[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF53115.1

[Show Plain Result]


## Summary of Sequence Search
    1::383
    8::376     2e-87  46%  383 aa  INSI_ECOLI RecName: Full=Transposase insI for insertion sequence
   13::323     1e-60  45%  339 aa  TRA8_RALME RecName: Full=Transposase for insertion sequence element
    5::317     1e-35  31%  326 aa  TRA4_BACFR RecName: Full=Transposase for insertion sequence element
   17::337     4e-25  32%  342 aa  TRA1_STRSL RecName: Full=Probable transposase for insertion-like
   33::318     8e-07  23%  322 aa  INTG_SPV1R RecName: Full=Putative integrase ORF3;AltName: Full=Gene
    1::383

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxDQRQKVWDLWKTGSSISDISRDVGSPPGSIFSILLPRGGIYLPAQKHHPGTLTLAEREE
INSI_ECOLI      -----------EEKASVFELWKNGTGFSEIANILGSKPGTIFTMLRDTGGIKPHERKRAVAHLTLSEREE
TRA8_RALME      ------------------------------------------------------------------ERMR
TRA4_BACFR      --------------------------------------------------------------ITEEQRYA
TRA1_STRSL      --------------------------------------------------------------LSEAERGE
INTG_SPV1R      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ISRGLSVGLSYRAIARLTGRSASTISREVTRNRGRTAYRAIDADDRSWRQARRPQRCKLAKNPVLRGYVA
INSI_ECOLI      IRAGLSAKMSIRAIATALNRSPSTISREVQRNRGRRYYKAVDANNRANRMAKRPKPCLLDQNLPLRKLVL
TRA8_RALME      IEIWKAEDVSLRAMARRLGRAPSTLMRELRRNAARGGYGAMSAQARTQRKASRPV-AKLAPDGVLWGVVR
TRA4_BACFR      ISMMLQIPMSKKAIAEAIGVDKSTVYREIKRNDARSGSYSMELAQRKADRRKQQKHRKEVLTPAMRKRII
TRA1_STRSL      IEAYLSVGLKPAEIARRLGRNRSTITREINRGSITQVKKVNGAKGRHAREASYYLKLDSVSDDFMRAFTD
INTG_SPV1R      ------------AIAKYLNRHRSTILREIKRFKTIDEYSAYKSDKMYYEXXXXXXXXXXXTEEQLNFHLR


                         +         .         .         .         .         *         .:210
query           ARLREDWSPEQIAGRLKITYACTSRMQISHESIYKSLFIQSRGVLPKDLQKHLRSRRPIRKARSNTTSGQ
INSI_ECOLI      EKLEMKWSPEQISGWLRRTKPRQKTLRISPETIYKTLYFRSREALHHNIQXXXXXXXXXXXXXXXXKGER
TRA8_RALME      HFLDQKWSPQEISATLKRAFPDQPDLNVSHETIYNAIYAYPRGELRRQLIACLRQARTKRLPRSRGTDR-
TRA4_BACFR      KLLKKGFSPEQIVGRSRLEGIA----MVSHETIYRWIWEDKRR--GGKLHKYLRRQGRRYAKRGSKNAG-
TRA1_STRSL      A-MREKPRVHSVD-----TFVHTYRLQHSTKTLYNYIHQGLLEIKVIDLPRRVRIRKKFTK-RPSTKKHL
INTG_SPV1R      FNVYHD-SPSELIYRYFLKFKV--KFPVCVKTLYKWIRLGFYGFLKQNLXXXXXXXXXXXXSDN------


                         .         .         .         +         .         .         .:280
query           WRSQIKDAVSISKRPKEAEARVQVGHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIR
INSI_ECOLI      GTINIVNGTPIHERSRNIDNRRSLGHWEGDLVSGTKNSHIATLVDRKSRYTIILRLRGKDSVSVNQALTD
TRA8_RALME      -RGQIPDMVSIHVRPPEVNDRLMPGHWEGDLIKGANQSAVGVLVERMSRAVLLVKMPDATAASALAGFTG
TRA4_BACFR      -RGFIPGRVDIDERPEIVELKERFGDLEIDTIIGKNKGAILTINDRATSRVWIRKLSGKEAIPVAKIAVW
TRA1_STRSL      GKS-------IEERPEEINNRSRFGDWEIDSVLGGKEPSILTLVERQTRYAVTKKLVEKKAEYVNQAVLE
INTG_SPV1R      -RGKLTDFKSIWDIDNKVS---NVGWLEMDTVVGKDKSAILVLVEQLSKKYFAIKLENHTAREVEKKFKD


                         .         *         .         .         .         .         +:350
query           ELGQLPDQAKRSLTWDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFS
INSI_ECOLI      KFLSLPSELRKSLTWDRGMELARHLEFTVSTGVKVYFCDPQSPWQRGTNENTNGLIRQYFPKKTCLAQYT
TRA8_RALME      KLQSLVAPLRQTLTYDQGREMARHAELSAATGVRVYFCDPHSPWQRGTCENTNGLLRQYLPKGTDLSVYS
TRA4_BACFR      ALRKVKNLI-HTITADNGKEFAKHEEIAQKLEIKFYFCKPYHSWERGANENTNGLIRQYIPKGKDFSEVT
TRA1_STRSL      CMKLYPI---KSITADNGNEFSSLSKIE---GLDVYFAHAYSSYERGTNENFNGLLREFIPKGCSLKELN
INTG_SPV1R      XXXXXXXXXXXXXXXDRRKEFSKWREMEIFAETQVYFCDAGSPQQKPLIEYMNSELRHWFPKGTDFNKVS


                         .         .         .         .         *         .         .:420
query           QTDLDQVADKLNNRPRKVLGFRTPAEQYEALLx
INSI_ECOLI      QHELDLVAAQLNNRPRKTLKFKTPKEIIE----
TRA8_RALME      QEELDAIADSLNGRPRKTLNWHSPLQ-------
TRA4_BACFR      NKQIKWIENKLNNRPRKRLGYLTPNEKFKQII-
TRA1_STRSL      QNLLEDYTKAINERPRRIHGYQSAKKLFE----
INTG_SPV1R      QKQIDWVVNVINDKLRPCLNWISSKEMF-----