXXXKSIYGEKFPDELKHNKPGLLSMANAGPNTNGSQFFITTVV
PPIL2_MOUSE     --YDGTIFHRSIRNFVIQXXXXXXXXXXXESFPFKDEFRPNLSHTGRGVLSMANSGPNTNKSQFFITFRS
PPIL2_GIBZE     -YYKGVAFHRNIPNFMIQXXXXXXXXXXXXXVWFDDEFDGPMTHNGRGTLSMANKGKNTNSSQFFFAYKP
PPIB_RAT        --YKNSKFHRVIKDFMIQXXXXXXXXXXXXKSIYGERFPDELKHYGPGWVSMANAGKDTNGSQFFITTVK
PPIB1_RHIOR     --YKGSTFHRVIKKFMIQGGDFTNHDGTGGKSIYGNRFADELRHSTPGLLSMANAGRDTNGSQFFITTVV
PPIB_MOUSE      --YKNSKFHRVIKDFMIQXXXXXXXXXXXXKSIYGERFPDELKHYGPGWVSMANAGKDTNGSQFFITTVK
PPIB2_RHIOR     --YKGSTFHRVIDQFMIQGGDFTNHDGTGGKSIYGSRFPDELRHTVPGLLSMANAGPDSNGSQFFITTVV
CP20C_ARATH     --YKGSSFHRIIKDFMIQXXXXXXXXXXXXISIYGAKFEDELKHTGPGILSMANAGPNTNGSQFFICTVK
PPIH_GIBZE      --YKGSKFHRIIPNFMCQGGDFLNGDGTGSTCSFEDE-NFTLKHDQPGLLSMANAGPNTNGSQFFITTVP
PPI1_STAS1      GYYNGVTFHRVINDFMVQGGDPTATGMGGESIPFEDEFSKE-AFNIYGALSMANAGPHTNGSQFFIVTGG
CYP9_CAEEL      LHYKQNEFHRIVKKFMIQXXXXXXXXXXXXFSIYGRYFDDELKHSRPYLLSMANKGPNSNSSQFFITTAA
PPIB_HUMAN      --YKNSKFHRVIKDFMIQXXXXXXXXXXXXKSIYGERFPDELKHYGPGWVSMANAGKDTNGSQFFITTVK
CYPD_YEAST      --YLNSIFHRVIPNFMIQGGDFTHRSGIGGKSIFGNTFKDEVKHDKPGRLSMANRGKNTNGSQFFITTVP
CYP5_CAEEL      EGYPGSKFHRVIADFMIQXXXXXXXXXXXXXSIYGEKFADELKHYGAGWLSMANAGADTNGSQFFITTVK
PPIA_PARPR      FGYKGSVFHRVITDFMAQXXXXXXXXXXXXKSIYGEKFADELKHTKPALLSMANAGPNTNGSQFFITFVP
PPIH_USTMA      --YKNSIFHRIIKDFMCQGGDFINADGTGSRSIYGDKFDDELKHDKAGLLSMANSGPGTNGCQFFITAQP
PPIG_RAT        LHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDEVKHNKEFLLSMANRGKDTNGSQFFITTKP
PPIG_MOUSE      LHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDEVKHNKEFLLSMANRGKDTNGSQFFITTKP
PPIG_HUMAN      LHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDEVKHNKEFLLSMANRGKDTNGSQFFITTKP
PPID_HUMAN      KHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDEYKHDREGLLSMANAGRNTNGSQFFITTVP
PPIB_BOVIN      --YKDSKFHRVIKDFMIQXXXXXXXXXXXXKSIYGERFPDELKHYGPGWVSMANAGKDTNGSQFFITTVK
CYP6_RHIOR      PLYKNSYFHRIIPGFMAQXXXXXXXXXXXXESIYGRTFKDELKHKGKGLLSMANAGPNTNGSQFFITFVD
PPID_BOVIN      KHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDEYKHDKEGLLSMANAGSNTNGSQFFITTVP
PPI2_SYNY3      PLFKGSHFHRVITDFMAQXXXXXXXXXXXXESIYGEKFADELKHDRPGLLSMANAGPNTNGSQFFLTFVP
CYPH_MAIZE      PLYKGSTFHRVIPEFMCQXXXXXXXXXXXXESIYGEKF-PDEKFVRKQVLSMANAGPNTNGSQFFICTVA
CYP5_RHIOR      PLYKGSHFHRIIPGFMAQGGDFTMGNGRGGESIYGHKFNDELKHTGKGVLSMANAGPNTNGSQFFITFDK
CYP1_CAEEL      LHFKGSKFHRIIPEFMIQGGDFTRHNGTGGESIYGNKFKDE-NFDLKHTLSMANAGPNTNGSQFFICTVD
PPIL2_NEUCR     GYYRDVAFHRSIRNFMIQXXXXXXXXXXXXXINFEDEFEGPNTHSARGIVSMANKGKNTNSSQFFITYRP
CYPR_DROME      --YVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEVEHNRPGYLGMANRGPDTNGCQFYVTTVG
CYPR_CALVI      TTYVGSEFHRVISRFLIQGGDIVNNDGTGSTSIYGDFFQDEVEHLRPGYLGMANRGPDTNGCQFYVTTVA
CYP10_CAEEL     -YYNGCIFHRNIKDFMVQTGDPTHSGKGGESIPFEDEFVSALKHDSRGCVSMANNGPDSNRSQFFITYAK
CYPH_YEAST      --YAGSPFHRVIPDFMLQXXXXXXXXXXXXKSIYGGKFPDEKHHDRPGLLSMANAGPNTNGSQFFITTVP
PPID_RAT        LHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDEYKHDREGLLSMANAGPNTNGSQFFITTVP
CYP9_CAEBR      LHYKGNEIHRVVKKFMIQXXXXXXXXXXXXFSIYGRYFDDELKHSKPYLLSMANKGPNSNSSQFFITTAP
PPID_MOUSE      LHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDEYKHDREGLLSMANAGPNTNGSQFFITTVP
PPIL2_ASPOR     -YYKDVTFHRNIKGFMIQGGDPSGTGRGGESIWFNDEFEGPLKHDSRGTLSMANKGKNTNSSQFFIAYRA
PPIL2_ASPFU     -YYKDVTFHRNIKGFMIQXXXXXXXXXXXESIWFNDEFEGPLKHDSRGTLSMANKGKNTNSSQFFIAYRA
PPIH_SCHPO      PIYKNSTFHRIIQGFMIQGGDFVSGDGTGSATIFNSRTFPDLKHDRPGLLSMANAGKDSNGCQFFITTVP
CYPB_YEAST      --FIGSTFHRVIPNFMVQXXXXXXXXXXXXKSIYGDTFPDELKHDRKGRLSMANRGKDTNGSQFFITTTE
NKTR_MOUSE      X----STFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDELKHDRAFLLSMANRGKHTNGSQFFITTKP
NKTR_HUMAN      X----STFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDELKHDRAFLLSMANRGKHTNGSQFFITTKP
CYP7_SCHPO      -YYDGTIVHRVVPEFLIQXXXXXXXXXXXESIPFAVETHPRLRFIRRGLVGMACTENEGNNSQFFITLGP
CP19C_ARATH     LHYKGSAFHRIIPGFMCQXXXXXXXXXXXXESIYGSKFEDELKHTGPGILSMANSGPNTNGSQFFICTEK
PPIL2_USTMA     --YDDTLFHRNIPGFMIQXXXXXXXXXXXSSINFRDEFNEPGAFDTRGVLSMANKGKDTNASQFFITYRG
PPIA_NEOCA      --YKGSTFHRVIADFMIQGGDFENHNGTGGHSIYGPRFEDELKHDRG-VISMANAGPNTNGSQFFITTVK
PPIA2_RHIOR     FGYKGSKFHRVIPQFMLQXXXXXXXXXXXXKSIYGEKFADELKHSEPGLLSMANAGPNTNGSQFFITTVP
CYPH_SOLLC      PLYKGSTFHRVIPGFMCQXXXXXXXXXXXXESIYGAKFNDE-NFVKKHILSMANAGPGTNGSQFFICTAK
CWC27_GIBZE     -YYDNTIFHRLVPGFILQXXXXXXXXXXXESINFKDEFHSRLKFNRRGLLGSANESPDTNSSQFFFTLDT
PPIB_BACSU      -FYDGLTFHRVIPGFVSQXXXXXXXXXXXXXYTIKCETEGNPHTHEAGALSMAHAGKDTGGSQFFIVHEP
PPIA_PONPY      --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
PPIA_PAPAN      --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
PPIA_PANTR      --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
PPIA_PANPA      --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
PPIA_MACMU      --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
PPIA_HYLSY      --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
PPIA_HYLLE      --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
PPIA_HYLLA      --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
PPIA_HUMAN      --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
PPIA_GORGO      --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
PPIA_FELCA      --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDELKHTGPGILSMANAGPNTNGSQFFICTAK
PPIA_CERAE      --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
PPIL2_EMENI     -YYKDVTFHRNIKGFMIQXXXXXXXXXXXESIWFNDEFEGPLKHDSRGTLSMANKGKNTNSSQFFIAYRA
PPIA_SAGOE      --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDELKHTGPGILSMANAGPNTNGSQFFICTVK
PPIA_RABIT      --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
PPIA_PIG        --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDELKHTGPGILSMANAGPNTNGSQFFICTAK
PPIA_MOUSE      --YKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
PPIA_CRIGR      --YKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
PPIA_BOVIN      --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDELKHTGPGILSMANAGPNTNGSQFFICTAK
PPIA_AOTTR      --YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFDDELKHTGPGILSMANAGPNTNGSQFFICTVK
CWC27_NEUCR     -YYDNTIFHRLIPGFIVQGGDPSGTGHGGESINFKDEFHSRLKFNRRGLLGMANEGPDTNSSQFFFTLGK
PPIA_RAT        --YKGSSFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
CYPH_ALLCE      LHYKGSSFHRVIPGFMCQXXXXXXXXXXXXESIYGAKFKDE-NFIKKHVLSMANAGPGTNGSQFFICTEK
PPIB_CHICK      XXXXXXXXHRVIKDFMIQXXXXXXXXXXXXKSIYGDRFPDELKHYGPGWVSMANAGKDTNGSQFFITTVK
PPIA_SCHMA      --YKGSVFHRIIPGFMCQXXXXXXXXXXXXKSIYGNKFKDE-NFNHAFSLSMANAGPNTNGSQFFITTVP
CYPH_CATRO      PLYKDSSFHRVIPGFMCQXXXXXXXXXXXXESIYGAKFADE-NFIKKHILSMANAGPNTNGSQFFICTAK
CYP3_CAEEL      PLFKGSKFHRIIPNFMIQXXXXXXXXXXXXESIYGEKF-PDENFKEKHVLSMANAGPNTNGSQFFLCTVK
CYPH_UROFA      KGFKHSIFHRVIPDFMIQXXXXXXXXXXXXESIYGKKFEDE-NFQKKHMLSMANAGPNTNGSQFFITVTK
CP20A_ARATH     LHYKGSSFHRIIPSFMLQGGDFTHGNGMGGESIYGEKFADELKHTGPGFLSMANAGQDTNGSQFFITTVT
CP19D_ARATH     PLYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADELKHTGPGVLSMANSGEDTNGSQFFITTVT
PPIH_NEUCR      --YKGSKFHRIIPNFMCQGGDFLNGDGTGSTCSFADE-NFLLKHDTPGLLSMANAGPNTNGSQFFITTVP
CP18D_ARATH     PLFKGSIFHRVIPGFMCQGGDFTAKNGTGGESIYGAKFKDEKKHTGAGILSMANSGPNTNGSQFFICTDK
PPID_USTMA      --FRNSIFHRVIPKFMIQGGDFTRADGTGGESIYGEKFQDEDKHDVPFLLSMANAGANTNGSQFFITTVP
PPIA_DROME      --YKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDELKHTGSGILSMANAGANTNGSQFFICTVK
PPAL4_HUMAN     --YKGSCFHRIIPGFMCQGGDFTHPNGTGDKSIYGEKFDDERKHTGSGILSMANAGPNTNGSQFFICTAK
CP18C_ARATH     LHFKGSKFHRVIPNFMCQXXXXXXXXXXXXESIYGSKFEDE-NFERKHILSMANAGANTNGSQFFICTVK
PPIA_ECHGR      --YKGSKFHRIIPGFMCQXXXXXXXXXXXXKSIYGSKFEDENKHSKPMMLSMANAGKNTNGSQFFITTAV
CWC27_ASPFU     -YYAGTIFHRIVPDFIVQFEYDPEARDPNEKVVLRDELHSRLRFNRRGLVGMAKSEDGTYGSQFFITLAN
PPIA_HEMPU      --YKGSTFHRVIPGFMCQGGDFTRHNGTGGKSIYGEKFADELKHTQPGILSMANAGVNTNGSQFFICTAV
CP19B_ARATH     PLFKGSSFHRVIPNFMCQXXXXXXXXXXXXESIYGAKFEDE-NFERKHILSMANAGANTNGSQFFICTVK
PPIA_BLAGE      --YKGSRFHRVIPNFMCQGGDFTNHNGTGGKSIYGTKFEDELKHTGPGILWMANAGPNTNGSQFFITTAK
CYPH_ENCCU      EGYKGSTFHRIIPGFMVQGGDYTAHNGTGGRSIYGEKFPDELKHTKEGILSMANCGAHTNGSQFFITLGK
PPIB_ECOLI      -FYNNTIFHRVINGFMIQGGFEPGMKQKATKEPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVD
PAL4B_HUMAN     --YKGSCFHRIIPGFMCQGGDFTRHNGTGDKSIYGEKFDDERKHTGSGILSMANAGPNTNGSQFFICAAK
CYP7_CAEEL      PLFKGSKFHRIIPEFMIQXXXXXXXXXXXXESIYGEKF-PDENFKEKHVLSMANAGPNTNGSQFFLCTVK
PPIH_HUMAN      IGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADELRHSAPGLLSMANSGPSTNGCQFFITCSK
PPIH_BOVIN      IGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADELRHSAPGLLSMANSGPSTNGCQFFITCSK
CYPH_LUPLU      PLYKGSTFHRVIPNFMCQGGDFTAGNGTGAESIYGAKFADEKRHTGPGILSMANAGAGTNGSQFFICTEK
CYP4_CAEEL      -YYNNTKFHRLIKNFMLQXXXXXXXXXXXESIPFSDEFISGFSHDARGVLSMANKGSNTNGSQFFITFRP
CYP11_CAEEL     --YKNCTFHRVIKDFMIQGGDFCNGDGTGLMSIYGSKFRDELKHIGPGMLSMANAGSDTNGCQFFITCAK
PPIH_MOUSE      IGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADELRHSAPGLLSMANSGPSTNGCQFFITCSK
PPIH_CRYNE      --YKKATFHRVIPQFMVQGGDFVRGDGTGSFSIYGAQFEDEVKHTGPGLLSMANSGPNTNGCQFFITTAP
RBP2_MOUSE      -----SIFHRVVPDFICQGGDITKYNGTGGQSIYGDKFDDE-NFDLKHLLSMANYGQNTNSSQFFITLKK
RBP2_HUMAN      -----SIFHRVIPDFVCQGGDITKHDGTGGQSIYGDKFEDE-NFDVKHLLSMANQGQNTNNSQFVITLKK
PPIF_BOVIN      --YKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDELKHEGPGVLSMANAGPNTNGSQFFICTIK
CP19A_ARATH     LHYKGSSFHRVIPKFMCQXXXXXXXXXXXXESIYGSKFKDE-NFIKKHILSMANAGANTNGSQFFICTEK
RBP2_BOVIN      --FKSSIFHRVIPDFVCQGGDITKHDGTGGRSIYGDKFEDE-NFDVKHLLSMANRGQDTNNSQFFITLKK
PPIE_SCHJA      --YHNCCFHRVIPQFMCQXXXXXXXXXXXXXSIYGRKFDDELRHEGFGVLSMANSGPNTNGSQFFICTTK
PPIA1_RHIOR     --YKGCSFHRVIPEFMLQGGDFTNHNGTGGKSIYGNKFRDELKHTGPGDLSMANAGPNTNGSQFFITTIK
PPIF_RAT        --YKGSTFHRVIPAFMCQAGDFTNHNGTGGKSIYGSRFPDELKHVGPGVLSMANAGPNTNGSQFFICTIK
PPIF_MOUSE      --YKGSTFHRVIPAFMCQAGDFTNHNGTGGRSIYGSRFPDELKHVGPGVLSMANAGPNTNGSQFFICTIK
PPIF_HUMAN      --YKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDELKHVGPGVLSMANAGPNTNGSQFFICTIK
CYPH_BRANA      PLYKGSAFHRVIPKFMCQXXXXXXXXXXXXESIYGMKFKDE-NFVKKHILSMRNAGSNTNGSQFFICTEK
CWC27_EMENI     -YYAGTIFHRVVPDFIIQFEYDPDARDPNEKVVLRDEIHSRLRFNRRGLVGMAKSEDGSYGSQFFITLAN
PPIL2_ARATH     GYYNGVAFHRSIRNFMIQXXXXXXXXXXXESIPFKDEPNSKLLHSGRGVVSMANSGPHTNGSQFFVLYKS
PPIE_SCHMA      --YHNCCFHRVIPQFMCQXXXXXXXXXXXXXSIYGRKFDDELRHEGFGVLSMANSGPNTNGSQFFICTTK
CWC27_USTMA     -FYDNLVFHRLIPNFILQTGDPSATGTGGESIPFPIESHSRLKFNRRGLLGMAANQDRTNESQFFLTLDA
PPIE_BOVIN      --FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDELKHTGPGLLSMANSGPNTNGSQFFLTCDK
PPIL3_EMENI     -AYNDTPFHRLIPGFMIQGGDISLGPAANSQGTFDDEIHPALRHNTRGILSMASTGPTINGSQFFITFAA
PPIH_RHIOR      --YKNCLFHRVIKDFMVQGGDFIKGDGTGAMCIYGDRFADENFIEKAGLLSMANSGPNSNGCQFFITCDA
PPIE_PONAB      --FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDELKHTGPGLLSMANSGPNTNGSQFFLTCDK
PPIE_MOUSE      --FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDELKHTGPGLLSMANSGPNTNGSQFFLTCDK
PPIE_HUMAN      --FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDELKHTGPGLLSMANSGPNTNGSQFFLTCDK
CYP7_YEAST      --YKGNGFHRVVKNFMIQAGDIVFGTQKDXXXXYADKFEDENEFVEPFTLGMANLGPNTNNSQFFITTYA
PPIE_RHIOR      FGYKKSSFHRIIPQFMCQXXXXXXXXXXXXXSIYGGKFEDELKHTGPGTLSMANAGSNTNGSQFFICTEK
PPIA_ACIAD      -FYNGTIFHRVIPNFMIQGGGFETNMKEKATAAIKNEASNGLANTRGTLAMARTSNPDSATSQFFINVAD
CYPR_YEAST      YSYRKTKINKVYPNKYIQGGVVAPDVGPFTVYKFDDE-NFYLKHDRPERLAMAYFGPDSNTSEFIITTKA
PPIL3_ASPFU     -AYNNTPFHRIFPGFMIQGGDISLGPAPGTLNTLKQEIHPALRHNARGILSMASTGATVNGSQFFITFAA
PPIB_STRAT      --YDGTIFHRVISDFMIQGGGFTPDMQQKSTLAIQNEADNGLRNDN-YTVAMARTNPHSATAQFFINVKD
PPIB_HAEIN      -FYNNTIFHRVIDGFMIQGGGMESGMREKATKAIQNEANNRLSNKRGTIAMARTSDPHSATAQFFINVAD
PPIE_DROME      --YKGCSFHRVIPEFMCQGGDFXXXXXXXXKSIYGKKFNDELKHNSFGTLSMANSGANTNGSQFFICTTK
PPIL4_RHIOR     KGDQGQSVYGILGGSRY----------------FPAEIHPTLKHVRRGMVSMAVAADGVSGSQFFITLGE
PPIB_MYCTU      -FFKGTTCHRLTTSPMLQCXXXXXXXXXXXXYQFANEYDPKLNEPVIYTLAMANAGPNTNSSQFFM-VYR
PPIL6_BOVIN     LHYTGSIFHRVVRNGWVQGGDIVAGKGDNGESIYGPTFEDEVPHNKRGVLGMVNKGRHSNGSQFYITLQA
PPIL6_HUMAN     LHYKNSIFHRIVQNGWIQGGDIVYGKGDNGESIYGPTFEDEVPHNKRGVLGMANKGRHSNGSQFYITLQA
PPIB_MYCLE      -FFNNTKCHRLTTSLMLQCGDPKVDGTGGPGYKFANEYDPKLKQPVLYTLAMANSGPNTNGSQFFL-VYH
PPIA_PSEAE      GYYDGTLFHRVIPGFMVQTGGFSAGMQEKKTRAIKNEADNGLLNERG-TLAMARTGVVDSASQFFINLTD
CYP2_CAEEL      XXXX-----RIIPEFMIQXXXXXXXXXXXXXSIHGEKFDDE-NFKEKHVLSMANCGANTNGSQFFLCTVK
PPIL4_MOUSE     KYYNYCLIHNVQRDFIIQTGDPTGTGRGGESIFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGE
CWC27_DEBHA     --YIGTTFNKVIKDYLVQTSKIKEPATLK----LKDEFHSRLKFNKRGLVGAVHDDKSNNVDSLFITLKP
PPIL4_HUMAN     KYYNYCLIHNVQRDFIIQTGDPTGTGRGGESIFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGE
CP21C_ARATH     GYFKGFLFSRVVKHFVIQAGDSAEFDAVKDWALDRKNIDTSLKHEE-FMVGTPKAKNEQGGFEFFIVSAQ
PPIA_DICD3      -FYNGTIFHRVIPGFMVQGGGFSSDMKQKATNPVKNEADNGLRNLRGTISMARTSEKDSATSQFFINVAD
PPIA_SALTY      -FYNNTTFHRVIPGFMIQGGGFNEQMQQKKPNPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVAD
PPIA_ECOLI      -FYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVAD
PPIA_ECOL6      -FYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVAD
PPIA_ECO57      -FYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVAD
PPIL4_CRYNE     PTATGTGGESLASYVYSQSPSGPRPPRY-----FTPEILNSLKHTHKGTLSMAVANPPGCGSQFFITLAD
PPIL4_GIBZE     PLSKDSDGGSSIWGHL---------SGDPSERTFPAFFHPKLKHLERGTVSMATAPLQSDGSQFIITLQD
PPI1_SYNY3      -FYNGLTFHRVVDGFVAQ----------------------------------------------------
PPIL4_NEUCR     PLSSESDGGQSIWGLL---------SGDPSEKTFPALFHPKLKHLERGTVSMATSDPDTRGSQFIVTLDN
PPI1_BRUSU      A-YNGVAFHRVIPGFMAQDKGFDAARVGTGGSNYPDEFSKE-PFVRGTVGMARSQNPNSANSQFFIMFDD
PPI1_BRUME      A-YNGVAFHRVIPGFMAQDKGFDAARVGTGGSNYPDEFSKE-PFVRGTVGMARSQNPNSANSQFFIMFDD
PPI1_BRUAB      A-YNGVAFHRVIPGFMAQDKGFDAARVGTGGSNYPDEFSKE-PFVRGTVGMARSQNPNSANSQFFIMFDD
PPI1_BRUA2      A-YNGVAFHRVIPGFMAQDKGFDAARVGTGGSNYPDEFSKE-PFVRGTVGMARSQNPNSANSQFFIMFDD
CWC27_YARLI     -YYDSKPFYRVLPGELIQCGQQEAGNNTNSYPKLKDEPHTRIKLKRGY-LAMASRVPNSATTEFFIALKE
CWC27_YEAST     TFTNGEFKELKPTQWLM-----FNANSTGEYRTVAEEKNPRIRFNRDGLL-----GWDRRRNTWFITVAD
CYP8_YEAST      DFPNGAIEGXXXXXXXIEETEMLAP-------KLPEENH-SLIHDRPGRVSMIK---DDKGLKFIIETSE


                         +         .         .         .         .         *         .:210
query           TPHLNNAHTIFGEVTDAESQKVVDAIATTATDRYDRPADAVVIESVEITA
PPIA_MYCTU      TPHLNRRHTIFGEVIDAESQRVVEAISKTATDGNDRPTDPVVIESITIS-
PPIA_MYCBO      TPHLNRRHTIFGEVIDAESQRVVEAISKTATDGNDRPTDPVVIESITIS-
PPIA_MYCLE      TPHLNRRHTIFGEVTDPDSQKVVDAISTTATDGNDRPTEPVVIDSITIS-
PPIB_STRCH      TAWLTGKHTIFGEVSGEAGRKVVDAIAATPTNRTDRPLEDVVIESVVV--
PPIL1_CRYNE     TPYLDGKHTIFGRV--SSGMKTIQRLEAVRTDKDDRPVEEIKIHRARL--
PPWD1_BOVIN     TPWLDNKHTVFGRVT--KGMEVVQRISNVKVNKTDKPYEDVSIINITV--
PPWD1_PONAB     TPWLDNKHTVFGRVT--KGMEVVQRISNVKVNKTDKPYEDVSIINITV--
PPWD1_HUMAN     TPWLDNKHTVFGRVT--KGMEVVQRISNVKVNKTDKPYEDVSIINITV--
PPIB_TREPA      TPWLDGKHTVFGKV--VEGMEVVHAIIAGDTIR-----------------
PPWD1_MOUSE     TPWLDNKHTVFGRV--SKGMEVVQRIFNVKVNQTDKPYEDVSIINITV--
BPPI_STRP6      TPHLDRRHTVFGQLVDETSFQVLDLIAGVETGAQDKPKEDVIIETIEV--
CYP15_RHIOR     TTWLDNKHSVFGRVT--AGMDVVHSIESAKVDKTNKPLDDIKIINIDI--
PPID_GIBZE      TPHLDGKHVVFGEVLNGKS--VVRQIENLTTQSGDRPAEALIVDCGELT-
PPIL1_NEUCR     TPWLDGKHTIFGRV--KKGMGVIRRMGMVPTDKEDRPATEVKIVKARV--
PPIL1_MOUSE     TQWLDGKHTIFGRV--CQGIGMVNRVGMVETNSQDRPVDDVKI-------
PPIL1_HUMAN     TQWLDGKHTIFGRV--CQGIGMVNRVGMVETNSQDRPVDDVKI-------
PPIL1_BOVIN     TQWLDGKHTIFGRV--CQGIGMVNRVGMVETNSQDRPVDDVKI-------
PPIL1_ASPFU     TPWLDGKHTIFGRV--KSGMRVIQRMGLVKTNSEDRPVDEVKI-------
PPID_KLULA      TPHLDGKHVVFGEV--IQGKRLVRTIENNATDEADKPAKEVKIE------
CYP9_SCHPO      TPWLDGKHTIFARA--YAGLDVVHRIEQGETDKYDRPLEPTKIINISI--
PPID_EMENI      TPHLDGKHVVFGEVINGKS--VVRKIENMPTQADKPTTDVTIAECGELT-
PPIL1_RHIOR     TPWLDGKHTIFGRVSD--GMNVVKRMGLVKTDANDR--------------
PPIL1_EMENI     TPWLDGKHTIFGRV--KSGMRIIQRMGLVKTNNEDRPLDEVKI-------
PPID_RHIOR      TPHLDGKHVVFGKV--LKGKAVVRALENLETVS-DRPVEDAVI-------
PPIL1_ASPOR     TPWLDGKHTIFGRV--KSGMRVIQRMGLVKTNGEDRPVDEVKI-------
PPID_NEUCR      TPHLDGKHVVFGEVLSGKS--VVRQIENLKTQGDKPTKDAVIADCGELS-
PPIL1_ASPNG     QPWLDGKHTIFGRV--KSGMRVIQRMGLVKTNSEDRPVDGVKI-------
PPID_CRYNE      TPHLDGKHVVFGRVIYNRSVRRIENIPTTS----DRPDQAVTISSAGV--
PPIC_MOUSE      PTWLDGKHVVFGKVLD--GMTVVHSIELQATDGHDRPTDCTIVNSGKI--
PPID_DICDI      TPHLNGGHTVFGEV--VEGFDIVKKVENAETDRSDRPKAACVIE------
PPID_CANGA      TPHLDGKHVVFGEV--IEGKRLVRLIEKQQTDGTDKPMHDVKVE------
CYP1_BRUMA      APHLNNIHVVFGKV--VSGQEVVTKIEYLKTNSKNRPADVVILNCGEL--
PPID_SCHPO      TPHLDGKHVVFGKVIQGKSTRTIENLET----KNDDPVVPVVIE------
PPID_ASPFU      TPHLDGKHVVFGEVINGKS--IVRKIENMPTQADKPTTDVTIVDCGELS-
PPIB_ASPNG      TPWLDGRHVVFGEV--LEGYEIVAQIENVPKGRSDRPVETVIVKSGEL--
PPIL1_SCHPO     TPWLDGKHTIFGRVVSGLS--VCKRMGLIRTDSSDRPIEPLKI-------
PPIB_ASPFU      TPWLDGRHVVFGEV--LEGYEVVEQIENVPKGPGDKPAETVKI-------
SDC10_DANRE     ADELNNKHTIFGKVTGDTVYNML-RLADVACDGDERPLNPHKIRSTEV--
PPID_AMAMU      TPHLDGKHVVFGEVIKGRS--VVRTIENNPATNGDVPKEPVVI-------
SDC10_BOVIN     ADELNNKHTIFGKVT---GDTVYNMLRLTEVDIDDRPRNSHKIRSCEV--
PPIL2_CRYNE     TPHLDGKHTVFGKLVGGE--ETLDKIRVNVRPGGDRPVRDIVIQGVTV--
PPID_YARLI      TPHLDNKHVVFGKLLSGKG--IVRQIERTETGEQDRPKQPVTI-------
SDC10_RAT       ADELNNKHTIFGKVT---GDTVYNMLRLTEVDIDDRPRNPHRIKSCEV--
SDC10_MOUSE     ADELNNKHTIFGKVT---GDTVYNMLRLTEVDIDDRPRNPHRIKSCEV--
PPIL3_GIBZE     APHLDGLNTVFGRVIGDEGLATLAKMEAVEVDRKNRPKEPVRIENVTIHA
PPIL1_GIBZE     TPWLDGKHTIFGRV--KSGMGTIKRMGLVKTGSEDRPVEEVKIVKARV--
PPID_ASPOR      TPHLDGKHVVFGEVINGKS--VVRKVENMNTQADKPVKDVTIVECGELT-
PPIB_SCHMA      TSWLDGKHVVFGKV--VEGMNIVRQIESETTDSRDRPVKSIKIAS-----
PPIC_BOVIN      PTWLDGKHVVFGKVLD--GMTVVHSIELQATDGHDRPTDCSIVNSGKI--
PPIH_EMENI      TPFLNGKHVVFGQVID--GMDIVRMIENTRTTRDKPNQDVVIIQCGEM--
PPID_ASHGO      TPHLDGKHVVFGEV--IQGKRVVRAIERQET-AADRPLADVRIDACGI--
PPIB_SCHJA      NPWLDGKHVVFGKV--VEGMSVVRQIENMQTDSRDRPVKSVKI-------
PPIH_ASPFU      TPFLNGKHVVFGQVVD--GMDIVRMIENTRTIR-DKPSQDVII-------
PPIB_EMENI      TPWLDGKHVVFGEV--LEGYDIVDKIQNVPKGRNDRPKDVKIVKSGEL--
CYPE_DICDI      TPWLDGKHTIFGRV--KSGMKVVQKMNAMQTNN-DKPIDEIRI-------
PPIL3_CRYNE     QPSLDGKYSIFGKVID--GMETLDSMEKTPVNPKSRPLQEIKLLNVTVHA
PPIA_HELPJ      LPHLDGEHTVFGKITSAESLSVLDKI------------------------
PPIC_HUMAN      PTWLDGKHVVFGKVID--GMTVVHSIELQATDGHDRP-------------
PPIB_GIBZE      TSWLDGKHVVFGEV--LEGYEIIEKIENSKTGAADRPVEAVKI-------
SDC10_PONAB     ADELNNKHTIFGKVTGDTVYNML-RLSEVDIDDEERPHNPHKIKSCEV--
SDC10_MACFA     ADELNNKHTIFGKVTGDTVYNML-RLSEVDIDDEERPHNPHKIKSCEV--
PPID_DEBHA      TPHLNGKHVVFGEVIQGKS--IVRQLERCDKGENDKPVEDWII-------
SDC10_HUMAN     ADELNNKHTIFGKVTGDTVYNML-RLSEVDIDDDERPHNPHKIKSCEV--
PPIL3_USTMA     QPHLDGKYTIIGKVIDAEDGGTLDAMEAIPVDAKNRPTSEIRMTGVTVHA
PPIL3_NEUCR     APHLDGLNTVFGKLIGDESLQTLAKLEGLEVDKKNRIKEEVRIERVTVHA
PPIB_CRYNE      TAWLDNRHVVFGHV--LEGMDVVYAMENVKTSRGDKPVEPITI-------
SDC10_XENLA     ADELNNKHTIFGKVTGDTIYNIL-RLAEVDIGEDERPVNPHKIKCTEV--
PPID_YEAST      TPHLDGKHVVFGEV--IQGKRIVRLIENQQCDQ-----------------
PPIA_STRCH      TPWLDGKHVVFGEVADDDSMALVRKIEALGSSSGRTSAKVTIAES-----
PPI_SYNE7       QPHLDGVHTTFGQTEDDESLKVVRSL------------------------
PPIB_SCHPO      TPWLDGHHVVFGEV--LSGYDIVKKISKAETDNRDKPLEDVKI-------
CYPX_USEUD      TPHLDGKHVVFGKV--VEGMDVVRKIEATQTDRGDKPLSEVKI-------
PPIB_ORPSP      TSWLDGRHVVFGKV--IEGMDVVTAIETTKTLPGDRPATPVII-------
PPIA_HELPY      LPHLDGEHTVFGKITSAEGLSVLDKI------------------------
PPI1_STAES      TPWLDQKHTVFGQLIEGES--TLEDIANTKVGAQDKPVYDVVIESIDV--
PPI1_STAEQ      TPWLDQKHTVFGQLIEGES--TLEDIANTKVGAQDKPVYDVVIESIDV--
CYPH_NEUCR      TSWLDGRHVVFGEVADDESMKVVKALEATGS-------------------
PPIB_ASPOR      TPWLDGRHVVFGEV--LEGYEVVEAIENVPKVPGDKPQQVVIVKSGEL--
PPI1_STAAW      TPWLDQKHTVFGQIIDGET--TLEDIANTKVGPQDKPLHDVVIESIDV--
PPI1_STAAS      TPWLDQKHTVFGQIIDGET--TLEDIANTKVGPQDKPLHDVVIESIDV--
PPI1_STAAR      TPWLDQKHTVFGQIIDGET--TLEDIANTKVGPQDKPLHDVVIESIDV--
PPI1_STAAN      TPWLDQKHTVFGQIIDGET--TLEDIANTKVGPQDKPLHDVVIESIDV--
PPI1_STAAM      TPWLDQKHTVFGQIIDGET--TLEDIANTKVGPQDKPLHDVVIESIDV--
PPI1_STAAC      TPWLDQKHTVFGQIIDGET--TLEDIANTKVGPQDKPLHDVVIESIDV--
PPI1_STAAB      TPWLDQKHTVFGQIIDGET--TLEDIANTKVGPQDKPLHDVVIESIDV--
PPI1_STAA8      TPWLDQKHTVFGQIIDGET--TLEDIANTKVGPQDKPLHDVVIESIDV--
PPI1_STAA3      TPWLDQKHTVFGQIIDGET--TLEDIANTKVGPQDKPLHDVVIESIDV--
CYPC_YEAST      CPWLDGKHVVFGEVT--KGMDIVKAIESYGTASGKPRAEIVIEEAGEL--
CYP8_CAEEL      VPHLDGKHCVFGEV--IKGVEVVKAIENLETGNEDKPVCKVEI-------
PPID_CANAL      TPHLDGKHVVFGEVIEGKS--IVRQLERSEKGANDRPVE-----------
PPIB_NEUCR      TSWLDGKHVVFGEV--LEGYDVVEKIENTKTGPRDAPAEPIKI-------
CYPB_VICFA      TPWLDNRHVVFGHV--IEGLDVVKQLESQETSKLD---------------
PPIA_CANAL      CPWLDGKHVVFGEVTD----------------------------------
PPIL2_SCHPO     AKHLDNKHTIFGRVVG--GLNVLDALEKVPTNSNDHPKLPIKLEDIII--
CYP11_RHIOR     TPHLDGKHVVFGRV--VSGYNVVEMMENEPVDDQDRPLHNVMI-------
PPIL3_RHIOR     HPHLDTKYTVFGKVIDG-ADSTLDMMEKVPVDEKHRPLQEFRIKSVTIHA
PPIL3_CHICK     QPHLDMKYTVFGKVIDG-LETLDELEKLPVNEKTYRPLNDVHIKDITIHA
PPI1_STAHJ      TPWLDQKHTVFGQLIEGEA--TLEDIANTKVGAQDKPVHDVVIESIDV--
CP20B_ARATH     TSWLDGRHVVFGQV--IEGMEVVKLIEEQETDRGDRPRKKVVI-------
PPIL3_DICDI     HRSLNKVYTVFGKI--IAGIEVLDLMEKVPVDDKDLPLNEIILKSVTIHA
PPIH_ASPOR      TPFLNNKHVVFGQV--VEGMDVVRMIENTRTTRDKPNQDVTIIQCGEM--
CYP6_CAEEL      TSWLDGKHVVFGKI--LEGMDVVREIEATPKGAGDRPIEDVVI-------
CWC27_CRYNE     APELTNKHTMFGKIVGNTIFNVLN-IGNLDTDKEERPLIPPKIRRIHI--
PPIL2_RHIOR     APHLDGLHTVFGKVVG--GLDVLSKLESIPVDEKDRPEREIKIKQIQM--
PPIB_YARLI      TSWLDGKHVVFGEV--LEGQDIVDAIENAPTGARSNPVDITIADAGEI--
PPIB_ARTBE      TAWLDGKHVVFGEV--LEGYDIVDKIQVVPKGFQDRPTKDVKI-------
CYP40_ARATH     TSHLDGKHVVFGRVT--KGMGVVRSIEHVSIEEQSCPSQDVVI-------
CWC27_RHIOR     ADELTKRHTLFGRVA-GDTLFNVMKMTELEIDENERPLYPPRIKRTEI--
PPIL3_RAT       QPHLDMKYTVFGKVIDG-LETLDELEKLPVNEKTYRPLNDVHIKDITIHA
PPIL3_MOUSE     QPHLDMKYTVFGKVIDG-LETLDELEKLPVNEKTYRPLNDVHIKDITIHA
PPIL2_HUMAN     CAYLDKKHTIFGRVVGGFD--VLTAMENVESDKTDRPKEEIRIDATTV--
PPIL3_HUMAN     QPHLDMKYTVFGKVIDG-LETLDELEKLPVNEKTYRPLNDVHIKDITIHA
CYPH_SCHPO      TPWLDGKHVVFGEVTE----------------------------------
PPIL2_MOUSE     CAYLDKKHTIFGRVVGGFD--TLTAMENVESDKTDRPKEEVLI-------
PPIL2_GIBZE     TPHLDRKHTVFGKV--VENINVLSKMENVPTDGSNRP-------------
PPIB_RAT        TSWLDGKHVVFGKV--LEGMDVVRKVENTKTDSRDKPLKDVII-------
PPIB1_RHIOR     TPWLDGKHVVFGRV--LEGMDVVTKIENTPTGSRSKPSVDVVI-------
PPIB_MOUSE      TSWLDGKHVVFGKV--LEGMDVVRKVESTKTDSRDKPKDVIIVDSGKI--
PPIB2_RHIOR     TSWLDGKHVVFGKV--LEGMDVVTKIEKTPTNYRSKPNVDVVI-------
CP20C_ARATH     TSWLDNKHVVFGQV--IEGMKLVRTLESQETRAFDVP-------------
PPIH_GIBZE      TPFLDNKHVVFGKV--FEGMDVVKKMEATKT-------------------
PPI1_STAS1      TPWLDQKHTVFGQL--IEGKDTLEDIANTKVGPQDKPLHDITIDSIEI--
CYP9_CAEEL      APHCNGKHVVFGEV--VKGQNVVDYIDNLAVDDKSKPLAKVLISN-----
PPIB_HUMAN      TAWLDGKHVVFGKV--LEGMEVVRKVESTKTDSRDKPLKDVII-------
CYPD_YEAST      CPWLDGKHVVFGEVLD--GMDVVHYIENVKTDSRNMPVEVIIVESGEL--
CYP5_CAEEL      TPWLDGRHVVFGKI--LEGMDVVRKIEQTEKLPGDRPKQDVII-------
PPIA_PARPR      CPWLDGKHVVFGEVVD----------------------------------
PPIH_USTMA      CPFLDGKHVVFGKVVD----------------------------------
PPIG_RAT        TPHLDGHHVVFGQV--ISGQEVVREIENQKTDAASKPFAEVRILS-----
PPIG_MOUSE      TPHLDGHHVVFGQV--ISGQEVVREIENQKTDAASKPFAEVRILS-----
PPIG_HUMAN      TPHLDGHHVVFGQV--ISGQEVVREIENQKTDAASKPFAEVRILS-----
PPID_HUMAN      TPHLDGKHVVFGQV------------------------------------
PPIB_BOVIN      TAWLDGKHVVFGKV--LEGMDVVRKVESTKTDGRDKPLKDVTI-------
CYP6_RHIOR      TPWLDGNHTVFGQIVD--GSKVLDLL------------------------
PPID_BOVIN      TPHLDGKHVVFGQV------------------------------------
PPI2_SYNY3      CPWLDGKHVVFGEVVE----------------------------------
CYPH_MAIZE      TPWLDGKHVVFGQV--VEGMDVVKAIEKVGT-------------------
CYP5_RHIOR      TPWLDGNHTVFGQL--VEGNQVLEILEQHGTQSGMPTAKVEIVDCGEI--
CYP1_CAEEL      TPWLDGGHVVFGQVTDGMS--VVKKIEKMGS-RSGAPAKTVTI-------
PPIL2_NEUCR     ASHLDRKHTIFAKVIEGQ-DTTLTAMENVATDGSDRPLNKIVIKDMII--
CYPR_DROME      AKWLDGKHTVFGKV--LEGMDTIYAIEDVKTDTDDFPVEPVVISN-----
CYPR_CALVI      AQWLNGKHTVFGKV--IEGMDTVYAIEDVKTDTDDHPIDPVII-------
CYP10_CAEEL     QAHLDMKYTLFGKVIDGFD--TLEEIETIKVDNKYRPLVQQKIQNVTIHA
CYPH_YEAST      CPWLDGKHVVFGEVVD--GYDIVKKVESLGSPSGATKARIVVAKSGEL--
PPID_RAT        TPHLDGKHVVFGQV------------------------------------
CYP9_CAEBR      APHCNGKHVVFGEV------------------------------------
PPID_MOUSE      TPHLDGKHVVFGQV------------------------------------
PPIL2_ASPOR     LPHLNNKHTIFGHVID----------------------------------
PPIL2_ASPFU     LPHLNNKHTIFGHVID----------------------------------
PPIH_SCHPO      CDFLDGKHVVFGEV--IEGYDIVKEIESTPVGANSRPKSNVAI-------
CYPB_YEAST      ASWLDGKHVVFGQVVD--GMDVVNYIQHVSRDANDKPLEAVKI-------
NKTR_MOUSE      APHLDGVHVVFGLV--ISGFEVIEQIENLKTDAASRPADVRVID------
NKTR_HUMAN      APHLDGVHVVFGLV--ISGFEVIEQIENLKTDAASRPADVRVID------
CYP7_SCHPO      TPEWNGKQTLFGRVVGDTIYNVV-RISELELDANQRPVFPPKIISTEV--
CP19C_ARATH     TSWLDGKHVVFGKVVD--GYNVVKAMEDVGSD-MGNPSERVVIE------
PPIL2_USTMA     VPHLDGKHTVFGRLVDGDKDATLTKMEQVPSEQTDRPLKKIQIQDVLVT-
PPIA_NEOCA      TEWLDGRHVVFGKITN-DSWPTVQAI------------------------
PPIA2_RHIOR     CSWLDGAHVVFGKVT-----------------------------------
CYPH_SOLLC      TEWLNGKHVVFGQVVE----------------------------------
CWC27_GIBZE     AEELNGKNTMFGRIAGDTVYNLAKMGEGEVDEATERPTYPVKIERIEI--
PPIB_BACSU      QPHLNGVHTVFGKVT-----------------------------------
PPIA_PONPY      TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
PPIA_PAPAN      TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
PPIA_PANTR      TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
PPIA_PANPA      TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
PPIA_MACMU      TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
PPIA_HYLSY      TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
PPIA_HYLLE      TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
PPIA_HYLLA      TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
PPIA_HUMAN      TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
PPIA_GORGO      TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
PPIA_FELCA      TEWLDGKHVVFGMV--KEGMNIVEAM------------------------
PPIA_CERAE      TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
PPIL2_EMENI     LPHLNLKHTIFGHVID----------------------------------
PPIA_SAGOE      TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
PPIA_RABIT      TEWLDGKHVVFGRV--KEGMSIVEAM------------------------
PPIA_PIG        TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
PPIA_MOUSE      TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
PPIA_CRIGR      TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
PPIA_BOVIN      TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
PPIA_AOTTR      TEWLDGKHVVFGKV--KEGMNIVEAM------------------------
CWC27_NEUCR     ADELTGKNTMFGRVAGDTIYNLAKIGEAEVEEGGERPLYPIKITRIEI--
PPIA_RAT        TEWLDGKHVVFGKV--KEGMSIVEAM------------------------
CYPH_ALLCE      TAWLDGKHVVFGQV--VEGMDVVRAI------------------------
PPIB_CHICK      TAWLDGKHVVFGKV--LEGMDVVRKVENTKTDSRDKPLKDVTI-------
PPIA_SCHMA      CSWLDGKHVVFGKVVSGDVVKKMESLGSTS----GKPSKKIIIE------
CYPH_CATRO      TEWLDGKHVVFGQV--VEGMDVVKAIEKVGSSS-GRTAKKVVVE------
CYP3_CAEEL      TEWLDGKHVVFGRV--VEGLDVVKAVESNGSQSGKPVKDCMIADCGQLKA
CYPH_UROFA      TPWLDGKHVVFGKVIEGYDQ-VVKAMEKTGS-------------------
CP20A_ARATH     TSWLDGRHVVFGKV--VTGMDVVYKVEAEGNQSGTPKSKVVIVDSGEL--
CP19D_ARATH     TSWLDGRHVVFGKV--VQGMDVVYKIEAEGKQSGTPKSKVVIADSGEL--
PPIH_NEUCR      TPFLDGKH------------------------------------------
CP18D_ARATH     TSWLDGKHVVFGQV--VKGLDVVKAIEKVGSD------------------
PPID_USTMA      TPHLDGKHXXXXXXXXXXXXXXXESVETVASDR--PKEDVKIVDCGELT-
PPIA_DROME      TAWLDNKHVVFGEVVE----------------------------------
PPAL4_HUMAN     TEWLDGKHVAFGKV--KERVNIVEAM------------------------
CP18C_ARATH     TDWLDGKHVVFGQV--VEGLDVVKAIEKVGSSS-GKPTKPVVV-------
PPIA_ECHGR      TSWLDGKHVVFGEVESGEDVKDMEAVGSSS--------------------
CWC27_ASPFU     AEELNGQCTLFGRVEGDSIYNVLKIAEAERVERTERPVYPVKVVSCEV--
PPIA_HEMPU      TSWLDGKHVVFGAVT-----------------------------------
CP19B_ARATH     TDWLDGKHVVFGQVVEGDVVKAIEKIGSSS----GKPTKPVVI-------
PPIA_BLAGE      TSWLDNRHVVFGSVVE----------------------------------
CYPH_ENCCU      TQWLDEKHVVFGEV--VEGMDVVHKIA-----------------------
PPIB_ECOLI      NDFLNFSYCVFAEVVD--GMDVVDKIKGVATGRQDVPKEDVIIESVTVS-
PAL4B_HUMAN     TEWLDGKHVAFGKV--KERVNIVEAM------------------------
CYP7_CAEEL      TAWLDGKHVVFGRVVE----------------------------------
PPIH_HUMAN      CDWLDGKHVVFGKIID--GLLVMRKIENVPTGPNNKPKLPVVI-------
PPIH_BOVIN      CDWLDGKHVVFGKIID--GLLVMRKIENVPTGPNNKPKLPVVI-------
CYPH_LUPLU      TEWLDGKHVVFGKVIE----------------------------------
CYP4_CAEEL      CKYLDRKHTIFGRLVGGQ--------------------------------
CYP11_CAEEL     TDFLDNKHVVFGRVLD--GMLTVRKIENVPTGANNKPKLPIVV-------
PPIH_MOUSE      CDWLDGKHVVFGKIID----------------------------------
PPIH_CRYNE      AEFLDGKHCVFGRVIDGLTVRKIENVPTGANNR-----------------
RBP2_MOUSE      AEHLDFKHVVFGFVKD----------------------------------
RBP2_HUMAN      AEHLDFKHVVFGFVKD----------------------------------
PPIF_BOVIN      TDWLDGKHVVFGHVKE----------------------------------
CP19A_ARATH     TSWLDGKHVVFGQV--VEGLNVVRDIEKVGSDS-GRTSKPVVI-------
RBP2_BOVIN      AERLDFKHVVFGFVKD----------------------------------
PPIE_SCHJA      CDWLDGKHVVFGRVVDGQN-------------------------------
PPIA1_RHIOR     CSWLDGKHVVFGRVTE----------------------------------
PPIF_RAT        TDWLDGKHVVFGHVKE----------------------------------
PPIF_MOUSE      TDWLDGKHVVFGHVKE----------------------------------
PPIF_HUMAN      TDWLDGKHVVFGHVKE----------------------------------
CYPH_BRANA      TSWLDGKHVVFGQV--VEGMDVVRDIEKVGSD------------------
CWC27_EMENI     TEELNGQCTLFGRLEGDSLYNMLKIAEAERIEGTERPVYPVKITSCEV--
PPIL2_ARATH     ATHLNYKHTXXXXXXXXLA--TLAAMENVPVDESDRPLEEIKI-------
PPIE_SCHMA      CDWLDGKHVVFGRVVDGQN-------------------------------
CWC27_USTMA     TPELTGKHTLMGKV------------------------------------
PPIE_BOVIN      TDWLDGKHVVFGEITD----------------------------------
PPIL3_EMENI     APHLDGSSTVFGKVLNLTAE------------------------------
PPIH_RHIOR      CDFLDGKHVVFGRLVDGLTLRKIENVATGPNNRPKLP-------------
PPIE_PONAB      TDWLDGKHVVFGEVTE----------------------------------
PPIE_MOUSE      TDWLDGKHVVFGEVTE----------------------------------
PPIE_HUMAN      TDWLDGKHVVFGEVTE----------------------------------
CYP7_YEAST      APHLNGKHSIFGQVVHGKS--VVRTIENCRVDSDGVPESDVRI-------
PPIE_RHIOR      TTWLDGKHVVFGQV------------------------------------
PPIA_ACIAD      NNFLNASRTVFGKV--IKGMDVVDKIANVPTSTYNVPKQPVKIISVQI--
CYPR_YEAST      NEELDGKSVVFGQITSGLDQ-LMDAIQYTETDEYGKP-------------
PPIL3_ASPFU     APHLDGASTVFGKVLNLSPQ------------------------------
PPIB_STRAT      NAFLNHGYAVFGRVT--EGQDVVDAIKGVKTGHQDVPVQPVVIESAKI--
PPIB_HAEIN      NDFLNYGYAVFGEV--VEGMDVVDKIKKVKTGHQDVPTEDVVITSVSI--
PPIE_DROME      TDWLDNKHVVFGHV------------------------------------
PPIL4_RHIOR     NDYLDGKYTLFGEI--AEGFDVLDKINEAYCDEQGRP-------------
PPIB_MYCTU      DSKLPPQYTVFGTI-QADGLTTLDKIAKAGVGEDGKPATEVTITSV----
PPIL6_BOVIN     APYLDKKYVAFGQL--IEGTDVLHHLESVPTEN-ERPIQNCVI-------
PPIL6_HUMAN     TPYLDRKFVAFGQLIETEVLKQLELVPT----------------------
PPIB_MYCLE      DSQLPPEYTVFGTI-QADGLATLDKIAKIASGGDDPPATEVTIESLRL--
PPIA_PSEAE      NDFLNHGYAVFGKV--VRGMGVVDQIAKVPTTRADVPSDDVVILSAK---
CYP2_CAEEL      TTWLDGKHVVFGKV--IEGMDVVKAIESKGSEDGAPSAPCVIADCGEM--
PPIL4_MOUSE     NDYLDGVHTVFGEVT--EGMDIVKKINETFVDK-----------------
CWC27_DEBHA     TPEFNNNYVLFGKIMGDSIYNVV---------------------------
PPIL4_HUMAN     NDYLDGVHTVFGEVT--EGMDIIKKINETFVDK-----------------
CP21C_ARATH     IKDLNEKLTVFGRV--SKGQDVVQEIEEVETDDQYQPKSPIEIMSVTL--
PPIA_DICD3      NAFLDHGYAVFGKV--VKGMEVADKISQVQTENQNVPSKPIVIQSAKI--
PPIA_SALTY      NAFLDHGYAVFGKV--VKGMDVADKISQVPTPYQNVPTKPVVILSAKV--
PPIA_ECOLI      NAFLDHGYAVFGKV--VKGMDVADKISQVPTPYQNVPSKPVVILSAKV--
PPIA_ECOL6      NAFLDHGYAVFGKV--VKGMDVADKISQVPTPYQNVPSKPVVILSAKV--
PPIA_ECO57      NAFLDHGYAVFGKV--VKGMDVADKISQVPTPYQNVPSKPVVILSAKV--
PPIL4_CRYNE     NDYLDGKHAVFGHV--IEGLDTLDKINDAFTDKEGRPLQNIRIRHVEI--
PPIL4_GIBZE     TDFLDGKAAIFGKV--VEGFEALDKINEAIVDEKGHP-------------
PPI1_SYNY3      --------------------------------------------------
PPIL4_NEUCR     TDYLDGKAAIFGKVVEGFDEKINDAI------------------------
PPI1_BRUSU      GPFLNGQYTVVGKV------------------------------------
PPI1_BRUME      GPFLNGQYTVVGKV------------------------------------
PPI1_BRUAB      GPFLNGQYTVVGKV------------------------------------
PPI1_BRUA2      GPFLNGQYTVVGKV------------------------------------
CWC27_YARLI     IPF---SGTVIGKITGDTIYNAQD-IARGELTEDGYPMYVQTVQNVEI--
CWC27_YEAST     SKHVLNDCNVFGKI------------------------------------
CYP8_YEAST      TP-LEGESVVFGQVT-AGLKDLMDKLANVKTDENGKPEQPITI-------