[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF53177.1

[Show Plain Result]


## Summary of Sequence Search
    1::136
    1::136     4e-73 100%  136 aa  PAND_CORGL RecName: Full=Aspartate 1-decarboxylase;       
    1::136     4e-73 100%  136 aa  PAND_CORGB RecName: Full=Aspartate 1-decarboxylase;       
    1::136     3e-66  88%  136 aa  PAND_COREF RecName: Full=Aspartate 1-decarboxylase;       
    1::128     5e-47  70%  141 aa  PAND_STRGG RecName: Full=Aspartate 1-decarboxylase;       
    1::132     7e-46  64%  136 aa  PAND_ACIC1 RecName: Full=Aspartate 1-decarboxylase;       
    1::128     9e-46  67%  137 aa  PAND_THEFY RecName: Full=Aspartate 1-decarboxylase;       
    1::136     6e-45  63%  148 aa  PAND_RHOE4 RecName: Full=Aspartate 1-decarboxylase;       
    1::133     1e-44  67%  135 aa  PAND_MYCVP RecName: Full=Aspartate 1-decarboxylase;       
    1::127     2e-44  65%  150 aa  PAND_KOCRD RecName: Full=Aspartate 1-decarboxylase;       
    1::128     4e-44  68%  141 aa  PAND_ARTCA RecName: Full=Aspartate 1-decarboxylase;       
    1::125     1e-43  65%  145 aa  PAND_MICLC RecName: Full=Aspartate 1-decarboxylase;       
    1::128     2e-43  66%  139 aa  PAND_STRCO RecName: Full=Aspartate 1-decarboxylase;       
    1::136     5e-43  62%  148 aa  PAND_RHOSR RecName: Full=Aspartate 1-decarboxylase;       
    1::136     5e-43  62%  148 aa  PAND_RHOOB RecName: Full=Aspartate 1-decarboxylase;       
    1::123     5e-43  72%  142 aa  PAND_MYCLE RecName: Full=Aspartate 1-decarboxylase;       
    1::123     5e-43  72%  142 aa  PAND_MYCLB RecName: Full=Aspartate 1-decarboxylase;       
    1::125     1e-42  67%  138 aa  PAND_RENSM RecName: Full=Aspartate 1-decarboxylase;       
    1::123     3e-42  65%  142 aa  PAND_ARTS2 RecName: Full=Aspartate 1-decarboxylase;       
    1::128     1e-41  61%  141 aa  PAND1_ARTAT RecName: Full=Aspartate 1-decarboxylase 1;       
    1::128     2e-41  62%  136 aa  PAND_MYCS2 RecName: Full=Aspartate 1-decarboxylase;       
    1::134     5e-41  62%  138 aa  PAND_CORJK RecName: Full=Aspartate 1-decarboxylase;       
    1::130     2e-40  63%  163 aa  PAND_SACEN RecName: Full=Aspartate 1-decarboxylase;       
    4::132     2e-40  61%  154 aa  PAND1_FRASC RecName: Full=Aspartate 1-decarboxylase 1;       
    1::131     3e-40  62%  139 aa  PAND_NOCSJ RecName: Full=Aspartate 1-decarboxylase;       
    1::136     3e-39  59%  139 aa  PAND_NOCFA RecName: Full=Aspartate 1-decarboxylase;       
    1::134     8e-39  60%  134 aa  PAND_MYCGI RecName: Full=Aspartate 1-decarboxylase;       
    1::126     2e-38  62%  170 aa  PAND_FRAAA RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-38  62%  138 aa  PAND_CLAM3 RecName: Full=Aspartate 1-decarboxylase;       
    1::122     4e-38  63%  143 aa  PAND_MYCUA RecName: Full=Aspartate 1-decarboxylase;       
    1::122     4e-38  64%  143 aa  PAND_MYCPA RecName: Full=Aspartate 1-decarboxylase;       
    1::122     4e-38  64%  143 aa  PAND_MYCA1 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     5e-38  66%  142 aa  PAND_SALTO RecName: Full=Aspartate 1-decarboxylase;       
    1::114     7e-38  62%  127 aa  PAND_NEIG2 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     7e-38  62%  127 aa  PAND_NEIG1 RecName: Full=Aspartate 1-decarboxylase;       
    1::122     2e-37  64%  135 aa  PAND_MYCSS RecName: Full=Aspartate 1-decarboxylase;       
    1::122     2e-37  64%  135 aa  PAND_MYCSK RecName: Full=Aspartate 1-decarboxylase;       
    1::122     2e-37  64%  135 aa  PAND_MYCSJ RecName: Full=Aspartate 1-decarboxylase;       
    1::120     2e-37  62%  141 aa  PAND_SALAI RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-37  61%  127 aa  PAND_NEIMB RecName: Full=Aspartate 1-decarboxylase;       
    1::114     5e-37  61%  127 aa  PAND_NEIMF RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-36  61%  127 aa  PAND_NEIMA RecName: Full=Aspartate 1-decarboxylase;       
    1::123     2e-36  58%  143 aa  PAND2_ARTAT RecName: Full=Aspartate 1-decarboxylase 2;       
    1::119     4e-36  59%  124 aa  PAND_CLOB8 RecName: Full=Aspartate 1-decarboxylase;       
    1::119     4e-36  60%  128 aa  PAND_CALS8 RecName: Full=Aspartate 1-decarboxylase;       
    1::131     1e-35  57%  139 aa  PAND_MYCTU RecName: Full=Aspartate 1-decarboxylase;       
    1::131     1e-35  57%  139 aa  PAND_MYCTA RecName: Full=Aspartate 1-decarboxylase;       
    1::131     1e-35  57%  139 aa  PAND_MYCBT RecName: Full=Aspartate 1-decarboxylase;       
    1::131     1e-35  57%  139 aa  PAND_MYCBP RecName: Full=Aspartate 1-decarboxylase;       
    1::131     1e-35  57%  139 aa  PAND_MYCBO RecName: Full=Aspartate 1-decarboxylase;       
    1::128     2e-35  60%  139 aa  PAND_STRAW RecName: Full=Aspartate 1-decarboxylase;       
    1::113     3e-35  61%  125 aa  PAND_HERA2 RecName: Full=Aspartate 1-decarboxylase;       
    1::115     1e-34  59%  130 aa  PAND_MYXXD RecName: Full=Aspartate 1-decarboxylase;       
    4::119     3e-34  58%  128 aa  PAND_CLOCE RecName: Full=Aspartate 1-decarboxylase;       
    1::109     4e-34  61%  126 aa  PAND_CLOTH RecName: Full=Aspartate 1-decarboxylase;       
    1::126     4e-34  54%  127 aa  PAND_BACSU RecName: Full=Aspartate 1-decarboxylase;       
    1::114     4e-34  56%  127 aa  PAND_BACA2 RecName: Full=Aspartate 1-decarboxylase;       
    1::117     8e-34  55%  127 aa  PAND_BACCR RecName: Full=Aspartate 1-decarboxylase;       
    1::117     8e-34  55%  127 aa  PAND_BACC4 RecName: Full=Aspartate 1-decarboxylase;       
    1::117     8e-34  55%  127 aa  PAND_BACC2 RecName: Full=Aspartate 1-decarboxylase;       
    1::115     8e-34  57%  131 aa  PAND_ANADF RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-33  57%  127 aa  PAND_LISMO RecName: Full=Aspartate 1-decarboxylase;       
    1::117     1e-33  55%  127 aa  PAND_BACSK RecName: Full=Aspartate 1-decarboxylase;       
    1::119     1e-33  55%  128 aa  PAND_ANATD RecName: Full=Aspartate 1-decarboxylase;       
    1::134     2e-33  55%  139 aa  PAND_CORU7 RecName: Full=Aspartate 1-decarboxylase;       
    1::128     2e-33  52%  132 aa  PAND_PELTS RecName: Full=Aspartate 1-decarboxylase;       
    1::122     2e-33  57%  134 aa  PAND_GEOBB RecName: Full=Aspartate 1-decarboxylase;       
    4::114     2e-33  55%  131 aa  PAND_ENTFA RecName: Full=Aspartate 1-decarboxylase;       
    1::117     3e-33  51%  127 aa  PAND_STAAR RecName: Full=Aspartate 1-decarboxylase;       
    1::117     3e-33  51%  127 aa  PAND_STAAN RecName: Full=Aspartate 1-decarboxylase;       
    1::117     3e-33  51%  127 aa  PAND_STAAM RecName: Full=Aspartate 1-decarboxylase;       
    1::117     3e-33  51%  127 aa  PAND_STAAE RecName: Full=Aspartate 1-decarboxylase;       
    1::117     3e-33  51%  127 aa  PAND_STAAC RecName: Full=Aspartate 1-decarboxylase;       
    1::117     3e-33  51%  127 aa  PAND_STAAB RecName: Full=Aspartate 1-decarboxylase;       
    1::117     3e-33  51%  127 aa  PAND_STAA9 RecName: Full=Aspartate 1-decarboxylase;       
    1::117     3e-33  51%  127 aa  PAND_STAA8 RecName: Full=Aspartate 1-decarboxylase;       
    1::117     3e-33  51%  127 aa  PAND_STAA3 RecName: Full=Aspartate 1-decarboxylase;       
    1::117     3e-33  51%  127 aa  PAND_STAA2 RecName: Full=Aspartate 1-decarboxylase;       
    1::117     3e-33  52%  127 aa  PAND_GEOKA RecName: Full=Aspartate 1-decarboxylase;       
    1::122     4e-33  57%  134 aa  PAND_GEOSM RecName: Full=Aspartate 1-decarboxylase;       
    1::117     4e-33  54%  127 aa  PAND_BACWK RecName: Full=Aspartate 1-decarboxylase;       
    1::117     4e-33  54%  127 aa  PAND_BACHK RecName: Full=Aspartate 1-decarboxylase;       
    1::117     4e-33  54%  127 aa  PAND_BACCZ RecName: Full=Aspartate 1-decarboxylase;       
    1::117     4e-33  54%  127 aa  PAND_BACCQ RecName: Full=Aspartate 1-decarboxylase;       
    1::117     4e-33  54%  127 aa  PAND_BACC7 RecName: Full=Aspartate 1-decarboxylase;       
    1::117     4e-33  54%  127 aa  PAND_BACC3 RecName: Full=Aspartate 1-decarboxylase;       
    1::117     4e-33  54%  127 aa  PAND_BACC0 RecName: Full=Aspartate 1-decarboxylase;       
    1::117     4e-33  54%  127 aa  PAND_BACAN RecName: Full=Aspartate 1-decarboxylase;       
    1::117     4e-33  54%  127 aa  PAND_BACAH RecName: Full=Aspartate 1-decarboxylase;       
    1::117     4e-33  54%  127 aa  PAND_BACAC RecName: Full=Aspartate 1-decarboxylase;       
    1::117     4e-33  54%  127 aa  PAND_BACAA RecName: Full=Aspartate 1-decarboxylase;       
    1::117     5e-33  54%  128 aa  PAND_MOOTA RecName: Full=Aspartate 1-decarboxylase;       
    1::116     5e-33  55%  132 aa  PAND_HELMI RecName: Full=Aspartate 1-decarboxylase;       
    1::115     7e-33  58%  120 aa  PAND_THET8 RecName: Full=Aspartate 1-decarboxylase;       
    1::115     7e-33  58%  120 aa  PAND_THET2 RecName: Full=Aspartate 1-decarboxylase;       
    1::115     7e-33  56%  131 aa  PAND_PELPD RecName: Full=Aspartate 1-decarboxylase;       
    1::114     7e-33  56%  127 aa  PAND_LISIN RecName: Full=Aspartate 1-decarboxylase;       
    4::119     7e-33  55%  131 aa  PAND_EUBR3 RecName: Full=Aspartate 1-decarboxylase;       
    1::117     9e-33  50%  127 aa  PAND_STAAW RecName: Full=Aspartate 1-decarboxylase;       
    1::117     9e-33  50%  127 aa  PAND_STAAS RecName: Full=Aspartate 1-decarboxylase;       
    5::116     9e-33  58%  118 aa  PAND_PORGI RecName: Full=Aspartate 1-decarboxylase;       
    5::116     9e-33  58%  118 aa  PAND_PORG3 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     9e-33  56%  127 aa  PAND_LISMC RecName: Full=Aspartate 1-decarboxylase;       
    1::114     9e-33  55%  127 aa  PAND_BACP2 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-32  56%  127 aa  PAND_LISMH RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-32  56%  127 aa  PAND_LISMF RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-32  54%  127 aa  PAND_BACLD RecName: Full=Aspartate 1-decarboxylase;       
    1::117     2e-32  53%  127 aa  PAND_BACC1 RecName: Full=Aspartate 1-decarboxylase;       
    1::117     3e-32  50%  127 aa  PAND_GEOTN RecName: Full=Aspartate 1-decarboxylase;       
    1::120     3e-32  52%  127 aa  PAND_DESHY RecName: Full=Aspartate 1-decarboxylase;       
    1::120     3e-32  52%  127 aa  PAND_DESHD RecName: Full=Aspartate 1-decarboxylase;       
    1::114     4e-32  55%  127 aa  PAND_LISW6 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     4e-32  54%  127 aa  PAND_CLOK5 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     4e-32  54%  127 aa  PAND_CLOK1 RecName: Full=Aspartate 1-decarboxylase;       
    5::114     4e-32  59%  127 aa  PAND_CLOAB RecName: Full=Aspartate 1-decarboxylase;       
    1::118     6e-32  53%  118 aa  PAND_SYNWW RecName: Full=Aspartate 1-decarboxylase;       
    1::117     6e-32  50%  127 aa  PAND_GEOSW RecName: Full=Aspartate 1-decarboxylase;       
    1::122     1e-31  54%  132 aa  PAND_GEOUR RecName: Full=Aspartate 1-decarboxylase;       
    4::114     1e-31  57%  116 aa  PAND_LEPIN RecName: Full=Aspartate 1-decarboxylase;       
    4::114     1e-31  57%  116 aa  PAND_LEPIC RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-31  57%  130 aa  PAND_LACPL RecName: Full=Aspartate 1-decarboxylase;       
    1::119     1e-31  55%  127 aa  PAND_CLOB6 RecName: Full=Aspartate 1-decarboxylase;       
    1::117     1e-31  54%  127 aa  PAND_CARHZ RecName: Full=Aspartate 1-decarboxylase;       
    1::116     1e-31  54%  118 aa  PAND1_GLOVI RecName: Full=Aspartate 1-decarboxylase 1;       
    1::116     2e-31  55%  129 aa  PAND_SORC5 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     4e-31  51%  127 aa  PAND_OCEIH RecName: Full=Aspartate 1-decarboxylase;       
    1::119     4e-31  54%  127 aa  PAND_CLOBM RecName: Full=Aspartate 1-decarboxylase;       
    1::119     4e-31  55%  127 aa  PAND_CLOBL RecName: Full=Aspartate 1-decarboxylase;       
    1::119     4e-31  55%  127 aa  PAND_CLOBK RecName: Full=Aspartate 1-decarboxylase;       
    1::119     4e-31  54%  124 aa  PAND_CLOBA RecName: Full=Aspartate 1-decarboxylase;       
    4::115     5e-31  54%  133 aa  PAND_LEGPL RecName: Full=Aspartate 1-decarboxylase;       
    4::114     6e-31  56%  116 aa  PAND_LEPBL RecName: Full=Aspartate 1-decarboxylase;       
    4::114     6e-31  56%  116 aa  PAND_LEPBJ RecName: Full=Aspartate 1-decarboxylase;       
    1::114     6e-31  53%  127 aa  PAND_EXISA RecName: Full=Aspartate 1-decarboxylase;       
    1::117     6e-31  49%  127 aa  PAND_ANOFW RecName: Full=Aspartate 1-decarboxylase;       
    1::127     8e-31  54%  149 aa  PAND_FRASN RecName: Full=Aspartate 1-decarboxylase;       
    1::121     1e-30  50%  126 aa  PAND_THISH RecName: Full=Aspartate 1-decarboxylase;       
    5::119     1e-30  56%  123 aa  PAND_CLONN RecName: Full=Aspartate 1-decarboxylase;       
    4::114     1e-30  50%  146 aa  PAND_SALRD RecName: Full=Aspartate 1-decarboxylase;       
    1::116     1e-30  51%  116 aa  PAND_PARD8 RecName: Full=Aspartate 1-decarboxylase;       
    4::115     1e-30  54%  133 aa  PAND_LEGPH RecName: Full=Aspartate 1-decarboxylase;       
    4::115     1e-30  54%  133 aa  PAND_LEGPA RecName: Full=Aspartate 1-decarboxylase;       
    1::118     2e-30  51%  124 aa  PAND_DEHSC RecName: Full=Aspartate 1-decarboxylase;       
    1::119     2e-30  54%  127 aa  PAND_CLOB1 RecName: Full=Aspartate 1-decarboxylase;       
    1::117     2e-30  47%  127 aa  PAND_BACHD RecName: Full=Aspartate 1-decarboxylase;       
    1::114     4e-30  56%  116 aa  PAND_SYNAS RecName: Full=Aspartate 1-decarboxylase;       
    1::105     4e-30  52%  128 aa  PAND_STAES RecName: Full=Aspartate 1-decarboxylase;       
    1::105     4e-30  52%  128 aa  PAND_STAEQ RecName: Full=Aspartate 1-decarboxylase;       
    1::118     4e-30  51%  124 aa  PAND_DEHE1 RecName: Full=Aspartate 1-decarboxylase;       
    5::115     7e-30  53%  124 aa  PAND_NAUPA RecName: Full=Aspartate 1-decarboxylase;       
    1::114     7e-30  52%  127 aa  PAND_EXIS2 RecName: Full=Aspartate 1-decarboxylase;       
    1::116     7e-30  53%  117 aa  PAND_BACTN RecName: Full=Aspartate 1-decarboxylase;       
    1::127     7e-30  53%  160 aa  PAND2_FRASC RecName: Full=Aspartate 1-decarboxylase 2;       
    4::118     9e-30  53%  126 aa  PAND_CAMJR RecName: Full=Aspartate 1-decarboxylase;       
    4::118     9e-30  53%  126 aa  PAND_CAMJJ RecName: Full=Aspartate 1-decarboxylase;       
    4::118     9e-30  52%  126 aa  PAND_CAMJE RecName: Full=Aspartate 1-decarboxylase;       
    4::118     9e-30  52%  126 aa  PAND_CAMJ8 RecName: Full=Aspartate 1-decarboxylase;       
    5::115     1e-29  52%  115 aa  PAND_CYTH3 RecName: Full=Aspartate 1-decarboxylase;       
    1::116     1e-29  54%  116 aa  PAND_BACV8 RecName: Full=Aspartate 1-decarboxylase;       
    5::121     2e-29  50%  121 aa  PAND_WOLSU RecName: Full=Aspartate 1-decarboxylase;       
    1::116     2e-29  54%  131 aa  PAND_ANASK RecName: Full=Aspartate 1-decarboxylase;       
    1::116     2e-29  54%  131 aa  PAND_ANAD2 RecName: Full=Aspartate 1-decarboxylase;       
    1::122     2e-29  48%  126 aa  PAND_ENTS8 RecName: Full=Aspartate 1-decarboxylase;       
    1::110     2e-29  56%  114 aa  PAND_CAMHC RecName: Full=Aspartate 1-decarboxylase;       
    1::116     2e-29  53%  131 aa  PAND_ANADE RecName: Full=Aspartate 1-decarboxylase;       
    1::117     3e-29  55%  120 aa  PAND_DEIGD RecName: Full=Aspartate 1-decarboxylase;       
    1::116     3e-29  52%  117 aa  PAND_BACFR RecName: Full=Aspartate 1-decarboxylase;       
    1::116     3e-29  52%  117 aa  PAND_BACFN RecName: Full=Aspartate 1-decarboxylase;       
    5::124     5e-29  52%  133 aa  PAND_DESAP RecName: Full=Aspartate 1-decarboxylase;       
    1::117     6e-29  55%  120 aa  PAND_DEIDV RecName: Full=Aspartate 1-decarboxylase;       
    5::113     6e-29  56%  136 aa  PAND_CHLT3 RecName: Full=Aspartate 1-decarboxylase;       
    5::118     6e-29  53%  126 aa  PAND_CAMJD RecName: Full=Aspartate 1-decarboxylase;       
    5::121     6e-29  50%  127 aa  PAND_ARCB4 RecName: Full=Aspartate 1-decarboxylase;       
    1::115     8e-29  50%  117 aa  PAND_THEPX RecName: Full=Aspartate 1-decarboxylase;       
    1::115     8e-29  50%  117 aa  PAND_THEP3 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-28  51%  118 aa  PAND_LEPBP RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-28  51%  118 aa  PAND_LEPBA RecName: Full=Aspartate 1-decarboxylase;       
    1::117     1e-28  54%  120 aa  PAND_DEIRA RecName: Full=Aspartate 1-decarboxylase;       
    1::118     2e-28  48%  124 aa  PAND_SYNFM RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-28  50%  126 aa  PAND_CHRVO RecName: Full=Aspartate 1-decarboxylase;       
    1::114     3e-28  51%  118 aa  PAND_CAUCR RecName: Full=Aspartate 1-decarboxylase;       
    1::114     3e-28  51%  118 aa  PAND_CAUCN RecName: Full=Aspartate 1-decarboxylase;       
    4::116     3e-28  49%  117 aa  PAND_BRAJA RecName: Full=Aspartate 1-decarboxylase;       
    1::112     4e-28  53%  131 aa  PAND_PELCD RecName: Full=Aspartate 1-decarboxylase;       
    1::117     4e-28  52%  119 aa  PAND_HERAR RecName: Full=Aspartate 1-decarboxylase;       
    5::117     5e-28  53%  117 aa  PAND_HELPY RecName: Full=Aspartate 1-decarboxylase;       
    1::114     5e-28  46%  126 aa  PAND_ENT38 RecName: Full=Aspartate 1-decarboxylase;       
    5::113     7e-28  55%  115 aa  PAND_CAMFF RecName: Full=Aspartate 1-decarboxylase;       
    5::114     9e-28  55%  116 aa  PAND_HELP2 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-27  49%  118 aa  PAND_CAUSK RecName: Full=Aspartate 1-decarboxylase;       
    1::115     1e-27  49%  131 aa  PAND_ACAM1 RecName: Full=Aspartate 1-decarboxylase;       
    1::115     1e-27  50%  126 aa  PAND_THIDA RecName: Full=Aspartate 1-decarboxylase;       
    5::117     1e-27  52%  117 aa  PAND_HELPJ RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-27  46%  126 aa  PAND_SALTY RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-27  46%  126 aa  PAND_SALTI RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-27  46%  126 aa  PAND_SALSV RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-27  46%  126 aa  PAND_SALPK RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-27  46%  126 aa  PAND_SALPC RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-27  46%  126 aa  PAND_SALPB RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-27  46%  126 aa  PAND_SALPA RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-27  46%  126 aa  PAND_SALNS RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-27  46%  126 aa  PAND_SALHS RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-27  46%  126 aa  PAND_SALG2 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-27  46%  126 aa  PAND_SALEP RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-27  46%  126 aa  PAND_SALDC RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-27  46%  126 aa  PAND_SALCH RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-27  46%  126 aa  PAND_SALA4 RecName: Full=Aspartate 1-decarboxylase;       
    1::117     2e-27  48%  120 aa  PAND_RALPJ RecName: Full=Aspartate 1-decarboxylase;       
    5::114     2e-27  54%  116 aa  PAND_HELPH RecName: Full=Aspartate 1-decarboxylase;       
    5::115     2e-27  51%  116 aa  PAND_GRAFK RecName: Full=Aspartate 1-decarboxylase;       
    4::114     4e-27  47%  126 aa  PAND_STRM5 RecName: Full=Aspartate 1-decarboxylase;       
    1::122     4e-27  47%  126 aa  PAND_PSYWF RecName: Full=Aspartate 1-decarboxylase;       
    1::114     4e-27  46%  126 aa  PAND_CITK8 RecName: Full=Aspartate 1-decarboxylase;       
    5::113     4e-27  53%  115 aa  PAND_CAMC5 RecName: Full=Aspartate 1-decarboxylase;       
    5::114     6e-27  48%  121 aa  PAND_SULDN RecName: Full=Aspartate 1-decarboxylase;       
    1::114     6e-27  46%  126 aa  PAND_PECCP RecName: Full=Aspartate 1-decarboxylase;       
    5::114     6e-27  54%  116 aa  PAND_HELPS RecName: Full=Aspartate 1-decarboxylase;       
    4::114     7e-27  47%  126 aa  PAND_STRMK RecName: Full=Aspartate 1-decarboxylase;       
    1::114     7e-27  45%  126 aa  PAND_SALAR RecName: Full=Aspartate 1-decarboxylase;       
    7::126     1e-26  43%  156 aa  PAND_RHOBA RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-26  45%  126 aa  PAND_ECOL5 RecName: Full=Aspartate 1-decarboxylase;       
    4::112     1e-26  54%  124 aa  PAND_BDEBA RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_SHISS RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_SHIFL RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_SHIF8 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_SHIDS RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_SHIBS RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_SHIB3 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ESCF3 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECOUT RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECOSM RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECOSE RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECOLX RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECOLU RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECOLI RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECOLC RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECOL6 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECOK1 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECOHS RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECODH RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECOBW RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECO8A RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECO81 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECO7I RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECO5E RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECO57 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECO55 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECO45 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECO27 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-26  45%  126 aa  PAND_ECO24 RecName: Full=Aspartate 1-decarboxylase;       
    5::112     2e-26  50%  129 aa  PAND_CHLCH RecName: Full=Aspartate 1-decarboxylase;       
    1::114     3e-26  48%  118 aa  PAND_PHEZH RecName: Full=Aspartate 1-decarboxylase;       
    1::114     3e-26  47%  126 aa  PAND_METFK RecName: Full=Aspartate 1-decarboxylase;       
    5::106     3e-26  52%  116 aa  PAND_FLAPJ RecName: Full=Aspartate 1-decarboxylase;       
    1::114     4e-26  49%  120 aa  PAND_RALSO RecName: Full=Aspartate 1-decarboxylase;       
    1::114     5e-26  45%  126 aa  PAND_YERE8 RecName: Full=Aspartate 1-decarboxylase;       
    1::112     5e-26  48%  126 aa  PAND_XYLFM RecName: Full=Aspartate 1-decarboxylase;       
    1::112     5e-26  48%  126 aa  PAND_XYLFA RecName: Full=Aspartate 1-decarboxylase;       
    1::114     5e-26  46%  126 aa  PAND_SERP5 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     5e-26  47%  120 aa  PAND_RALEH RecName: Full=Aspartate 1-decarboxylase;       
    1::122     5e-26  44%  126 aa  PAND_ERWT9 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     5e-26  47%  120 aa  PAND_CUPTR RecName: Full=Aspartate 1-decarboxylase;       
    4::121     6e-26  46%  126 aa  PAND_MARMS RecName: Full=Aspartate 1-decarboxylase;       
    1::114     6e-26  45%  126 aa  PAND_ERWCT RecName: Full=Aspartate 1-decarboxylase;       
    1::115     6e-26  50%  128 aa  PAND_BURVG RecName: Full=Aspartate 1-decarboxylase;       
    1::115     6e-26  50%  128 aa  PAND_BURCJ RecName: Full=Aspartate 1-decarboxylase;       
    1::121     6e-26  45%  126 aa  PAND_ALHEH RecName: Full=Aspartate 1-decarboxylase;       
    4::114     8e-26  47%  126 aa  PAND_XANCB RecName: Full=Aspartate 1-decarboxylase;       
    1::117     8e-26  44%  127 aa  PAND_LARHH RecName: Full=Aspartate 1-decarboxylase;       
    1::115     8e-26  50%  128 aa  PAND_BURCH RecName: Full=Aspartate 1-decarboxylase;       
    1::115     8e-26  50%  128 aa  PAND_BURCC RecName: Full=Aspartate 1-decarboxylase;       
    1::115     8e-26  50%  128 aa  PAND_BURCA RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-25  45%  126 aa  PAND_YERPY RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-25  45%  126 aa  PAND_YERPS RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-25  45%  126 aa  PAND_YERPB RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-25  45%  126 aa  PAND_YERP3 RecName: Full=Aspartate 1-decarboxylase;       
    4::114     1e-25  46%  126 aa  PAND_XANCP RecName: Full=Aspartate 1-decarboxylase;       
    4::114     1e-25  46%  126 aa  PAND_XANC8 RecName: Full=Aspartate 1-decarboxylase;       
    1::121     1e-25  44%  127 aa  PAND_DECAR RecName: Full=Aspartate 1-decarboxylase;       
    1::117     1e-25  45%  127 aa  PAND_STACT RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-25  46%  122 aa  PAND_BORA1 RecName: Full=Aspartate 1-decarboxylase;       
    4::119     1e-25  45%  126 aa  PAND_ALCBS RecName: Full=Aspartate 1-decarboxylase;       
    1::112     2e-25  47%  126 aa  PAND_XYLFT RecName: Full=Aspartate 1-decarboxylase;       
    1::117     2e-25  44%  127 aa  PAND_STAHJ RecName: Full=Aspartate 1-decarboxylase;       
    4::121     2e-25  45%  126 aa  PAND_SACD2 RecName: Full=Aspartate 1-decarboxylase;       
    1::122     2e-25  43%  126 aa  PAND_PROMH RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-25  45%  126 aa  PAND_HALHL RecName: Full=Aspartate 1-decarboxylase;       
    5::113     2e-25  52%  115 aa  PAND_CAMC1 RecName: Full=Aspartate 1-decarboxylase;       
    1::120     2e-25  46%  131 aa  PAND_LEPCP RecName: Full=Aspartate 1-decarboxylase;       
    5::114     2e-25  52%  116 aa  PAND_HELAH RecName: Full=Aspartate 1-decarboxylase;       
    4::114     3e-25  46%  126 aa  PAND_XANOR RecName: Full=Aspartate 1-decarboxylase;       
    4::114     3e-25  46%  126 aa  PAND_XANOM RecName: Full=Aspartate 1-decarboxylase;       
    1::117     3e-25  47%  126 aa  PAND_DELAS RecName: Full=Aspartate 1-decarboxylase;       
    1::115     3e-25  49%  128 aa  PAND_BURA4 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     3e-25  46%  122 aa  PAND_BORPE RecName: Full=Aspartate 1-decarboxylase;       
    1::115     3e-25  49%  124 aa  PAND_AQUAE RecName: Full=Aspartate 1-decarboxylase;       
    1::113     3e-25  47%  126 aa  PAND2_POLSJ RecName: Full=Aspartate 1-decarboxylase 2;       
    4::114     4e-25  45%  126 aa  PAND_XANC5 RecName: Full=Aspartate 1-decarboxylase;       
    1::115     4e-25  48%  128 aa  PAND_BURCM RecName: Full=Aspartate 1-decarboxylase;       
    4::114     5e-25  45%  126 aa  PAND_XANAC RecName: Full=Aspartate 1-decarboxylase;       
    4::121     5e-25  45%  126 aa  PAND_TERTT RecName: Full=Aspartate 1-decarboxylase;       
    1::114     5e-25  46%  132 aa  PAND_CYAP8 RecName: Full=Aspartate 1-decarboxylase;       
    1::115     5e-25  48%  128 aa  PAND_BURS3 RecName: Full=Aspartate 1-decarboxylase;       
    1::115     7e-25  48%  128 aa  PAND_BURP6 RecName: Full=Aspartate 1-decarboxylase;       
    1::115     7e-25  47%  128 aa  PAND_BURM1 RecName: Full=Aspartate 1-decarboxylase;       
    1::122     7e-25  45%  126 aa  PAND_ACIBT RecName: Full=Aspartate 1-decarboxylase;       
    1::122     7e-25  45%  126 aa  PAND_ACIBS RecName: Full=Aspartate 1-decarboxylase;       
    1::122     7e-25  45%  126 aa  PAND_ACIBC RecName: Full=Aspartate 1-decarboxylase;       
    1::114     9e-25  48%  127 aa  PAND_POLNA RecName: Full=Aspartate 1-decarboxylase;       
    1::114     9e-25  46%  126 aa  PAND_METCA RecName: Full=Aspartate 1-decarboxylase;       
    1::121     9e-25  40%  126 aa  PAND_EDWI9 RecName: Full=Aspartate 1-decarboxylase;       
    5::112     9e-25  49%  127 aa  PAND_CHLPB RecName: Full=Aspartate 1-decarboxylase;       
    1::115     9e-25  48%  128 aa  PAND_BURXL RecName: Full=Aspartate 1-decarboxylase;       
    1::115     9e-25  47%  128 aa  PAND_BURPS RecName: Full=Aspartate 1-decarboxylase;       
    1::115     9e-25  47%  128 aa  PAND_BURP1 RecName: Full=Aspartate 1-decarboxylase;       
    1::115     9e-25  47%  128 aa  PAND_BURP0 RecName: Full=Aspartate 1-decarboxylase;       
    1::115     9e-25  47%  128 aa  PAND_BURMS RecName: Full=Aspartate 1-decarboxylase;       
    1::115     9e-25  47%  128 aa  PAND_BURMA RecName: Full=Aspartate 1-decarboxylase;       
    1::115     9e-25  47%  128 aa  PAND_BURM9 RecName: Full=Aspartate 1-decarboxylase;       
    1::115     9e-25  47%  128 aa  PAND_BURM7 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     9e-25  45%  122 aa  PAND_BORPA RecName: Full=Aspartate 1-decarboxylase;       
    1::114     9e-25  45%  122 aa  PAND_BORBR RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-24  44%  126 aa  PAND_YERPP RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-24  44%  126 aa  PAND_YERPN RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-24  44%  126 aa  PAND_YERPG RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-24  44%  126 aa  PAND_YERPE RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-24  44%  126 aa  PAND_YERPA RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-24  44%  119 aa  PAND_DESPS RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-24  49%  126 aa  PAND1_POLSJ RecName: Full=Aspartate 1-decarboxylase 1;       
    1::114     2e-24  46%  140 aa  PAND_PERMH RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-24  47%  120 aa  PAND_METPP RecName: Full=Aspartate 1-decarboxylase;       
    1::119     2e-24  47%  125 aa  PAND_HYDS0 RecName: Full=Aspartate 1-decarboxylase;       
    1::122     2e-24  44%  126 aa  PAND_SODGM RecName: Full=Aspartate 1-decarboxylase;       
    1::119     2e-24  45%  126 aa  PAND_CELJU RecName: Full=Aspartate 1-decarboxylase;       
    1::115     2e-24  47%  128 aa  PAND_BURPP RecName: Full=Aspartate 1-decarboxylase;       
    1::122     2e-24  44%  126 aa  PAND_ACIBY RecName: Full=Aspartate 1-decarboxylase;       
    1::122     2e-24  44%  126 aa  PAND_ACIB5 RecName: Full=Aspartate 1-decarboxylase;       
    1::122     2e-24  44%  126 aa  PAND_ACIB3 RecName: Full=Aspartate 1-decarboxylase;       
    4::125     3e-24  41%  129 aa  PAND_THICR RecName: Full=Aspartate 1-decarboxylase;       
    1::117     3e-24  46%  127 aa  PAND_BACCN RecName: Full=Aspartate 1-decarboxylase;       
    1::124     3e-24  43%  125 aa  PAND2_GLOVI RecName: Full=Aspartate 1-decarboxylase 2;       
    5::112     3e-24  47%  128 aa  PAND_CHLL2 RecName: Full=Aspartate 1-decarboxylase;       
    1::115     4e-24  47%  128 aa  PAND_BURTA RecName: Full=Aspartate 1-decarboxylase;       
    1::122     4e-24  44%  126 aa  PAND_ACIAD RecName: Full=Aspartate 1-decarboxylase;       
    5::112     6e-24  46%  128 aa  PAND_PROVI RecName: Full=Aspartate 1-decarboxylase;       
    1::110     6e-24  54%  115 aa  PAND_KOSOT RecName: Full=Aspartate 1-decarboxylase;       
    1::121     1e-23  43%  126 aa  PAND_TOLAT RecName: Full=Aspartate 1-decarboxylase;       
    5::112     1e-23  47%  129 aa  PAND_PROA2 RecName: Full=Aspartate 1-decarboxylase;       
    5::120     1e-23  47%  120 aa  PAND_HELHP RecName: Full=Aspartate 1-decarboxylase;       
    5::112     2e-23  47%  128 aa  PAND_PELPB RecName: Full=Aspartate 1-decarboxylase;       
    5::112     2e-23  48%  128 aa  PAND_CHLTE RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-23  49%  120 aa  PAND_POLSQ RecName: Full=Aspartate 1-decarboxylase;       
    5::112     2e-23  47%  128 aa  PAND_CHLP8 RecName: Full=Aspartate 1-decarboxylase;       
    1::115     2e-23  46%  128 aa  PAND_BURP8 RecName: Full=Aspartate 1-decarboxylase;       
    6::117     3e-23  45%  151 aa  PAND_CYAA5 RecName: Full=Aspartate 1-decarboxylase;       
    1::115     4e-23  40%  134 aa  PAND_SULSY RecName: Full=Aspartate 1-decarboxylase;       
    5::112     4e-23  45%  128 aa  PAND_PELLD RecName: Full=Aspartate 1-decarboxylase;       
    6::117     6e-23  42%  156 aa  PAND_CYAP7 RecName: Full=Aspartate 1-decarboxylase;       
    1::113     8e-23  48%  127 aa  PAND_ANAVT RecName: Full=Aspartate 1-decarboxylase;       
    1::113     8e-23  48%  127 aa  PAND_ANASP RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-22  45%  126 aa  PAND_CHRSD RecName: Full=Aspartate 1-decarboxylase;       
    1::115     1e-22  46%  127 aa  PAND_NOSP7 RecName: Full=Aspartate 1-decarboxylase;       
    5::109     1e-22  46%  131 aa  PAND_CHLPD RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-22  44%  135 aa  PAND_RHOFD RecName: Full=Aspartate 1-decarboxylase;       
    1::122     2e-22  41%  126 aa  PAND_PHOLL RecName: Full=Aspartate 1-decarboxylase;       
    1::119     2e-22  42%  126 aa  PAND_NITOC RecName: Full=Aspartate 1-decarboxylase;       
    1::105     2e-22  50%  111 aa  PAND_FRATN RecName: Full=Aspartate 1-decarboxylase;       
    1::114     4e-22  43%  115 aa  PAND_THELT RecName: Full=Aspartate 1-decarboxylase;       
    1::122     4e-22  41%  126 aa  PAND_PSYCK RecName: Full=Aspartate 1-decarboxylase;       
    1::122     4e-22  41%  126 aa  PAND_PSYA2 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     5e-22  43%  118 aa  PAND_HYPNA RecName: Full=Aspartate 1-decarboxylase;       
    6::114     7e-22  45%  139 aa  PAND_MICAN RecName: Full=Aspartate 1-decarboxylase;       
    1::105     7e-22  49%  111 aa  PAND_FRATW RecName: Full=Aspartate 1-decarboxylase;       
    1::105     7e-22  49%  111 aa  PAND_FRATT RecName: Full=Aspartate 1-decarboxylase;       
    1::105     7e-22  49%  111 aa  PAND_FRATO RecName: Full=Aspartate 1-decarboxylase;       
    1::105     7e-22  49%  111 aa  PAND_FRATH RecName: Full=Aspartate 1-decarboxylase;       
    1::105     7e-22  49%  111 aa  PAND_FRAT1 RecName: Full=Aspartate 1-decarboxylase;       
    1::116     9e-22  41%  121 aa  PAND_MARMM RecName: Full=Aspartate 1-decarboxylase;       
    1::121     2e-21  41%  126 aa  PAND_PSYIN RecName: Full=Aspartate 1-decarboxylase;       
    1::115     3e-21  41%  150 aa  PAND_XANP2 RecName: Full=Aspartate 1-decarboxylase;       
    1::119     3e-21  39%  119 aa  PAND_RUTMC RecName: Full=Aspartate 1-decarboxylase;       
    1::114     3e-21  40%  150 aa  PAND2_RHILO RecName: Full=Aspartate 1-decarboxylase 2;       
    5::122     8e-21  41%  126 aa  PAND_PSEAE RecName: Full=Aspartate 1-decarboxylase;       
    1::110     8e-21  47%  114 aa  PAND_HALWD RecName: Full=Aspartate 1-decarboxylase;       
    1::117     8e-21  43%  126 aa  PAND_DIAST RecName: Full=Aspartate 1-decarboxylase;       
    1::117     8e-21  43%  126 aa  PAND_ACISJ RecName: Full=Aspartate 1-decarboxylase;       
    5::122     1e-20  40%  126 aa  PAND_PSEAB RecName: Full=Aspartate 1-decarboxylase;       
    5::122     1e-20  40%  126 aa  PAND_PSEA8 RecName: Full=Aspartate 1-decarboxylase;       
    5::119     2e-20  39%  126 aa  PAND_PSEFL RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-20  39%  152 aa  PAND_METNO RecName: Full=Aspartate 1-decarboxylase;       
    5::122     2e-20  40%  126 aa  PAND_PSEA7 RecName: Full=Aspartate 1-decarboxylase;       
    6::115     4e-20  44%  158 aa  PAND_TRIEI RecName: Full=Aspartate 1-decarboxylase;       
    1::115     5e-20  42%  120 aa  PAND_THEAB RecName: Full=Aspartate 1-decarboxylase;       
    1::112     5e-20  42%  116 aa  PAND_FERNB RecName: Full=Aspartate 1-decarboxylase;       
    1::114     5e-20  39%  150 aa  PAND1_RHILO RecName: Full=Aspartate 1-decarboxylase 1;       
    5::119     7e-20  38%  126 aa  PAND_PSEU5 RecName: Full=Aspartate 1-decarboxylase;       
    1::100     1e-19  49%  114 aa  PAND_THESQ RecName: Full=Aspartate 1-decarboxylase;       
    5::112     1e-19  40%  126 aa  PAND_AZOVD RecName: Full=Aspartate 1-decarboxylase;       
    6::118     2e-19  40%  145 aa  PAND_SYNY3 RecName: Full=Aspartate 1-decarboxylase;       
    1::114     2e-19  40%  155 aa  PAND_METSB RecName: Full=Aspartate 1-decarboxylase;       
    1::115     7e-19  38%  119 aa  PAND_THEM4 RecName: Full=Aspartate 1-decarboxylase;       
    1::112     1e-18  41%  120 aa  PAND_COPPD RecName: Full=Aspartate 1-decarboxylase;       
    4::113     4e-18  39%  152 aa  PAND_RHOCS RecName: Full=Aspartate 1-decarboxylase;       
    1::114     1e-17  40%  150 aa  PAND_BEII9 RecName: Full=Aspartate 1-decarboxylase;       
    1::90      2e-17  48%  111 aa  PAND_COXBU RecName: Full=Aspartate 1-decarboxylase;       
    1::112     2e-17  38%  127 aa  PAND_VESOH RecName: Full=Aspartate 1-decarboxylase;       
    4::87      1e-15  45%  120 aa  PAND_PYRIL RecName: Full=Aspartate 1-decarboxylase;       
    4::114     1e-15  39%  141 aa  PAND_DESDA RecName: Full=Aspartate 1-decarboxylase;       
    1::111     4e-15  42%  114 aa  PAND_THEMA RecName: Full=Aspartate 1-decarboxylase;       
    1::111     5e-15  41%  114 aa  PAND_THEP1 RecName: Full=Aspartate 1-decarboxylase;       
    4::95      6e-15  47%  155 aa  PAND_AGRT5 RecName: Full=Aspartate 1-decarboxylase;       
    4::114     4e-14  39%  180 aa  PAND_MAGSA RecName: Full=Aspartate 1-decarboxylase;       
  258::312     7e-04  45%  997 aa  LPTD_PSYCK RecName: Full=LPS-assembly protein lptD;AltName:
    1::136

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVIVGDAGTGNIC
PAND_CORGL      MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVIVGDAGTGNIC
PAND_CORGB      MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVIVGDAGTGNIC
PAND_COREF      MLRTILGSKIHRATVTQADLDYVGSITIDADLVNAAGLIEGEKVAVVDITNGARIETYVITGDAGTGSIC
PAND_STRGG      MMRTLFKSKIHRATVTQADLHYVGSVTVDAALMEAADLLPGELVHIVDIDNGARLETYVIEGERGSGVIG
PAND_ACIC1      MLRTMLHAKIHRATVTRADLHYVGSITLDLDLMEAADILPGELVAVADINNGNRLETYVIAGERGSGVVG
PAND_THEFY      MLRTMLNGKIHRATVTHADLHYVGSITIDADLMDAANLVDGEQVHVVNITNGHRLVTYVLTGERGSGVIG
PAND_RHOE4      MFRTMMKSKIHRATVTHADLHYVGSVTVDQDLMDAADLLEGEQVCIVDIDNGARLETYVIAGERGTGVIG
PAND_MYCVP      MFRTMLKSKIHRATVTQADLHYVGSVTVDADLMDAADLIEGEQVTIVDIENGARLVTYVITGERGSGVIG
PAND_KOCRD      MLRTMFTGKIHRATVTQADLHYVGSVTVDQDLLDAAGILPGELVAVVDVTNGARLETYTIAGERGSGVLG
PAND_ARTCA      MNRTMFKSKIHRATVTHADLHYVGSVTVDLDLLEAADILPGELVSIVDITNGARLETYTIAGERGSGVIG
PAND_MICLC      MLRTMFHAKIHRATVTQADLHYVGSVTVDQDLLDAADILPGELVSIVDVTNGARLETYTIAGERGSGVLG
PAND_STRCO      MLRTLIKSKIHRATVTQADLHYVGSVTIXXXXXXXXXXXPGELVHIVDVTNGARLETYVIEGERGSGVIG
PAND_RHOSR      MFRTMMKSKIHRATVTHADLHYVGSVTVDQDLMDAADLLEGEQVCIVDIDNGARLETYVIAGERGSGVIG
PAND_RHOOB      MFRTMMKSKIHRATVTHADLHYVGSVTVDQDLMDAADLLEGEQVCIVDIDNGARLETYVIAGERGSGVIG
PAND_MYCLE      MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDINNGARLVTYAIAGERGTGVIG
PAND_MYCLB      MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDINNGARLVTYAIAGERGTGVIG
PAND_RENSM      MIRTMFKSKIHRATVTHANLHYVGSVTVDKDLLDAADILPGELVAIVDVTNGSRLETYTIEGQAGSGVIG
PAND_ARTS2      MNRTMFKSKIHRATVTHADLHYVGSVTVDLDLLEAADILPGELVAIVDVTNGARLETYTIAGERGSGVIG
PAND1_ARTAT     MKRTMFKSKIHRATVTHADLHYVGSVTVDLDLLDAANILPGEQVAIVDVTNGARLETYTIAGERGSGVIG
PAND_MYCS2      MQRVLLASKIHRATVTQADLHYVGSITIDAELMAAADIVEGEQVHVVDITSGARLVTYAITGTPGSGVIG
PAND_CORJK      MLRTMLKSKIHRATVTQADLHYVGSCTIDADLMEAADILEGEQIDIVDIDNGNRLTTYAITGDRGTGVIG
PAND_SACEN      MFRTMLKSKIHRATVTQADLHYVGSVTVXXXXXXXXXXXEGEQVAIVDVTNGARLETYVITGERGSGVIG
PAND1_FRASC     --REMLKSKIHRAVVRQADLHYVGSITIDATLMAAAGLWPGEKVDVLDITNGARLSTYVIEGEADSGTIG
PAND_NOCSJ      MLRTMMKSKIHRATVTQADLHYVGSVTVXXXXXXXXXXXPGELVHIVDIDNGARLETYTIAGERGSGVIG
PAND_NOCFA      MLRTMMKSKIHRATVTHADLHYVGSVTVXXXXXXXXXXXEGEQVCIVDIDNGARLETYVIAGERGSGVIG
PAND_MYCGI      MLRTMLKSKIHRATVTQADLHYVGSVTVXXXXXXXXXXXEGEQVTIVDVDNGARLVTYVITGERGSGVIG
PAND_FRAAA      MLRTMLTAKIHRATVTQADLHYVGSVTIXXXXXXXXXXXPGEQVTIVDINNGARLETYAIAGPAGSGVIG
PAND_CLAM3      MLRTMMTAKIHRATVTHADLHYVGSVTVDRDLLDAADILVGERVSIVDVTNGARLDTYTIAGERGSGVLG
PAND_MYCUA      MLRTMLKSKIHRATVTQADLHYVGSVTIXXXXXXXXXXXEGEQVTIVDIDNGARLVTYAITGERGSGVIG
PAND_MYCPA      MLRTMLKSKIHRATVTQADLHYVGSVTIXXXXXXXXXXXEGEQVTIVDIDNGARLVTYAITGERGSGVIG
PAND_MYCA1      MLRTMLKSKIHRATVTQADLHYVGSVTIXXXXXXXXXXXEGEQVTIVDIDNGARLVTYAITGERGSGVIG
PAND_SALTO      MLRTMLKSKIHRATVTQADLHYVGSVTVXXXXXXXXXXXPGEQVAIVDVTNGARLETYVIPGRRGSGVIG
PAND_NEIG2      MFRTILGGKIHRATVTEADLNYVGSITVDQDLLDAAGICPNEKVAIVNNNNGERFETYTIAGKRGSGVIC
PAND_NEIG1      MFRTILGGKIHRATVTEADLNYVGSITVDQDLLDAAGICPNEKVAIVNNNNGERFETYTIAGKRGSGVIC
PAND_MYCSS      MLRTMLKSKIHRATVTQSDLHYVGSVTIXXXXXXXXXXIEGEQVTIVDIDNGNRLVTYAITGARGSGVIG
PAND_MYCSK      MLRTMLKSKIHRATVTQSDLHYVGSVTIXXXXXXXXXXIEGEQVTIVDIDNGNRLVTYAITGARGSGVIG
PAND_MYCSJ      MLRTMLKSKIHRATVTQSDLHYVGSVTIXXXXXXXXXXIEGEQVTIVDIDNGNRLVTYAITGARGSGVIG
PAND_SALAI      MLRTMLKSKIHRATVTQADLHYVGSVTVXXXXXXXXXXXPGEQVAIVDINNGSRLETYVIPGKRGSGVIG
PAND_NEIMB      MFRTMLGGKIHRATVTEADLNYVGSITVDQDLLDAAGIYPNEKVAIVNNNNGERFETYTIAGKRGSGVIC
PAND_NEIMF      MFRTMLGGKIHRATVTEADLNYVGSITVDQDLLDAAGIYPNEKVAIVNNNNGERFETYTISGKRGSGVVC
PAND_NEIMA      MFRTMLGGKIHRATVTEADLNYVGSITVDQDLLDAAGIYPNEKVAIVNNNNGERFETYTIAGKRGSGVIC
PAND2_ARTAT     MIRTMFKSKIHRATVTHADLHYVGSVTVXXXXXXXXXXXPGELVSIVDVTNGARLETYTIAGERGSGVIG
PAND_CLOB8      MILTMLKGKIHRATVTQAELNYVGSITIDKTLMEAAGILENEKVQIVDINNGARLETYVIPGKRESGVIC
PAND_CALS8      MLIEVLKSKIHRATVTEANLNYVGSITIDEELMEAAGILENEKVQVVNINNGERFETYVIKGERGSGTIC
PAND_MYCTU      MLRTMLKSKIHRATVTCADLHYVGSVTIXXXXXXXXXXXEGEQVTIVDIDNGARLVTYAITGERGSGVIG
PAND_MYCTA      MLRTMLKSKIHRATVTCADLHYVGSVTIXXXXXXXXXXXEGEQVTIVDIDNGARLVTYAITGERGSGVIG
PAND_MYCBT      MLRTMLKSKIHRATVTCADLHYVGSVTIXXXXXXXXXXXEGEQVTIVDIDNGARLVTYAITGERGSGVIG
PAND_MYCBP      MLRTMLKSKIHRATVTCADLHYVGSVTIXXXXXXXXXXXEGEQVTIVDIDNGARLVTYAITGERGSGVIG
PAND_MYCBO      MLRTMLKSKIHRATVTCADLHYVGSVTIXXXXXXXXXXXEGEQVTIVDIDNGARLVTYAITGERGSGVIG
PAND_STRAW      MLRTMFKSKIHRATVTQADLHYVGSVTIXXXXXXXXXXXPGELVHIVDITNGARLETYVIEGERGSGVVG
PAND_HERA2      MIRTLVHAKIHRATVTGADLNYVGSITIDEDLLEAAGIWPFERVQVVDVNNGARLETYAIVGERGSGTIQ
PAND_MYXXD      MRRILFKSKIHRATVTQADLDYEGSVTIDRDLLRAADIVENEKVAVWNITQGTRLETYALEGEAGSGVIC
PAND_CLOCE      ---TLLSGKIHRATVTQAELNYVGSITIDQDLLEAAGIMEYEKVCVVNINNGIRLETYTIAGEKGSGIIC
PAND_CLOTH      MFITLMKSKIHRATVTEANLDYVGSITIDEDLMEAADIMENEKVQVVDNNNGNRFETYVIKGERGSGMIC
PAND_BACSU      MYRTMMSGKLHRATVTEANLNYVGSITIDEDLIDAVGMLPNEKVQIVNNNNGARLETYIIPGKRGSGVIC
PAND_BACA2      MYRTMMAGKLHRATVTEANLNYVGSITIDEDLLDAVGMLANEKVQIVNNNNGARLETYIIPGKRGSGVIC
PAND_BACCR      MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLETYVIKGERGSGVVC
PAND_BACC4      MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLETYVIKGERGSGVVC
PAND_BACC2      MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLETYVIKGERGSGVVC
PAND_ANADF      MRRTFFKSKIHRATVTHADLDYEGSVSIDEDLLDASGILEYEAVHVWNITRGTRLQTYAIKGERGSGVIC
PAND_LISMO      MFRTMMNGKIHRATVTEANLNYVGSITIDSAILEAVDMLPNEKVQIVNNNNGARIETYIIPGEPGSGVIC
PAND_BACSK      MYRTMMKAKLHRARVTESNLNYVGSITIDEDLMDAVDLLENEKVQIVNNNNGERFETYVIKGPRGEGGIC
PAND_ANATD      MFIEVLKSKIHRATVTEANLNYVGSITIDEELMKAAGIYENEKVQVVNINNGERFETYVIKGEKGSGTIC
PAND_CORU7      MFRTMLKSKIHRATVTQADLHYVGSCTXXXXXXXXXXXXEGEQIDIVDIDNGNRLTTYAITGERGSGVIG
PAND_PELTS      MFLTMLKSKIHRATVTESNLNYMGSITIDEELMEAADILPNEKVQVVNNNNGARFETYVIKGPRGSGVIC
PAND_GEOBB      MDRKMLKSKIHRATVTGADLHYEGSITIDLDLMEAADIIPYEAVCIWDVTNGSRFETYAIEGERGSGVIC
PAND_ENTFA      ---TMLKGKIHRAKVEQAELDYVGSITVDMDLLEAAGIYEYEKVQIVDVNNGNRFETYTIAGERGTGMIC
PAND_STAAR      MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVIAGERGSGKIC
PAND_STAAN      MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVIAGERGSGKIC
PAND_STAAM      MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVIAGERGSGKIC
PAND_STAAE      MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVIAGERGSGKIC
PAND_STAAC      MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVIAGERGSGKIC
PAND_STAAB      MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVIAGERGSGKIC
PAND_STAA9      MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVIAGERGSGKIC
PAND_STAA8      MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVIAGERGSGKIC
PAND_STAA3      MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVIAGERGSGKIC
PAND_STAA2      MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVIAGERGSGKIC
PAND_GEOKA      MFRTLMNAKIHRARVTEANLDYVGSITIDEDILDAVGIVANEKVQVVNNHNGARFETYVIPGERGSGVFC
PAND_GEOSM      MERKMLKSKIHRATVTGADLHYEGSITIDLDLMEASDIIPYEAVCIWDVTNGSRFETYAIEGERGSGVIC
PAND_BACWK      MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLETYVIKGERGSGVVC
PAND_BACHK      MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLETYVIKGERGSGVVC
PAND_BACCZ      MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLETYVIKGERGSGVVC
PAND_BACCQ      MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLETYVIKGERGSGVVC
PAND_BACC7      MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLETYVIKGERGSGVVC
PAND_BACC3      MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLETYVIKGERGSGVVC
PAND_BACC0      MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLETYVIKGERGSGVVC
PAND_BACAN      MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLETYVIKGERGSGVVC
PAND_BACAH      MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLETYVIKGERGSGVVC
PAND_BACAC      MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLETYVIKGERGSGVVC
PAND_BACAA      MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLETYVIKGERGSGVVC
PAND_MOOTA      MWRIMMKSKLHRATVTAADLNYIGSITIDSDLMAAADILPNEKVQVVDNNNGARLETYAIPGPAGSGVIC
PAND_HELMI      MNRIMHKSKIHRATVTEANLNYVGSITIDEDLMDAADVLENEKIQVVNNNNGARFETYVIPGPRGSGVIC
PAND_THET8      MKRVMFHAKIHRATVTQADLHYVGSVTVDQDLLDAAGILPFEQVDIYDITNGARLTTYALPGERGSGVIG
PAND_THET2      MKRVMFHAKIHRATVTQADLHYVGSVTVDQDLLDAAGILPFEQVDIYDITNGARLTTYALPGERGSGVIG
PAND_PELPD      MERIMLKSKIHRATITGADLEYEGSITIDRDLMDAADIVSYEKVAVWDVTNGSRLETYAIEGERGSGVIC
PAND_LISIN      MFRTMMNGKIHRATVTEANLNYVGSITIDSAILEAVDMLPNEKVQIVNNNNGARIETYIIPGEPGSGVIC
PAND_EUBR3      ---TMLKGKIHRAVVKQADLNYVGSITVDTKLLEAAGILEYEMVQIVDVENGNRFETYTIAGEPGSGMIC
PAND_STAAW      MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVIAGERGSGKIC
PAND_STAAS      MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVIAGERGSGKIC
PAND_PORGI      ----VLKSKIHRVTITEANLNYVGSITIDEDLMDAANIIAGEKVQIVDNNNGARLETYTIPGKRGSGVIC
PAND_PORG3      ----VLKSKIHRVTITEANLNYVGSITIDEDLMDAANIIAGEKVQIVDNNNGARLETYTIPGKRGSGVIC
PAND_LISMC      MFRTMMNGKIHRATVTEANLNYVGSITIDSAILEAVDMLPNEKVQIVNNNNGARIETYIIPGEPGSGVIC
PAND_BACP2      MYRTFMTSKLHKATVTEANLHYVGSITIDEDLLDAAGMMANEKVQIVNNHNGARLETYIIPGERKSGVIC
PAND_LISMH      MFRTMMNGKIHRATVTEANLNYVGSITIDSAILEAVDMLPNEKVQIVNNNNGARIETYIIPGEPGSGVIC
PAND_LISMF      MFRTMMNGKIHRATVTEANLNYVGSITIDSAILEAVDMLPNEKVQIVNNNNGARIETYIIPGEPGSGVIC
PAND_BACLD      MYRTLMSAKLHRARVTEANLNYVGSVTIDEDLLDAVGMMANEKVQIVNNNNGARLETYIIPGERGSGVVC
PAND_BACC1      MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLETYVIKGERGSGVVC
PAND_GEOTN      MFRTLMNAKIHRARVTEANLDYVGSITIDEDILDAVGMVANEKVQIVNNNNGARFETYIIPGERGSGVFC
PAND_DESHY      MFRTMMKSKIHRATVTEANLKYVGSITIDEELLEVADILPNEKVQVVNNNNGARLETYVIPGKRGERTVC
PAND_DESHD      MFRTMMKSKIHRATVTEANLKYVGSITIDEELLEVADILPNEKVQVVNNNNGARLETYVIPGKRGERTVC
PAND_LISW6      MFRTMMNGKIHRATVTEANLNYVGSITIDSAILEAVDMLPNEKVQIVNNNNGARIETYIIPGEPGSGVIC
PAND_CLOK5      MQLNMLKSKIHRATVTEANLNYVGSITIDRELMESAHIIEYEKIQVVDIDNGNRLETYVIAGEKGSKVIC
PAND_CLOK1      MQLNMLKSKIHRATVTEANLNYVGSITIDRELMESAHIIEYEKIQVVDIDNGNRLETYVIAGEKGSKVIC
PAND_CLOAB      ----MLKSKIHRATVVQADLNYVGSITIDRNLMDKANILEYEKVEIANINNGARFETYVIAGEAGSGIIC
PAND_SYNWW      MLRHMLKSKIHRAVVTDANLNYVGSITIDRDLMDAADILENEKVTIVNNNNGARFDTYVIEGERGSKVIC
PAND_GEOSW      MFRTLMNAKIHRARVTEANLNYVGSITIDADILDAVGMVPNEKVQIVNNNNGARFETYIIPGERGSGVFC
PAND_GEOUR      MDRKMLKSKIHRATVTGADLHYEGSITIDKDLMEAADIIPYEAVCIWDVDNGSRFETYAIEGERGSGVIC
PAND_LEPIN      ---TVMKGKIHRATVTDADLNYEGSLTVDMDLVDAAGMRVYEKVSVVNVNNGARFETYIIEGKRGSGEIC
PAND_LEPIC      ---TVMKGKIHRATVTDADLNYEGSLTVDMDLVDAAGMRVYEKVSVVNVNNGARFETYIIEGKRGSGEIC
PAND_LACPL      MLIDMLKGKIHRATVTQADLEYVGSITIDETLMEASGILEYEKVQIADVNNGARFETYVIAGPRDSGVIC
PAND_CLOB6      MTITMLKSKIHRATVTEANLNYVGSITIDKNLMDKANILEYEKVQIVDIDNGNRFETYVIAGEKHSGVIC
PAND_CARHZ      MFLTMMKGKIHRATVTEANLNYVGSITIDEELLDASGILPNEKVQVVNINNGARLETYTIPGPRGSGIIS
PAND1_GLOVI     MLRTVLLSKIHRATVTGACLEYMGSISLDAQLLAAAHILAFEQVHVVNLNNGARLITYAIEATAGSGAVV
PAND_SORC5      MNRRMFKSKIHRATVTHADLHYEGSVTIDADLLEAADILPYEAVDIWNVTRGSRLTTYALAGARGSGVVC
PAND_OCEIH      MYRTMMKSKIHRAVVTEANLNYVGSITIDEAILNQVDILPNEKVQIVNNNNGARLETYVIAGERNSGTIC
PAND_CLOBM      MTITMLKSKIHRATVTEANLNYVGSITIDKALMDKSNILEYEKVQIVDIDNGNRFETYVIAGEENSGVIC
PAND_CLOBL      MTITMLKSKIHRATVTEANLNYVGSITIDKYLMDKANILEYEKVQIVDIDNGNRFETYVIAGEKHSGVIC
PAND_CLOBK      MTITMLKSKIHRATVTEANLNYVGSITIDKYLMDKANILEYEKVQIVDIDNGNRFETYVIAGEKHSGVIC
PAND_CLOBA      MILNMLKGKIHRATVTQADLNYMGSITIDKTLIDAAGILENEKVQIVDNNNGARLETYVIPGKRDSGIIC
PAND_LEGPL      --RKMLKSKIHRACVTQADLDYEGSITISPELLKAANILPYEAVNVWNITAGTRFETYAITGEKGSTDIC
PAND_LEPBL      ---TVMKGKIHRATVTDADLNYEGSLTVDMDLVDAAGMRVYEKVSVVNINNGARFETYIIEGKRGSGEIC
PAND_LEPBJ      ---TVMKGKIHRATVTDADLNYEGSLTVDMDLVDAAGMRVYEKVSVVNINNGARFETYIIEGKRGSGEIC
PAND_EXISA      MIRTFMHAKLHKATVTEANLHYVGSITIDEDLMDAVGIMENEHVHITNNHNGARIETYVIKGERGSGVIC
PAND_ANOFW      MFRTLMNAKIHRARVTEANLNYVGSITIDEDILDAVGMVPNEKVQIVNNNNGARFETYIIPGERGSGVFC
PAND_FRASN      MFRTMLNSKIHRATVTQADLHYVGSVTIXXXXXXXXXXXPGEQVTIVDINNGARLETYXXXXXXXXXXXX
PAND_THISH      MLLTLLKCKLHKATVTHSELEYEGSCAIDGDLLDAAGILPYEQIQIYNIANGERFTTYAIRAEAGSRVIS
PAND_CLONN      ----MLKSKIHRVTVTQAELSYVGSITIDKALMKAANILEYEKVQIVDIDNGARFETYVIPGEENSKVIC
PAND_SALRD      ---SMLRAKLHRLRVTEADLYYEGSITIDEELLDAAGLLPYEKVQVVNVNNGSRLETYTIPGEAGERTVC
PAND_PARD8      MFIEVVKSKIHRVTVTEANLNYIGSITIDEDLLDAANLIANEKVSIVNNNNGERFETYIIKGERGSGVVC
PAND_LEGPH      --RKMLKSKIHRACVTQADLDYEGSITISPELLKVANILPYEAVNVWNITAGTRFETYAITGEKGSTDIC
PAND_LEGPA      --RKMLKSKIHRACVTQADLDYEGSITISPELLKVANILPYEAVNVWNITAGTRFETYAITGEKGSTDIC
PAND_DEHSC      ----MLKSKIHRATITDACIDYEGSITIDKNLMQAANLLPYEQVHVVNVNNGTRLETYVIEGSAGSGQIC
PAND_CLOB1      MTITMLKSKIHRATVTEANLNYVGSITIDKYLMDKANILEYEKVQIVDIDNGNRFETYVIAGEKHSDVIC
PAND_BACHD      MFRTMMKAKLHRARVTESNLNYVGSITIDEDIMDAVDIVENEKVQIVNNNNGARFETYVIKGPRGSGVFC
PAND_SYNAS      MQRLMLKSKIHRATVTDADLHYEGSISIDEALMEAADLLPYEKVAIYDVNNGERFTTYVITGKRGSGVIC
PAND_STAES      MIRTFMNSKIHRARVTESNLNYVGSITIDANILDAVDILPNEKVAIVNNNNGARFETYVIAGERGSGKMC
PAND_STAEQ      MIRTFMNSKIHRARVTESNLNYVGSITIDANILDAVDILPNEKVAIVNNNNGARFETYVIAGERGSGKMC
PAND_DEHE1      ----MLKSKIHRATITDACIDYEGSITIDKNLMQAANLLPYEQVHVVNVNNGTRLETYVIEGPAGSGQIC
PAND_NAUPA      ----MLYSKIHRATVTDANLNYVGSITIDEELMEEANLLVGQKVDIVNINNGERFSTYVIKGKRGNRDIC
PAND_EXIS2      MLRTFMHAKLHKARVTEANLHYVGSITIDEDLLDAVGILENEKVQVTNNQNGARIETYAIKGARGSGVIC
PAND_BACTN      MMIEVLKSKIHCARVTEANLNYMGSITIDEDLLDAANMIPGEKVYIADNNNGERFETYIIKGERGSGKIC
PAND2_FRASC     MLRTMLTAKIHRATVTQADLHYVGSVTIXXXXXXXXXXXPGEQVTIVDINNGARLETYXXXXXXXXXXXX
PAND_CAMJR      ---TLLKSKIHRANVTEARLDYVGSISIDEKLLQASGILEYEKVQVVNVNNGARFETYTIATQE-EGVVC
PAND_CAMJJ      ---TLLKSKIHRANVTEARLDYVGSISIDEKLLQASGILEYEKVQVVNVNNGARFETYTIATQE-EGVVC
PAND_CAMJE      ---TLLKSKIHRASVTEARLDYIGSISIDEKLLQASGILEYEKVQVVNVNNGARFETYTIATQE-EGVVC
PAND_CAMJ8      ---TLLKSKIHRASVTEARLDYIGSISIDEKLLQASGILEYEKVQVVNVNNGARFETYTIATQE-EGVVC
PAND_CYTH3      ----VLKSKIHRVKVTQAELHYVGSITIDEALMEASNIIENEKVQIVNINNGERFETYVIKGEKNTGVIC
PAND_BACV8      MMIEVLKSKLHCVRVTEANLNYMGSITIDEDLMDAANMIAGEKVHIVDNNNGERFETYIIKGERGSGCIC
PAND_WOLSU      ----MLWSKIHRATVTDANLNYVGSITIDEELMEAAELLVGQKVEILDVNNGERFSTYVIRGERGSREIC
PAND_ANASK      MRRTFFKAKIHRATVTHADLEYEGSVSIDEDLLEAAGIWEYEAVHIWNITRGTRLQTYAIKGERGSGIIC
PAND_ANAD2      MRRTFFKAKIHRATVTHADLEYEGSVSIDEDLLEAAGIWEYEAVHIWNITRGTRLQTYAIKGERGSGIIC
PAND_ENTS8      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVTNGKRFSTYAIAGERGSKIIS
PAND_CAMHC      MTISMLQSKIHRATVTDANLNYVGSITIDEELIKKAGMLEFQKVDILDINNGERFSTYIIKGK--KGEIC
PAND_ANADE      MRRTFFKAKIHRATVTHADLEYEGSVSIDEDLLEAAGIWEYEAVHVWNITRGTRLQTYAIKGERGSGIIC
PAND_DEIGD      MERIMFRAKIHRATVTQADLDYVGSVTXXXXXXXXXXXXVNERVDIYNITNGNRLSTYALSGPRGSGVIG
PAND_BACFR      MMIEVLKSKIHCARVTEANLNYMGSITIDENLLDAANMIAGEKVYIADNNNGERFETYIIKGERGSGKIC
PAND_BACFN      MMIEVLKSKIHCARVTEANLNYMGSITIDENLLDAANMIAGEKVYIADNNNGERFETYIIKGERGSGKIC
PAND_DESAP      ----MLKSKIHRATVTGANLDYEGSITIDGELLEAAGILVFEQVQVANLNNGVRFETYVIPGARGSGVIN
PAND_DEIDV      MERIMFRAKIHRATVTQADLDYVGSVTXXXXXXXXXXXXVNEKVDIWNITNGNRLHTYALSGPRGSGVIG
PAND_CHLT3      ----IFKSKIHRATVTNADLYYEGSITIDMDLVDLAGMMPNEKVQVVNNNNGARFETYIIRGKRGSGTIQ
PAND_CAMJD      ----LLKSKIHRASVTEARLDYVGSISIDEKLLQASGILEYEKVQVVNINNGARFETYTIATQE-EGVVC
PAND_ARCB4      ----MLYSKIHRATVSDANLNYVGSITIDEDLMKAANLRVGQKVDIVNINNGERFQTYIIKGKAGSKDMC
PAND_THEPX      MQRFMMKSKIHRAIVTDANLNYQGSITIDKNLMELADILPNEKVQVLNINNGARFDTYAIEGERGSGTIC
PAND_THEP3      MQRFMMKSKIHRAIVTDANLNYQGSITIDKNLMELADILPNEKVQVLNINNGARFDTYAIEGERGSGTIC
PAND_LEPBP      MIITVCKGKIHRAVVTEAELHYEGSLTVDQDLMDMAGMKPYEQVSVVNVNNGARFETYLIVGERGSGTIC
PAND_LEPBA      MIITVCKGKIHRAVVTEAELHYEGSLTVDQDLMDMAGMKPYEQVSVVNVNNGARFETYLIVGERGSGTIC
PAND_DEIRA      MERIMFRAKIHRATVTQADLDYVGSVTXXXXXXXXXXXXVNEKVDIWNITNGNRLHTYALSGPRGSGVIG
PAND_SYNFM      MQRLMLKSKIHRARVTEANLHYEGSLTIDETLMKAADILPYEQIKVYNVFNGARFDTYAIAGPAGSGVFC
PAND_CHRVO      MQRNMLKSKLHRVTTTHAELHYIGSCAIDENLLEAADILEYEEVQIWNVTNGERFATYAIKAERGSGVIS
PAND_CAUCR      MLLTMLKAKLHRATVTQADLDYEGSIAIDRDLLDASGILPNEQVDVLNITNGARFTTYAIEAPRGSKVIG
PAND_CAUCN      MLLTMLKAKLHRATVTQADLDYEGSIAIDRDLLDASGILPNEQVDVLNITNGARFTTYAIEAPRGSKVIG
PAND_BRAJA      ---TLMKGKIHRASVTEADLHYEGSISIDRTLLEAAGMVINERVEIYNVETGTRFATYVIEAPPMSGTMS
PAND_PELCD      MKRKMLKSKIHRATVTGADLHYEGSITIDSELMKQADILPYEAVDIWNVTYGTRFQTYAIEGQPGSGVIC
PAND_HERAR      MQRIMLRAKIHRAKVTQADLHYEGSCGIDADLLEAADIKVGEKIELYNINNGERFSTYAIQGARGSGEIS
PAND_HELPY      ----MLYSKIHRATITDANLNYIGSITIDEDLAKLAKLREGMKVEIVDVNNGERFSTYVILGKK-RGEIC
PAND_ENT38      MIRKMLQGKLHRVKVTQADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGNRFSTYAIAGERGSKIIS
PAND_CAMFF      ----MLYSKIHRATVTDANLNYVGSITIDERLMKAANLLEFQKVEILDINNGERFQTYVIKGEK-KGEIC
PAND_HELP2      ----MLYSKIHRATITDANLNYVGSITIDEDLAKLAKLREGMKVEIVDVNNGERFSTYVILGKK-KGEIC
PAND_CAUSK      MLLTMMKAKLHRATVTQADLDYEGSIAIDTDLLDAAGILPNEQVDVLNITTGARFTTYAIAAPRGSKVIG
PAND_ACAM1      MHRTFLFSKIHHCTLTETNLEYVGSISIDQTLLDAAGIVPYEQVQVVNMNNGERLVTYAIPAPADSGAVE
PAND_THIDA      MQRTMLKSKLHRATVTHSELHYEGSCAIDESLLEAANIHEYEQIQIYNVSNGERFTTYAIRAARGSGVIS
PAND_HELPJ      ----MLYSKIHRATITDANLNYIGSITIDEDLAKLAKLREGMKVEIVDVNNGERFSTYVILGKK-RGKIC
PAND_SALTY      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SALTI      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SALSV      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SALPK      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SALPC      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SALPB      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SALPA      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SALNS      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SALHS      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SALG2      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SALEP      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SALDC      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SALCH      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SALA4      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_RALPJ      MQRNMLRAKLHRATVTQADLDYEGSCGIDEDLLDAADMREYEKIELYNVNNGERFSTYIIKGKRGSGEIS
PAND_HELPH      ----MLYSKIHRATITDANLNYIGSITIDEDLAKLAKLREGMKVEIVDVNNGERFSTYVILGKK-RGEIC
PAND_GRAFK      ----VVKSKIHRVKVTGADLDYIGSITIDEDLMEAASIIEGEKVQIVNNNNGERLETYVIPGLRNTGEIT
PAND_STRM5      ---SLLKTKIHRATVTHSELNYEGSIAIDDNLLAATGIREFEQVHIWDVTNGARFSTYAIRAEAGSGVVS
PAND_PSYWF      MLLTLLKGKLHRARVTHADLHYEGSCGIDGDLLDLAGIRENESIDIYNVSNGKRFRTYAIRAEAGSGIIS
PAND_CITK8      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_CAMC5      ----ILSSKIHRATVTDANLNYVGSITIDEELMRAANLLENQKVEILDVNNGERFATYVIKGK--KGEIC
PAND_SULDN      ----MLYSKIHRATVTDANLNYVGSITVDEELLEASMLRVGQKVEILNINNGERFSTYIILGERGKRDIC
PAND_PECCP      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFMDAAGILEYEAIDIYNVDNGQRFSTYAIAGERGSRIIS
PAND_HELPS      ----MLYSKIHRVTITDANLNYVGSITIDEDLAKLAKLREGMKVEIVDVNNGERFSTYVILGKK-RGEIC
PAND_STRMK      ---SLLKTKIHRATVTHSELNYEGSIAIDDNLLAATGIREFEQVHIWDVTNGARFSTYAIRAEAGSGVVS
PAND_SALAR      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDAAGILENEAIDIWNVSNGKRFSTYAIAAERGSKIIS
PAND_RHOBA      --RKMLAAKIHRATVTGADVNYEGSLTVPPELLVAAKIHPYESLHVWNVTRGTRLETYAIEGLPNSNDVC
PAND_ECOL5      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_BDEBA      ---SLLRTKIHRATVTGADLNYEGSVSICPDLIKASGLLMNERVDIYNCNNGARFSTYVIKGK--KGEIC
PAND_SHISS      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SHIFL      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SHIF8      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SHIDS      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SHIBS      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_SHIB3      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ESCF3      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECOUT      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECOSM      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECOSE      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECOLX      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECOLU      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECOLI      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECOLC      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECOL6      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECOK1      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECOHS      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECODH      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECOBW      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECO8A      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECO81      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECO7I      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECO5E      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECO57      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECO55      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECO45      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECO27      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_ECO24      MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIIS
PAND_CHLCH      ----LLKSKIHNAIVTSGDLEYEGSITIDSELLDLAGMIPNEKVLVVNNNNGERFETYIIKGDHGSREIQ
PAND_PHEZH      MLVTLMKAKLHRATVTQADLDYEGSIAIDRDLLDASGILPHEQVDVLNITTGARFTTYAIEAPRGSKVIG
PAND_METFK      MQRTMLKSKLHRVHVTHSELDYEGSCAIDEALLEAADIKEYQQIDIYNVNNGERFTTYAIRAERNSGIIS
PAND_FLAPJ      ----VVKSKIHRVTVTGADLNYIGSITIDEVLLEASNIIEGEKVNIVNINNGERFETYAIKGAKNSGEIT
PAND_RALSO      MQRNMLRAKLHRATVTQADLDYEGSCGIDEDLLDAADMREYEKIELYNVNNGERFSTYIIKGKRGSGEIS
PAND_YERE8      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVDNGQRFSTYAIAAERGSRIIS
PAND_XYLFM      MQLSLLKAKIHRATVSHSELNYEGSIAIDGLLLEAAGLYEFEKVHIWNVTNGARFTTYAIRAEHGSGIIS
PAND_XYLFA      MQLSLLKAKIHRATVSHSELNYEGSIAIDGLLLEAAGLYEFEKVHIWNVTNGARFTTYAIRAEHGSGIIS
PAND_SERP5      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVDNGQRFSTYAIAAERGSRIIS
PAND_RALEH      MQRIMLRAKLHRVTVTQADLNYEGSCGIDQDLLDAADMKEFEKIELYNVNNGERFSTYIIKGERGSGEIS
PAND_ERWT9      MNRTMLQGKLHRVKVTQADLNYEGSCAIDQDFLDASGILQYEAVDIYNVNNGQRFSTYAIAAERGSKIIS
PAND_CUPTR      MQRIMLRAKLHRVTVTQADLNYEGSCGIDQDLLDAADMKEFEKIELYNVNNGERFSTYIIKGERGSGEIS
PAND_MARMS      ---TLLKGKLHMASVTQAELWYDGSCAIDKDLVELAGFREFEQIDIYNVDNGERFHTYVILAESGSGTIS
PAND_ERWCT      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFMDAAGILEYEAIDIYNVDNGQRFSTYAIAGERGSRIIS
PAND_BURVG      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAAGLIENERIDIWNINNGERFSTYAIKGERGSGMIS
PAND_BURCJ      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAAGLIENERIDIWNINNGERFSTYAIKGERGSGMIS
PAND_ALHEH      MQLNMLKCKLHQACVTDTELDYEGSCAIDANLMDAAGIREFEQIHVYNLANGARFTTYAIRGEAGSRMIS
PAND_XANCB      ---SLLKAKIHRATVTHSELNYEGSIAIDGLLLEATGIREFEQVHIWDVTNGARFSTYAIRAEEGSGIIS
PAND_LARHH      MQRTLLKSKLHRVHVTQCELHYIGSCAIDEDLLEAADICEYEEIQIWNVNNGERFATYAIRGERGSGMIS
PAND_BURCH      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAAGLIENERIDIWNINNGERFSTYAIKGERGSGMIS
PAND_BURCC      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAAGLIENERIDIWNINNGERFSTYAIKGERGSGMIS
PAND_BURCA      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAAGLIENERIDIWNINNGERFSTYAIKGERGSGMIS
PAND_YERPY      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVDNGQRFSTYAIAAERGSRIIS
PAND_YERPS      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVDNGQRFSTYAIAAERGSRIIS
PAND_YERPB      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVDNGQRFSTYAIAAERGSRIIS
PAND_YERP3      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVDNGQRFSTYAIAAERGSRIIS
PAND_XANCP      ---SLLKAKIHRATVTHSELNYEGSIAIDGLLLEATGIREFEQVHIWDVTNGARFSTYAIRAEQGSGIIS
PAND_XANC8      ---SLLKAKIHRATVTHSELNYEGSIAIDGLLLEATGIREFEQVHIWDVTNGARFSTYAIRAEQGSGIIS
PAND_DECAR      MQRTMLKSKLHRVTATHADLHYEGSCAIDEDLLEAANIKEYEQIDIWNVNNGERFTTYAIRAERGSGVIS
PAND_STACT      MIRTMMNAKIHRARVTESNLNYVGSXXXXXXXXXXXXXXPNEKVAIVNNNNGARFETYVIKGERGSGKIC
PAND_BORA1      MQRIMLRAKLHRVTVTEADLHYEGSCGIDEDLLDAAGMREFERIELYNVTNGERFDTYIIKAARGSGAIS
PAND_ALCBS      ---TMLKAKLHQARVTHAELEYEGSCAIDGDLMDMAGILEYEQIQIYNIDNGERFETYAIRGEAGSKIIS
PAND_XYLFT      MQLSLLKAKIHRATVSHSELNYEGSIAIDGLLLEAAGLYEFEKVHIWNVTNGARFTTYAIRAEHGSGIIS
PAND_STAHJ      MIRTMMNGKIHRARVTESNLNYVGSXXXXXXXXXXXXXXPNEKVAIVNNNNGARFETYVIAGERGSGKIC
PAND_SACD2      ---TLLKGKLHMAKVTQAELWYDGSCAIDEEFVKLAGLREFEQIEIYNVDNGERFSTYVILAEAGSRTIS
PAND_PROMH      MLRTMLQGKLHRVKVTQADLHYEGSCAIDQDFMDAAGILENEAIDIYNVDNGERFSTYAICAERGSGIIS
PAND_HALHL      MQLNMLKGKLHQARVTQTELEYEGSCAIDLDLLEAVGIHEYEQIHVYNIENGERFVTYAIIGERGSRMIS
PAND_CAMC1      ----ILASKIHRAVVTDANLNYVGSISIGEELIKAANLIENQKVEILDINNGERFATYVIKGK--KGEIC
PAND_LEPCP      MFRTLLKSKIHRAVVTHCELHYEGSCGIDEDLLDAANLCENEQIHVWNINNGERFVTYVIKAPRGSGIIS
PAND_HELAH      ----MLYSKIHRATITDANLNYVGSITIDENLAKLAKLREGMKVEIVNINNGERFSTYVILGKK-RGEIC
PAND_XANOR      ---SLLKAKIHRATVTHAELNYEGSIAIDGLLLEATGIREFEQVHIWDVTNGARFSTYAIRAEDGSGIMS
PAND_XANOM      ---SLLKAKIHRATVTHAELNYEGSIAIDGLLLEATGIREFEQVHIWDVTNGARFSTYAIRAEDGSGIMS
PAND_DELAS      MFRTLLKSKIHRVKTTQCELHYEGSCAIDEDLLDAANIVENEQVHIWNIDNGERFVTYAIKGQRGSGMIS
PAND_BURA4      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANLIENERIDIWNINNGERFSTYAIKGERGSGMIS
PAND_BORPE      MQRIMLRAKLHRVTVTEADLHYEGSCGIDEDLLDAAGMREFERIELYNVTNGERFDTYIIKAARGSGAIS
PAND_AQUAE      MLREMLKSKIHRLTVTDADLHYEGSLSLDEYLMELADLKPFEKIDVYNINNGARFQTYVIPAPRYSGEVK
PAND2_POLSJ     MFRTLLKSKIHRVAVTHCELHYEGSCAIDEDLLDAANIAENEQIHIWNINNGERFVTYAIKGERGSGMIS
PAND_XANC5      ---SLLKAKIHRATVTHSELNYEGSIAIDGLLLEATGIREFEQVHIWDVTNGARFSTYAIRAEEGSGIMS
PAND_BURCM      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANLVENERIDIWNINNGERFSTYAIKGERGSGMIS
PAND_XANAC      ---SLLKAKIHRATVTHSELNYEGSIAIDGLLLEATGIREFEQVHIWDVTNGARFSTYAIRAEDGSGIMS
PAND_TERTT      ---TLLKGKLHMACVTQAELWYDGSCAIDADLVKLAGLREFEQIDIYNVDNGERFSTYVILAEPGSKTIS
PAND_CYAP8      MKRTFLNSKIHRATVTGSELNYVGSMAIDAELMKAANILPFERIEIVNVNNGQRWATYVIEAEPGSGIME
PAND_BURS3      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEASGIIENERIDIWNINNGERFSTYAIKGERGSGMIS
PAND_BURP6      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNINNGERFSTYAIKGERGSGMIS
PAND_BURM1      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNINNGERFSTYAIKGERGSGMIS
PAND_ACIBT      MLSRLLKCKIHRAVVTHAELHYEGSCAIDGVLMDLAGIREYEEIHVWNVTNGKRFTTYAIRGEDNSGIIS
PAND_ACIBS      MLSRLLKCKIHRAVVTHAELHYEGSCAIDGVLMDLAGIREYEEIHVWNVTNGKRFTTYAIRGEDNSGIIS
PAND_ACIBC      MLSRLLKCKIHRAVVTHAELHYEGSCAIDGVLMDLAGIREYEEIHVWNVTNGKRFTTYAIRGEDNSGIIS
PAND_POLNA      MFRTLLKSKIHRAAVTHCELNYEGSCAIDEDLLDAANLGENEQIHIWNINNGERFITYAIRAERGSRIIS
PAND_METCA      MQTTMLKAKLHRARVTHSELEYEGSCAIDGSLLDCAGIREYEQIQIYNVNNGERFTTYAIRAADGSGTIS
PAND_EDWI9      MVRTMLQGKLHRVKVTQSDLNYEGSCAIDQDFLNAAGILQYEAIDIYNVDNGQRFSTYAIAAEPGSKIIS
PAND_CHLPB      ----LLKSKIHNAVVTSGDLQYEGSITIDSELLDLANMIPNEKVLCVNNNNGERFETYIIEGKAGSREIQ
PAND_BURXL      MQRNMLKSKIHRVAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNINNGERFSTYAIKGERGSGMIS
PAND_BURPS      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNVNNGERFSTYAIKGERGSGMIS
PAND_BURP1      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNVNNGERFSTYAIKGERGSGMIS
PAND_BURP0      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNVNNGERFSTYAIKGERGSGMIS
PAND_BURMS      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNVNNGERFSTYAIKGERGSGMIS
PAND_BURMA      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNVNNGERFSTYAIKGERGSGMIS
PAND_BURM9      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNVNNGERFSTYAIKGERGSGMIS
PAND_BURM7      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNVNNGERFSTYAIKGERGSGMIS
PAND_BORPA      MQRIMLRAKLHRVTVTEADLHYEGSCGIDEDLLDAAGMREFERIELYNVTNGERFDTYIIKAARGSGAIS
PAND_BORBR      MQRIMLRAKLHRVTVTEADLHYEGSCGIDEDLLDAAGMREFERIELYNVTNGERFDTYIIKAARGSGAIS
PAND_YERPP      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVDNGQRFSTYAIAAERGSRIIS
PAND_YERPN      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVDNGQRFSTYAIAAERGSRIIS
PAND_YERPG      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVDNGQRFSTYAIAAERGSRIIS
PAND_YERPE      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVDNGQRFSTYAIAAERGSRIIS
PAND_YERPA      MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVDNGQRFSTYAIAAERGSRIIS
PAND_DESPS      MLHQMMKAKLHRATISAADLNYEGSLTIDTDLLKASGIRPYERIYVYNVNNGERFETYAIEGEAGSGAIQ
PAND1_POLSJ     MFRTLLKSKIHRASVTHCELNYEGSCAIDEDLLDAANLGENEQVHIWNINNGERFITYAIRAERGSRIIS
PAND_PERMH      MRRTILKSKIHRITITGADLHYEGSLTLDEAIMEAANLVPFEKIEIYNVNNGHRFSTYVIPGQRYGGECI
PAND_METPP      MNRLMLRAKLHRATVTEADLHYEGSCGIDAALLEAADMREFEQIELYNVNNGERFSTYVIPAPPGSGVIS
PAND_HYDS0      MKRHILRAKIHRATVTGANLNYEGSISIDERLLEAGKFVVFEKVDIYNVNNGNRFSTYVIPGK--PGEIS
PAND_SODGM      MQRTMLRGKLHRVHVTQVDLHYEGSCAIDQDFLDAAGILEYEAIDIYNVDNGQRFSTYAIAAERGSRIIS
PAND_CELJU      MLSHMLKAKLHMAKVTQAELWYDGSCAIDADLVALAGMREFEQIDIYNVSNGERFHTYIILAEPGSGTIS
PAND_BURPP      MQRNMLKSKIHRVAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNINNGERFSTYAIKGERGSGMIS
PAND_ACIBY      MLSRLLKCKIHRAVVTHAELHYEGSCAIDGVLMDLAGIREYEEIHVWNVTNGKRFTTYAIRGEDNSGIIS
PAND_ACIB5      MLSRLLKCKIHRAVVTHAELHYEGSCAIDGVLMDLAGIREYEEIHVWNVTNGKRFTTYAIRGEDNSGIIS
PAND_ACIB3      MLSRLLKCKIHRAVVTHAELHYEGSCAIDGVLMDLAGIREYEEIHVWNVTNGKRFTTYAIRGEDNSGIIS
PAND_THICR      ---TLLKSKLHRVTTTHSELDYEGSCAIDGHFLEVAGIREYEQIQIYNVNNGNRFTTYAIRAEENTGIIS
PAND_BACCN      MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAXXXXXXXXXXXXXXXXXXRLETYVIKGERGSGVIC
PAND2_GLOVI     MLRTVLLGKIHRATVTGACLEYVGSISVDSRLLAAAGILPHEQVHVVNLNNGARLVTYAIEASEGSXXXX
PAND_CHLL2      ----LLKSKIHNAIVTSGDLEYEGSITIDSELLEMAQMIPNEKVLVVNNNNGERFETYIIKGDYGSRVIQ
PAND_BURTA      MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNINNGERFSTYAIKGERGSGMIS
PAND_ACIAD      MLSRLLKCKIHRAVVTHAELHYEGSCAIDGVLMDLAGIREYEEIHVWNVTNGKRFTTYAIRGEDHSGIIS
PAND_PROVI      ----LLKSKIHNAIVTSGDLEYEGSITVDSELLKKADMIPNEKVLVVNNNNGERFETYIIKGDHGSRVIQ
PAND_KOSOT      MFRIMQKSKIHRATVTDKNLNYEGSITIDYRLMKLADIRENELVQVVNINNGERFETYVIKGEEGSGVIA
PAND_TOLAT      MQRIMLRGKLHQARVTHAVLNYEGSCGIDQDFLDAAGIVEYEAIDIYNIENGERFSTYAISGERGSRMIS
PAND_PROA2      ----LLKSKIHNAIVTSGDLEYEGSITIDSQLLELADMLPNEKVLCVNNNNGERFETYIIKGKAGSREIQ
PAND_HELHP      ----MLYSKIHRAKVSDANLNYVGSITIDKTLAQSANLLAGMKVEIVNINNGERFSTYVIYGDK-KGEIC
PAND_PELPB      ----ILKSKIHNAIVTSGDLEYEGSITIDNELLEMVDMIPNEKVLVVNNNNGERFETYIIKGAHGSREIQ
PAND_CHLTE      ----MLKSKIHNAIVTSGDLEYEGSITIDKELLDMADMIANEKVLVVNNNNGERFETYIIEGTRGLREIQ
PAND_POLSQ      MNRIMLLAKIHRATVTEADLHYEGSCGIDEDLLDAANMREFEKIELYNINNGNRFSTYIIKAVRGSGIIS
PAND_CHLP8      ----MLKSKIHNAIVTSGDLEYEGSITIDKELLEIADMMANEKVLVVNNNNGERFETYIIEGTRGLREIQ
PAND_BURP8      MQRNMLKSKIHRAVVTHCELHYEGSCAIDENLLEAANIVENERIDIWNINNGERFSTYAIKGERGSGMIS
PAND_CYAA5      ----LMHAKLHRVQVTEANIDYVGSITIDPILLDKVGILPLEEVDIVNLNNGNRFSTYVIPGETGKGEIC
PAND_SULSY      MYRTLLKSKVHRIKITGADLHYEGSLTLDEEIMEAANLIPFEKIEVYNVNNGQRFSTYVIPGVRYSGECI
PAND_PELLD      ----LLKSKIHNAIVTSGDLEYEGSITIDCELLEKADMIPNEKVLVVNNNNGERFETYIINGVRGSRVIQ
PAND_CYAP7      ----LMHAKLHRVRVTEANVGYIGSITIDPQLLDRVGILPLEEVDIVNLNNGKRFSTYVFPGEAGTGEVC
PAND_ANAVT      MQRTLLLAKIHNCTLTGANINYVGSISIDQILLDKSGILPYEQVQVVNNANGQRFITYAIPAPAHSGIIE
PAND_ANASP      MQRTLLLAKIHNCTLTGANINYVGSISIDQILLDKSGILPYEQVQVVNNANGQRFITYAIPAPAHSGIIE
PAND_CHRSD      MYTIMLKAKLHMARVTHAVLDYEGSCAIDGELLDLAGIRENEQIQIYDVENGNRFTTYAIRGEAGSRLIS
PAND_NOSP7      MQRTLLLAKIHNCTLTGANINYVGSISIDEILLEKAGILPYEQVQVVNSANGQRFITYAIPAPAHSGVIE
PAND_CHLPD      ----LLKSKIHNARVTSGDLEYEGSITIDQELLLLAEMIPNEKVLVVNNNNGERFETYIINGEPGSRVIQ
PAND_RHOFD      MLRTLLKSKIHRATVTDCELHYEGSCAIXXXXXXXXXXXXXXQIHIWNINNGERFVTYAIRGERGTGIIS
PAND_PHOLL      MLRTMLQGKLHRVKVTQADLHYEGSCAMDQNFMDAAGILEYEAIDIYNVDNGERFSTYAIAAERGSRIIS
PAND_NITOC      MYLTLLKSKLHRACVTHIELEYEGSCAIDSVLLSTAGIQEYEQIHIYNLTNGERFVTYAIRAEDNSGIIS
PAND_FRATN      MLISVLKSKISYATVTGKDLFYVGSITIDSEIMKQANIIENEKVQVVNLNNGARLETYVIKGEPNSKTIA
PAND_THELT      -MRFMLKSKLHMACVTDKNINYEGSIEIDEELMNIVDLKENELVLIADLNNGQRFETYVIKGKPGSGTIS
PAND_PSYCK      MLLNMLKCKLHRARVTHAELHYEGSCXXXXXXXXXXXXRENESIDIYNVTNGKRFRTYAIRAEAGSGIIS
PAND_PSYA2      MLLNMLKCKLHRARVTHAELHYEGSCXXXXXXXXXXXXRENESIDIYNVTNGKRFRTYAIRAEAGSGIIS
PAND_HYPNA      MILSMLKAKLHGATVTQCDLHYEGSVSIDQDLLDASGILPHEKVDIWNVTNGARIQTYALEAPRGSRTIG
PAND_MICAN      ----LMHAKLHRVRVSEANVDYVGSITIDRELIERVGILPLEEVDVVNLSNGKRFSTYVFPGH--TGEIC
PAND_FRATW      MLISVLKSKISYATVTGKDLFYVGSITIDSEIMKQANIIENEKVQVVNLNNGERLETYVIKGEPNSKTIA
PAND_FRATT      MLISVLKSKISYATVTGKDLFYVGSITIDSEIMKQANIIENEKVQVVNLNNGERLETYVIKGEPNSKTIA
PAND_FRATO      MLISVLKSKISYATVTGKDLFYVGSITIDSEIMKQANIIENEKVQVVNLNNGERLETYVIKGEPNSKTIA
PAND_FRATH      MLISVLKSKISYATVTGKDLFYVGSITIDSEIMKQANIIENEKVQVVNLNNGERLETYVIKGEPNSKTIA
PAND_FRAT1      MLISVLKSKISYATVTGKDLFYVGSITIDSEIMKQANIIENEKVQVVNLNNGERLETYVIKGEPNSKTIA
PAND_MARMM      MRLTMMKCKLHRATVTQADLHYEGSISIDRDYLEAAGILPHEQVDVLNINNGERFTTYAIEAPRGSRTFG
PAND_PSYIN      MKKTMLTGKLHQARVTHAELNYEGSCAIDQDLLEQAGXXXXXXXXXXXXXXGARFSTYAITGERGSKMIS
PAND_XANP2      -MRKIVAGKLHGLTVTGADLNYHGSITLDPEHCEEAGILPLEFVEIWNRNSGARISTYVILGERGSRCCV
PAND_RUTMC      MKRTFLSAKLHKVITTAVELDYEGSCEIDGVLLDAADIGAFEQIQIYNINNGNRFTTYTIRGKDNSGVIS
PAND2_RHILO     -MRKIVAGKLHGIHVTEANLDYHGSITLDPDHCEEAGILPMEFVEIWNKNSGARISTYVILGERGSRCCI
PAND_PSEAE      ----MLKAKLHRAEVTHAVLDYEGSCAIDGDWLDLSGIREYEQIQIYNIDNGERFTTYAIRAENGSKMIS
PAND_HALWD      MRRWLLKSKLHRARVTGTEKDYEGSISIDAALLSEADIAVGEQVQVVNVTNGERFETYTIEGE--SRQME
PAND_DIAST      MYRTLLKSKIHRVKTTHCELHYEGSCAIDEDLLEAANICENEQVHIWNVDNGERFVTYAIKGQRGSGMIS
PAND_ACISJ      MYRTLLKSKIHRVKTTHCELHYEGSCAIDEDLLEAANICENEQVHIWNVDNGERFVTYAIKGQRGSGMIS
PAND_PSEAB      ----MLKAKLHRAEVTHAVLDYEGSCAIDGDWLDLSGIREYEQIQIYNVDNGERFTTYAIRAENGSKMIS
PAND_PSEA8      ----MLKAKLHRAEVTHAVLDYEGSCAIDGDWLDLSGIREYEQIQIYNVDNGERFTTYAIRAENGSKMIS
PAND_PSEFL      ----MLKAKLHRAEVTHAVLDYEGSCAIDGEWLDLSGIREYEQIQIYNVDNGERFTTYAIRGEEGSRMIS
PAND_METNO      -MRRIVAGKLHGIYVTDANLNYHGSITLDPDHCEEAGILPMEFVEIWNKNSGARISTYVILGERGSRCCI
PAND_PSEA7      ----MLKAKLHRAEVTHAVLDYEGSCAIDGDWLDLSGIREYEQIQIYNVDNGERFTTYAIRAENGSKMIS
PAND_TRIEI      ----LMHAKLHRVRVTDAKPDYVGSVTIDSDLLEKVGILPLEEVQIVNLNNGQRWLTYVLPGQAGSGMVC
PAND_THEAB      MQEIMLKSKIHMAKVTDKSINYMGSIGIDTELLEKAGMKPYELVLVADVNNGQRFVTYIIPEEKGSKKIV
PAND_FERNB      MMEIMLKAKIHMATVTEKEIEYEGSIGIDEELLELSGIKINEMVLISDVNNGNRFITYVIPEPRGSRKIS
PAND1_RHILO     -MRKLVAGKLHGIHVTEANLNYHGSITLDPDHCEAAGILPMEFVEIWNKNSGARISTYVILGERGSRCCI
PAND_PSEU5      ----MLKAKLHRAQVTHSVLDYEGSCAIDGEWLDLAGIREYEQIQIYNVDNGERFTTYAIRGEEGSRIIS
PAND_THESQ      MLNIYLKSKIHMATVTGKKLFYEGSIEIDEELMERAGISEGEMVLVVNVNNAERFVTYVIKGKRGSREIN
PAND_AZOVD      ----MLKAKLHRAEVTHSVLDYEGSCAIDGEWLDLAGIHEYEQIQIYNVDNGERFTTYAIRAEDGSKMIS
PAND_SYNY3      ----LMHAKLHRVCVTEANVNYVGSITIDPVMLERVGLLPLEEVDIINLSNGNRFSTYVLPGQAHSKEIC
PAND_METSB      -MRKLVGGKLHGIRVTESNLEYHGSITLDPAHCEAAGILPLEFVEIWNKNSGARITTYVILGQRGSRCCV
PAND_THEM4      MQEILLKSKIHMAKVTDKSINYMGSIGIDVELLEKSNIKPYELVLVADVNNGQRFVTYTIPEEKGSRKIV
PAND_COPPD      MLITVLKSKIHNARVTVCNVDYEGSLSLDEELIKQANLRPYEKVLVANVTNGERFETYIIPAPANSREVG
PAND_RHOCS      ----VVRAKLHGITVTGADLNYHGSITLDPEICAQAGIYPMEFVEIWNRNSGARISTYVIFGEPGSGCCI
PAND_BEII9      -MRKVMAAKLHGIHVTAADLDYHGSITLDPDHCEKAGLLPLEFVDIWNKNSGARISTYVIFGERYSRCCI
PAND_COXBU      MLISVLKSKISYATITQKELFYIGSITIDEAIMERAQLTINEQVQIVNLNNGERLETYVIPGKRNSNIIA
PAND_VESOH      MKRIFLSAKLHKVTTTAVELNYEGSCEIDGVLLDAAGIGAFEQIQIYNINNGNRFTTYTILGKDNSGIIS
PAND_PYRIL      ----LLRAKAHGLVVTGKNLHYEGSLTLGRDIIEAAGFYPLEKVEVYNVTNGARFTTYVIPG--RPGEVV
PAND_DESDA      ----ILRAKLHGIRVTECVLDYHGSITLDPEICGLAGIMPLEFVYIWNKHSGQRISTYVIYGEAGSRCCI
PAND_THEMA      MLNIYLKSKIHMATITRKEVYYEGSIEIDEELMGKAGISEGEXXXXXXXXXAERFVTYVIKGKRGSREIN
PAND_THEP1      MLNIYLKSKIHMAKITRKEVYYEGSIEVDEELMEKAGISEGEXXXXXXXXXAARFVTYVIKGKRGSREIN
PAND_AGRT5      ----IVRAELHGITVTGADLDYHGSITLDPEHCDLAGIRPLEFVDIWNKQSGARISTYVIFGEAGSKCCI
PAND_MAGSA      ----IIRAKLHGIRVTNADLNYHGSITLDPEQCEMAGIYPMEFVDIWNKNSAARISTYVIFGEPGSRCCV
LPTD_PSYCK      ------------------NVDYAGNVIIDQGTQH----IEAEKI-VLDLSNGAAAQGKVMFTDQATGNVS


                         .         .         *         .         .         .         .:140
query           INGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRIVALGNDLAEALPGSGLLTSRSI
PAND_CORGL      INGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRIVALGNDLAEALPGSGLLTSRSI
PAND_CORGB      INGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRIVALGNDLAEALPGSGLLTSRSI
PAND_COREF      INGAAAHLINPGDLVIIMSYLQATDAEARAYQPNIVHVDADNRIVALGNDAGEPIPGSSLLSSRSL
PAND_STRGG      INGAAAHLVHPGDLVILISYAQVDDAEARAFVPRVVHVDADNRIVALGSDASAPVPGS--------
PAND_ACIC1      INGAAARLVHPGDLVIIMSYVQLPDAEARRHHPRVVFVDAENRIIGTGTDPAEPLPGSGLLS----
PAND_THEFY      INGAAARLVAPGDLVIIISYVQLTEAERATHRPHVVHVDANNRIVALGDDLAEPVPGS--------
PAND_RHOE4      INGAAAHLVKPGDLVILIAYGVMNEQEVKEYSPRVVFVDADNKQIELGSDPAHAPEGSGLITPRML
PAND_MYCVP      INGAAAHLVHPGDLVILIAYGTMEDAEARAYRPRVVFVDADNRPIDLGVDPAYVPPDAGELLS---
PAND_KOCRD      INGAAAHLVHPGDLVILIAYGLMDTAEAQTYEPRVVHVDERNRIVALGSDPADAVVG---------
PAND_ARTCA      INGAAAHLMHENDLVILITYAQMTTEEAKAYEPKVVHVDQDNRIIQLGNDPAEGIPG---------
PAND_MICLC      INGAAAHLVHPGDIVILIAYGQMDDDEARHFQPKVVHVDADNRIVELGIDPADGL-----------
PAND_STRCO      INGAAAHLVHPGDLVILISYAQVTDAEARSLRPRVVHVDGDNRIVGLGADASEPVPGS--------
PAND_RHOSR      INGAAAHLVKPGDLVILIAYGVMNEQEVRDYEPRVVFVDAANSPIELGADPAHAPEGSGLITPRML
PAND_RHOOB      INGAAAHLVKPGDLVILIAYGVMNEQEVRDYEPRVVFVDAANTPVDLGADPAHAPEGSGLITPRML
PAND_MYCLE      INGAAAHLVHPGDLVILISYGTMEDAEAHAYQPRIVFVDADNKPIDLGHD-----PGS--------
PAND_MYCLB      INGAAAHLVHPGDLVILISYGTMEDAEAHAYQPRIVFVDADNKPIDLGHD-----PGS--------
PAND_RENSM      INGAAAHLVNIGDTVILISYAQMTTAEAREYLPSIVHVDAANKIVQLGTDPAEAL-----------
PAND_ARTS2      INGAAAHLMHENDIVILITYAEMTTEEAKAYTPKVVHVDKDNKIVQIGNDPAE-------------
PAND1_ARTAT     INGPAAHLVHENDTVILITYAQMTHEEARAHEPRVVHVNQDNRVIQLGNDPAQGIPG---------
PAND_MYCS2      INGAAAHLISPGNLVIIMSFVHLDEAERADHRANVVHVDADNHIVTIGSDPAQPVPGA--------
PAND_CORJK      INGAAARLISPGDLVIIIGYAQYSEEDLKNYASRVVFVDGNNKQVELGGDPAQVPDGSGLKNPR--
PAND_SACEN      INGAAAHLIEPGDLVILISYGVMDELEARSVRPKVIFVDADNRIVERGQDPGHAPAGSGL------
PAND1_FRASC     INGAAAHLISPGDLVIIVGYALMAEEDARSYQPNVVFVNGDNQLVRMGTDPAEAYDGVGLV-----
PAND_NOCSJ      INGAAARLVHPGDLVILIAYGQMEDVEAKGFEPHVVFVDADNRVVSTGSDPADAPAGSGLL-----
PAND_NOCFA      INGAAAHLVHPGDLVILIAYGMMNEQEIAEYDPKVVFVDERNRPVELGSDPAHAPEGSGLTSPRSL
PAND_MYCGI      INGAAAHLIHPGDLVILIAYGMLDDAAARTYEPRVVFVDADNRVLDLGADPAFVPDTAELLSPR--
PAND_FRAAA      INGAAARLVQPGDLVIIIAYGMMDDAEARRHVPRVLFVDAENRIIGRGHDPAEALP----------
PAND_CLAM3      INGAAAHLVDVGDVVILIAYGQMTTEEARALEPRVVHVDVGNRI----------------------
PAND_MYCUA      INGAAAHLVHPGDLVILIAYGTMQDAEARAYQPRIVFVDADNKQIDVGHDPA--------------
PAND_MYCPA      INGAAAHLVHPGDLVILIAYGTMEEAEARAYQPRIVFVDADNKPVDLGHDPA--------------
PAND_MYCA1      INGAAAHLVHPGDLVILIAYGTMEEAEARAYQPRIVFVDADNKPVDLGHDPA--------------
PAND_SALTO      INGAAAHLVHPGDLVILIAYGQLEDAQARGYQPRIVHVDSGNRI----------------------
PAND_NEIG2      LNGAAARLVQKGDIVIIMSYIQLSEPEIAAHEPKVVLVDGNNKI----------------------
PAND_NEIG1      LNGAAARLVQKGDIVIIMSYIQLSEPEIAAHEPKVVLVDGNNKI----------------------
PAND_MYCSS      INGAAAHLVHPGDLVILIAYGTMEDAEARAYQPRVVFVDADNRQVHLGADPA--------------
PAND_MYCSK      INGAAAHLVHPGDLVILIAYGTMEDAEARAYQPRVVFVDADNRQVHLGADPA--------------
PAND_MYCSJ      INGAAAHLVHPGDLVILIAYGTMEDAEARAYQPRVVFVDADNRQVHLGADPA--------------
PAND_SALAI      INGAAAHLVHTGDLVILIAYGQMDDAEARAYQPRVVHVDSANQVIDLNAD----------------
PAND_NEIMB      LNGAAARLVQKGDIVIIMSYVQLSEPEIAAHEPKVVLVDGNNKI----------------------
PAND_NEIMF      LNGAAARLVQKGDIVIIMSYVQLSEPEIAAHEPKVVLVDGNNKI----------------------
PAND_NEIMA      LNGAAARLVQKSDIVIIMSYVQLSEPEIAAHEPKVVLVDGNNKI----------------------
PAND2_ARTAT     INGAAAHLVHVDDTVILITYAEMTTEEARTYEPRVVHVGKDNKILQLGNDPAE-------------
PAND_CLOB8      LNGAAARLVQPGDKVIIIAYAQMNEDEARKYKPSVVFMNDDNTIKEITN-----------------
PAND_CALS8      LNGAAARLVQVGDKVIIMAYCLLTMEEYKTHMPKIVFVDDNNKIVKLSN-----------------
PAND_MYCTU      INGAAAHLVHPGDLVILIAYATMDDARARTYQPRIVFVDAYNKPIDMGHDPAFVPENAGEL-----
PAND_MYCTA      INGAAAHLVHPGDLVILIAYATMDDARARTYQPRIVFVDAYNKPIDMGHDPAFVPENAGEL-----
PAND_MYCBT      INGAAAHLVHPGDLVILIAYATMDDARARTYQPRIVFVDAYNKPIDMGHDPAFVPENAGEL-----
PAND_MYCBP      INGAAAHLVHPGDLVILIAYATMDDARARTYQPRIVFVDAYNKPIDMGHDPAFVPENAGEL-----
PAND_MYCBO      INGAAAHLVHPGDLVILIAYATMDDARARTYQPRIVFVDAYNKPIDMGHDPAFVPENAGEL-----
PAND_STRAW      INGAAAHLVHPGDLVIIISYAQVSDAEARALXXXXXXXXXXXXXXALGADPAEPVPGS--------
PAND_HERA2      LNGAAAHLVNVGDLVIIMAYAQ-VDAKPEEWEPTVVFVNEQNAI----------------------
PAND_MYXXD      INGAAAHLNKPGDLVILATFXXXXXXXXXNWKPTVVFVDKDNRVV---------------------
PAND_CLOCE      LNGAAARYAQVSDKVIIMAYAQMTKEEAQKHKPNVVFVDDNNRITRKTN-----------------
PAND_CLOTH      LNGAAARLVHPGDLIIIISYGIFDREEAKTFNPKVVFVD---------------------------
PAND_BACSU      LNGAAARLVQEGDKVIIISYKMMSDQEAASHEPKVAVLNDQNKIQMLGNEPARTI-----------
PAND_BACA2      LNGAAARLVQEGDKVIIISYQMMSDQEAKSHQPKVAVLDDQNKI----------------------
PAND_BACCR      LNGAAARLVQPGDKVIIICYGLVTEEEIHTQEPKIAVLDDNNQIIEM-------------------
PAND_BACC4      LNGAAARLVQPGDKVIIICYGLVTEEEIHTQEPKIAVLDDNNQIIEM-------------------
PAND_BACC2      LNGAAARLVQPGDKVIIICYGLVTEEEVHKQEPKIAVLDDNNQIIEM-------------------
PAND_ANADF      INGAAAHLNKPGDLVILATFAELDEAEARGFKPTVVLVDRKNKIV---------------------
PAND_LISMO      LNGAAARHVQVGDVVIIMSYGMFTDEEAKTHEPKIVVLDEKNHI----------------------
PAND_BACSK      LNGAAARKVQPGDVVIILSYAMMENAEALAHQPKVAILDENNRIVEM-------------------
PAND_ANATD      LNGAAARLVQVGDKIIIMAYCLLTMEEYYNHKPRIVFVDDENKIVRLSD-----------------
PAND_CORU7      INGAAARLISPGDLVIIIGYGIFDNAELGDYHPRVIFVDENNKQVELGEDPAHAPAGSGLKDPR--
PAND_PELTS      LNGAAARLVQPGDLVIIISYAIMDAGEARTYRPAVVMVDGRNKIVEVRQGEAHGPAGA--------
PAND_GEOBB      INGAAARLVAPQDLVIIASFVNMENAEAIAHEPKLVFVDDKNRMLESRKEVA--------------
PAND_ENTFA      LNGAAARCVSTGDKIILMAYCELNENEVKDHRPKVVFVDDNNKV----------------------
PAND_STAAR      LNGAASRLVEVGDVVIIMTYAQLNEEEIKNHAPKVAVMNEDNVIIEM-------------------
PAND_STAAN      LNGAASRLVEVGDVVIIMTYAQLNEEEIKNHAPKVAVMNEDNVIIEM-------------------
PAND_STAAM      LNGAASRLVEVGDVVIIMTYAQLNEEEIKNHAPKVAVMNEDNVIIEM-------------------
PAND_STAAE      LNGAASRLVEVGDVVIIMTYAQLNEEEIKNHAPKVAVMNEDNVIIEM-------------------
PAND_STAAC      LNGAASRLVEVGDVVIIMTYAQLNEEEIKNHAPKVAVMNEDNVIIEM-------------------
PAND_STAAB      LNGAASRLVEVGDVVIIMTYAQLNEEEIKHHAPKVAVMNEDNVIIEM-------------------
PAND_STAA9      LNGAASRLVEVGDVVIIMTYAQLNEEEIKNHAPKVAVMNEDNVIIEM-------------------
PAND_STAA8      LNGAASRLVEVGDVVIIMTYAQLNEEEIKNHAPKVAVMNEDNVIIEM-------------------
PAND_STAA3      LNGAASRLVEVGDVVIIMTYAQLNEEEIKNHAPKVAVMNEDNVIIEM-------------------
PAND_STAA2      LNGAASRLVEVGDVVIIMTYAQLNEEEIKNHAPKVAVMNEDNVIIEM-------------------
PAND_GEOKA      LNGAAARLVQKGDVIIVISYVLVPEEKIAAHRPKIAIMDENNRIVQL-------------------
PAND_GEOSM      INGAAARLVAPQDLVIIASFVNMENAEAIAHEPKLVFVDDKNRMLESRKEVA--------------
PAND_BACWK      LNGAAARLVQPGDKVIIICYGLVAEENIHKQEPKIAVLDDDNQIIEM-------------------
PAND_BACHK      LNGAAARLVQPGDKVIIICYGLVAEENIHKQEPKIAVLDDDNQIIEM-------------------
PAND_BACCZ      LNGAAARLVQPGDKVIIICYGLVAEENIHKQEPKIAVLDDDNQIIEM-------------------
PAND_BACCQ      LNGAAARLVQPGDKVIIICYGLVAEENIHKQEPKIAVLDDDNQIIEM-------------------
PAND_BACC7      LNGAAARLVQPGDKVIIICYGLVAEENIHKQEPKIAVLDDDNQIIEM-------------------
PAND_BACC3      LNGAAARLVQPGDKVIIICYGLVAEENIHKQEPKIAVLDDDNQIIEM-------------------
PAND_BACC0      LNGAAARLVQPGDKVIIICYGLVAEENIHKQEPKIAVLDDDNQIIEM-------------------
PAND_BACAN      LNGAAARLVQPGDKVIIICYGLVAEENIHKQEPKIAVLDDDNQIIEM-------------------
PAND_BACAH      LNGAAARLVQPGDKVIIICYGLVAEENIHKQEPKIAVLDDDNQIIEM-------------------
PAND_BACAC      LNGAAARLVQPGDKVIIICYGLVAEENIHKQEPKIAVLDDDNQIIEM-------------------
PAND_BACAA      LNGAAARLVQPGDKVIIICYGLVAEENIHKQEPKIAVLDDDNQIIEM-------------------
PAND_MOOTA      ANGAAARLVQPGDXXXXXAYGIFDDREARTYQPRVIFLDARNKITAV-------------------
PAND_HELMI      LNGAAARLVQPGDKVILITYGIYDDAEARQHRPTVIFLDDQNRIIA--------------------
PAND_THET8      INGAAAHLVKPGDLVILVAYGVFDEEEARNLKPTVVLVDERNRIL---------------------
PAND_THET2      INGAAAHLVKPGDLVILVAYGVFDEEEARNLKPTVVLVDERNRIL---------------------
PAND_PELPD      LNGAAARLVAPKDVVIIASFVNMSNQAAIKHEPKLVFVDGKNRML---------------------
PAND_LISIN      LNGAAARHVQVGDVVIIMSYGMFTSEEAKTHEPKIVVLDEKNHI----------------------
PAND_EUBR3      LNGAAARQVAVGDHVILMCYAQMTPEEAKEHHPKVVFVDDENKIARVTN-----------------
PAND_STAAW      LNGAASRLVEVGDVVIIMTYAQLNEEEIQNHAPKVAVMNEDNVIIEM-------------------
PAND_STAAS      LNGAASRLVEVGDVVIIMTYAQLNEEEIQNHAPKVAVMNEDNVIIEM-------------------
PAND_PORGI      LNGAAARIVHPGDIIIIMAYAWMPMEEAKVFKPAVVFPDATNKII---------------------
PAND_PORG3      LNGAAARIVHPGDIIIIMAYAWMPMEEAKVFKPAVVFPDATNKII---------------------
PAND_LISMC      LNGAAARHVQVGDVVIIMSYGMFTTEEAKTHEPKIVVLDEKNHI----------------------
PAND_BACP2      LNGAAARLVQPGDEVIIIAYGMLSEGEAKTHTPKVVVLNKENQI----------------------
PAND_LISMH      LNGAAARHVQVGDVVIIMSYGMFTAEEAKTHEPKIVVLDEKNHI----------------------
PAND_LISMF      LNGAAARHVQVGDVVIIMSYGMFTAEEAKTHEPKIVVLDEKNHI----------------------
PAND_BACLD      LNGAAARLVQVGDVVIIVSYAMMSEEEAKTHKPKVAVLNERNEI----------------------
PAND_BACC1      LNGAAARLVQPGDKVIIICYGLVAEENIHKQEPKIAVLDDNNQIIEM-------------------
PAND_GEOTN      LNGAAARLVQKGDIIIVISYALVPEEKIAMHRPKVAIMDENNRIAQL-------------------
PAND_DESHY      LNGAAARLVQVGDEVIIIAYGIFTDEAARTYEPKVIFVDEGNNPVKIAHE----------------
PAND_DESHD      LNGAAARLVQVGDEVIIIAYGIFTDEAARTYEPKVIFVDEGNNPVKIAHE----------------
PAND_LISW6      LNGAAARHVQVGDVVIIMSYGMFTTEEANKHEPKIVVLDEKNHI----------------------
PAND_CLOK5      LNGAAARHVQPGDKVILMTYCQMDEEEAKIHKPIVIFLDENNSI----------------------
PAND_CLOK1      LNGAAARHVQPGDKVILMTYCQMDEEEAKIHKPIVIFLDENNSI----------------------
PAND_CLOAB      LNGAAARCAQAGDKVIIMCYCSLTPEEASEHRPKVVFVNDDNSI----------------------
PAND_SYNWW      LNGAASRLVQKGDVVIILTYTVLQDEECHNHKPRLVFMDGNNNIKELG------------------
PAND_GEOSW      LNGAAARLVQKGDIIIVISYAIVPEEKIAQHRPKIAIMDENNRIQQL-------------------
PAND_GEOUR      INGAAARMVAPKDLVIIASFVNMNNEEALKHEPKLVFVDDQNRMLPARKEVA--------------
PAND_LEPIN      LNGAAARLGMKGDKIIIITYAQVEEQEASDYTPKVVHVDEKNR-----------------------
PAND_LEPIC      LNGAAARLGMKGDKIIIITYAQVEEKEASDYTPKVVHVDEKNR-----------------------
PAND_LACPL      LNGATARCASVGDKVIIMNYAQFEPEEAKHAKPYVVLVDDENRL----------------------
PAND_CLOB6      LNGAAARMVQKGDKIIIMSYCDLTIDEANKFNPTVLFVDNKNNIEKLTN-----------------
PAND_CARHZ      LNGAAARLCQIGDKVIIIAYALMEEKEAKQWQPKVVFVDEYNKIVKI-------------------
PAND1_GLOVI     LNGAAARLAAPGDRVIVLAYGQGTTEELENHQPRVVHVDTGNRIVA--------------------
PAND_SORC5      INGAAAHLNQPGDLVIIATFADMDDAEARRHTPRVLRVDGRNRPLA--------------------
PAND_OCEIH      LNGAAARLVQPGDTVIIIAYALLSQEELQSFHPKVAIMDESNRV----------------------
PAND_CLOBM      LNGAAARMVQKGDKIIIMSYCSLTIDEANKFNPTVLFVDNKNNIEKLTN-----------------
PAND_CLOBL      LNGAAARMVQKGDKIIIMSYCSLTIDEANKFNPTVLFVDNKNNIEKLTN-----------------
PAND_CLOBK      LNGAAARMVQKGDKIIIMSYCSLTIDEANKFNPTVLFVDNKNNIEKLTN-----------------
PAND_CLOBA      LNGAAARLVQPGDXXXXXXXXXXXXXXXKTYKPKVVFVNDDNTIKEITN-----------------
PAND_LEGPL      VNGAAAHLVTPGDLVIIASFTQILEEDCAAHEPTVVFVDQFNRL----------------------
PAND_LEPBL      LNGAAARLGMKGDKIIVITYAQVEENELPIYIPKVVHVDENNR-----------------------
PAND_LEPBJ      LNGAAARLGMKGDKIIVITYAQVEENELPIYIPKVVHVDENNR-----------------------
PAND_EXISA      LNGAAARHFQVGDVVIIMAYGQMTAEEAKTHRPKVAVLNEQNEV----------------------
PAND_ANOFW      LNGAAARLVQKDDIIIVISYVLVPEEKLTSHRPKIAIMDEHNRIKEL-------------------
PAND_FRASN      XXXXXXRLVHPGDLVIIISYGIMDDAEARRHVPKVLFVDAENRIVGQGGDPAAALPG---------
PAND_THISH      VNGAAAHKANPGDRVIICAYGQLPREEAARFHPRLVYLDADNRIVRTGSDI---------------
PAND_CLONN      LNGAAARCVQVGDKVIIMCYCSMDEQEAKDYKPIVVFANEDNTINKISN-----------------
PAND_SALRD      LNGPAARLAAPGDEVIVIAYAELTPSEAREHHPRVVHVDENNDV----------------------
PAND_PARD8      LNGAAARKAQPGDIIIVMSYAMMDFEEAKTFKPSVVFPDATNKLI---------------------
PAND_LEGPH      VNGAAAHLVTPGDLVIIASFTQILEEDCAAHEPTVVFVDQFNRL----------------------
PAND_LEGPA      VNGAAAHLVTPGDLVIIASFTQILEEDCAAHEPTVVFVDQFNRL----------------------
PAND_DEHSC      LNGAAARMGMKGDKIIILGYSLITEEDTLIHQPNLVYVDALNRITKVKNGVA--------------
PAND_CLOB1      LNGAAARMVQKGDKIIIMSYCSLTIDEANKFNPTVLFVDNKNNIEKLTN-----------------
PAND_BACHD      LNGAAARLVQEGDVIIVISYALVAEENVKEHQPKVAVLNESNQIVEM-------------------
PAND_SYNAS      LNGAAARKVAKGDLVIIASYVIVDGEEAKGWKPTCVFVDPENQI----------------------
PAND_STAES      LNGAASRLVEVGDVIIIMTYAQLNEDEMVDHSPKV-------------------------------
PAND_STAEQ      LNGAASRLVEVGDVIIIMTYAQLNEDEMVDHSPKV-------------------------------
PAND_DEHE1      LNGAAARMGMKGDKVIILGYSLITEEDTLTHQPNLVYVDSLNRITKVKNGVA--------------
PAND_NAUPA      LNGAAARKVHPGDKIIIIAYANMTPEEAKNFKPAVLIVDDNNDII---------------------
PAND_EXIS2      LNGAAARHFQIGDEVIIMAYAQLTNEEIATHVPKVAVLDQENSI----------------------
PAND_BACTN      LNGAAARKVQPDDIVIIMSYALMDFEEAKSFKPTVIFPDATNSVV---------------------
PAND2_FRASC     XXXXXXRLVQPGDLVIIIAYGLMDDAEARRHVPKVLFVDAANRIIGHGDDPAEPLPG---------
PAND_CAMJR      LNGAAARLAEVGDKVIIMSYADFNEEEAKTFKPKVVFVDENNTATKITN-----------------
PAND_CAMJJ      LNGAAARLAEVGDKVIIMSYADFNEEEAKTFKPKVVFVDENNTATKITN-----------------
PAND_CAMJE      LNGAAARLAEVGDKVIIMSYADFNEEEAKTFKPKVVFVDENNTATKITN-----------------
PAND_CAMJ8      LNGAAARLAEVGDKVIIMSYADFNEEEAKTFKPKVVFVDENNTATKITN-----------------
PAND_CYTH3      LNGPAARKVAVGDIVIVIAYASMDFEEAKKWKPTLIFPDANNRLI---------------------
PAND_BACV8      LNGAAARKVQVGDIVIIMSYAMMDFEEAKSFKPTVVFPDAMNKIV---------------------
PAND_WOLSU      LNGAAARKVAIGDKIIIVAYAQYDRSELSSYKPTVVLVDEKNDIVQIKHEV---------------
PAND_ANASK      INGAAAHLNRPGDMVIXXXXXXXXXXXXRDFKPTVVLVDRQNKIVA--------------------
PAND_ANAD2      INGAAAHLNRPGDMVIXXXXXXXXXXXXRDFKPTVVLVDRQNKIVA--------------------
PAND_ENTS8      VNGAAAHCADVGDILIIASYVTMPDEQARSWQPKVAYFDGDNEM----KRLAKAVP----------
PAND_CAMHC      LNGAAARKVCIGDLVIIVSYAQMSTDEALNFKPKIVHVNSKN------------------------
PAND_ANADE      INGAAAHLNRPGDMVIXXXXXXXXXXXXRDFKPTVVLVDRQNKIVA--------------------
PAND_DEIGD      INGAAAHLVQPGDLVIIAAYGNFSEEEARTLEPRVVLVDAQNRILDL-------------------
PAND_BACFR      LNGAAARKVQPDDIVIIMSYALMDFEEAKSFKPTVIFPDATNSVV---------------------
PAND_BACFN      LNGAAARKVQPDDIVIIMSYALMDFEEAKSFKPTVIFPDATNSVV---------------------
PAND_DESAP      LNGAAARLAVPGDQVIIMAYSWCSESEVREWAPVVVLVDARNRVAKV--LAAEGLP----------
PAND_DEIDV      INGAAAHLMRPGDMVIIAAFGNFTEEEARVLEPKVVLVDARNRLLEL-------------------
PAND_CHLT3      LNGAAARLASIGDEIIIITYAEMEPEEAKDYKPTVVLVDKKNR-----------------------
PAND_CAMJD      LNGATARLAEVGDKVIIMSYADFNEEEAKTFKPKVVFVDENNTATKITN-----------------
PAND_ARCB4      LNGAAARKVEIGDKIIVIAYATFSEAELENYKPTVVLVDDKNNIELITHEL---------------
PAND_THEPX      INGAAARLCQVGDXXXXXSYAIMDDEEAKNYKPKVIFVDENNKPV---------------------
PAND_THEP3      INGAAARLCQVGDXXXXXSYAIMDDEEAKNYKPKVIFVDENNKPV---------------------
PAND_LEPBP      LNGAAARLGMKGDKVIIITYGQVEEKDPNDYQPKVVFVDENNR-----------------------
PAND_LEPBA      LNGAAARLGMKGDKVIIITYGQVEEKDPNDYQPKVVFVDENNR-----------------------
PAND_DEIRA      INGAAAHLMRPGDMVIIAAFGNFSEEEARTLEPKVVLVDAKNRLLEL-------------------
PAND_SYNFM      LNGAAARMGAAGDLIIIATYAQYDEAEIARHQPKVVLLDGDNRPLSQG------------------
PAND_CHRVO      VNGSAARRAAPGDLLIIASFAQYEDAELKGHSPKLVFVDGDNRL----------------------
PAND_CAUCR      VNGAAARLVQKNDLVIVVTYCQMPAEEARNYAPTVVLLDEGNLI----------------------
PAND_CAUCN      VNGAAARLVQKNDLVIVVTYCQMPAEEARNYAPTVVLLDEGNLI----------------------
PAND_BRAJA      LNGAAARLVMPGDKIIIVAYASFDEAEAKKFKPHVVRVDRDNRILA--------------------
PAND_PELCD      INGAAARMVSKGDMVIIASWIDIDADKAAAYEPKLVFVDDKN------------------------
PAND_HERAR      LNGAAARCAHLGDLMIICTYGPMTDEEIATYTPKIVFVDEDNHFAGM-------------------
PAND_HELPY      VNGAAARKVAIGDVVIILAYASMNEDEINAHKPSIVLVDEKNEILEKG------------------
PAND_ENT38      VNGAAAHCASVGDIVIIASFVMMSDEEARRWQPKVAYFEGDNEM----------------------
PAND_CAMFF      LNGAAARKVCIGDIIIIVSYASMKRKKAKNFSPTIVHVNEKNEI----------------------
PAND_HELP2      VNGAAARKVAIGDVVIILAYASMNEDEINAHKPSIVLVDEKNEIL---------------------
PAND_CAUSK      VNGAAARLVQKNDTVIVVTYCQMPAEEARNYAPTVVLLEDGNRI----------------------
PAND_ACAM1      LNGAAARLGTRGDRVIIMTYAQLTSEEIEGFEPRVVLVDQENRVI---------------------
PAND_THIDA      VNGAAAHKANPGDLVIIATYATYNELEMARYAPELVYVDAANAIV---------------------
PAND_HELPJ      VNGAAARKVAIGDVVIILAYASMNEDEINTHKPSIVLVDEKNEILEKG------------------
PAND_SALTY      VNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPKVAYFEGDNEM----------------------
PAND_SALTI      VNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPKVAYFEGDNEM----------------------
PAND_SALSV      VNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPKVAYFEGDNEM----------------------
PAND_SALPK      VNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPKVAYFEGDNEM----------------------
PAND_SALPC      VNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPKVAYFEGDNEM----------------------
PAND_SALPB      VNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPKVAYFEGDNEM----------------------
PAND_SALPA      VNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPKVAYFEGDNEM----------------------
PAND_SALNS      VNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPKVAYFEGDNEM----------------------
PAND_SALHS      VNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPKVAYFEGDNEM----------------------
PAND_SALG2      VNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPKVAYFEGDNEM----------------------
PAND_SALEP      VNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPKVAYFEGDNEM----------------------
PAND_SALDC      VNGAAAHCAEVGDIVIIASFVTMSDEEARTWSPKVAYFEGDNEM----------------------
PAND_SALCH      VNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPKVAYFEGDNEM----------------------
PAND_SALA4      VNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPKVAYFEGDNEM----------------------
PAND_RALPJ      LNGAAARRAHVGDLLIICTYAPMNEEEVASYKPKVVLLGEGNKIKAI-------------------
PAND_HELPH      VNGAAARKVAIGDVVIILAYASMNEDEINAHKPCIVLVDEKNEIL---------------------
PAND_GRAFK      LNGAAARKVAKGDILIIIAYGIMELEEARNFKPSLVFPDEETNLL---------------------
PAND_STRM5      LNGGAARHVQVGDIIIIAAFASMTEQEADSFKPKLVYVDGNNQI----------------------
PAND_PSYWF      LNGAAAYMADLGDIVIICAYAQMDEQEADTHKPKLVYCNEDNTV----KDTANIIP----------
PAND_CITK8      VNGAAAHCAAVGDIVIIASFVTMSDEEARRWQPNVAYFEGDNEM----------------------
PAND_CAMC5      LNGAAARKVCIGDIVIIVAYXXXXXXXXXXXXPTIVHVNAKNEMI---------------------
PAND_SULDN      LNGAAARKVHKGDKIIIVAYATYDEKELQNYKPRVVLVNDNNDI----------------------
PAND_PECCP      VNGAAARLACVGDKLIICSYVQMSDEQARSHNPKVAYFSGDNEL----------------------
PAND_HELPS      VNGAAARKVAIGDVVIILAYASMNEDEINAHKPCIVLVDEKNEIL---------------------
PAND_STRMK      LNGGAARHVQVGDIIIIAAFASMTEQEADSFKPKLVYVDGKNQI----------------------
PAND_SALAR      VNGAAAHCASVGDIVIIASFVTMSDEEARTWHPNVAYFEGDNEM----------------------
PAND_RHOBA      ANGAAAHLIRPGDHVILAAYAMVPEADAATHKPRLIFVDDNNQLSHVGPEIA--------------
PAND_ECOL5      VNGAAAHCASVGDIVIIASFVNMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_BDEBA      LNGAAARHVQKGDLVIICSYCGLSMDEAKKHEPTVVFVNAKNKV----------------------
PAND_SHISS      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_SHIFL      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_SHIF8      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_SHIDS      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_SHIBS      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_SHIB3      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ESCF3      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECOUT      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECOSM      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECOSE      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECOLX      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECOLU      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECOLI      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECOLC      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECOL6      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECOK1      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECOHS      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECODH      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECOBW      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECO8A      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECO81      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECO7I      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECO5E      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECO57      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECO55      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECO45      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECO27      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_ECO24      VNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM----------------------
PAND_CHLCH      LNGAAARCALPGDEIIIMTFAVMEEAEARNYKPMVLIVDRHN------------------------
PAND_PHEZH      VNGAAARLVQKGDKVIVVTYGMLPAEEARNYAPTVVLLDDGNEI----------------------
PAND_METFK      VNGAAARKASPGDLLIIATYASYTEAELAQFKPQLVYVDADNRI----------------------
PAND_FLAPJ      LNGPAARKVHKGDIIIIMSYARMDFEKAKTFKPWLV------------------------------
PAND_RALSO      LNGAAARRAHVGDKLIICTYAPMNEEEVANYKPKIVLLGDGNRI----------------------
PAND_YERE8      VNGAAARCACVGDKLIICSYVQMSDADARLHHPKVAYFEGENQL----------------------
PAND_XYLFM      VNGGAARYVQVGDLVIVAAFAQMSEDEAAVFRPNLVYVDAAN------------------------
PAND_XYLFA      VNGGAARYVQVGDLVIVAAFAQMSEDEAAVFSPNLVYVDAAN------------------------
PAND_SERP5      VNGAAARCACVGDKLIICSYVQMSDADARQHRPKVGYFEGDNHL----------------------
PAND_RALEH      LNGAAARRAHLGDQLIICTYAPMSDEEIAAYKPKVILVNEKNGI----------------------
PAND_ERWT9      VNGAAARCACEGDLLIICSYVQMSDEQAREWQPKVAYFEGDNQM----KRVAKAVP----------
PAND_CUPTR      LNGAAARRAHLGDQLIICTYAPMTDEEIATYKPKVILVNEKNGI----------------------
PAND_MARMS      MNGAAARKVQVGDRVIIAAYGQMNEAEADEFKPKLVYLNKDNSVERTTNTI---------------
PAND_ERWCT      VNGAAARCACVGDKLIICSYVQMSDEQARSHSPKVAYFSGENEL----------------------
PAND_BURVG      LNGSAARRAQLGDLVIIAAFAMVDEAELQAWKPKLVFIDEGNKI----------------------
PAND_BURCJ      LNGSAARRAQLGDLVIIAAFAMVDEAELQAWKPKLVFIDEGNKI----------------------
PAND_ALHEH      MNGAAAHLCSEGDRIIICCYANVDESELDRHEPALVYCDGDNRITHQRNGI---------------
PAND_XANCB      LNGGAARHVQVGDLIIVAAFAGMSEDEAKTFKPNLVYVDAHNAI----------------------
PAND_LARHH      VNGSAARRAAVGDILIIATFARFDEQERLEHRPRLVHVDEQNRIIEL-------------------
PAND_BURCH      LNGSAARRAQLGDLVIIAAFAMVDEAELQAWKPKLVFIDDGNKI----------------------
PAND_BURCC      LNGSAARRAQLGDLVIIAAFAMVDEAELQAWKPKLVFIDDGNKI----------------------
PAND_BURCA      LNGSAARRAQLGDLVIIAAFAMVDEAELQAWKPKLVFIDDGNKI----------------------
PAND_YERPY      VNGAAARCACVGDKLIICSYVQMSDAAARLHHPKVAYFEGENQL----------------------
PAND_YERPS      VNGAAARCACVGDKLIICSYVQMSDAAARLHHPKVAYFEGENQL----------------------
PAND_YERPB      VNGAAARCACVGDKLIICSYVQMSDAAARLHHPKVAYFEGENQL----------------------
PAND_YERP3      VNGAAARCACVGDKLIICSYVQMSDAAARLHHPKVAYFEGENQL----------------------
PAND_XANCP      LNGGAARHVQVGDLIIVAAFASMSEDQAKTFKPNLVYVDAHNAI----------------------
PAND_XANC8      LNGGAARHVQVGDLIIVAAFASMSEDQAKTFKPNLVYVDAHNAI----------------------
PAND_DECAR      VNGSAARRAAPGDILIIATFAVYNEVELAKHEPDLIYVDTQNRIVRRGHKI---------------
PAND_STACT      LNGAASRLVEVDDVVIIMTYAQLNETEIADHAPKVAVMNEKNEIVEM-------------------
PAND_BORA1      LNGAAARRAQVGDLMIICTYGPMSEEESATHKPKVVLVDDANRV----------------------
PAND_ALCBS      VNGAAAHKAQPGDRVIICAYANYTSAELINFKPSLIYMAEGNEVKGTSN-----------------
PAND_XYLFT      VNGGAARYVQVGDLVIVAAFAQMSEDEAAVFRPNLVYVNAAN------------------------
PAND_STAHJ      LNGAASRLVEVDDVVIIMTYVQLDERELVDHAPKVAVMNEKNEIIQM-------------------
PAND_SACD2      MNGAAARKVQVGDRVIIAAYSQMSEAEADSFKPRLVYLDKDNAVERTTNTI---------------
PAND_PROMH      VNGXXXXXXXVGDRLIICSYVQIPDSDARSHKPNIAYFEGDNEM----KRIAKAVP----------
PAND_HALHL      MNGAAAHKCNEGDRVIICAYAGVPESELGEFQPRLAYLDADNRI----------------------
PAND_CAMC1      LNGAAARKVCVGDVVIIVAYASMXXXXXXXXXPTIVHVNNKNEII---------------------
PAND_LEPCP      LNGSAARRASAGDLVIIAAFAQVHEEQVPTHQPKLVFMDEANRIKELRSE----------------
PAND_HELAH      VNGAAARKVAIGDVVIILAYASMNEDEMNVHKPCIVLVNEKNEIL---------------------
PAND_XANOR      LNGGAARHVQVGDLIIVAAFASMSEDEAKTFKPNLVYVNARNAI----------------------
PAND_XANOM      LNGGAARHVQVGDLIIVAAFASMSEDEAKTFKPNLVYVNARNAI----------------------
PAND_DELAS      VNGSAARRAAVGDLLIIASFAQVHETDVATHQPQLVFVDDANRQVEL-------------------
PAND_BURA4      LNGSAARRAQLGDLVIIAAFAMVDEAELQAWKPKLVFIDEGNKI----------------------
PAND_BORPE      LNGAAARRAQVGDLLIICTYGPMSEEQSAAHKPQVVLVDDANRV----------------------
PAND_AQUAE      LNGAAARLGHKGDLIIIASYAQYTEEELENYAPKLIFVNEKNQPV---------------------
PAND2_POLSJ     VNGSAARRAAAGDLIIIAAFAQVHNDQVSAHEPQLVFVDDKNR-----------------------
PAND_XANC5      LNGGAARHVQVGDLIIVAAFASMSEDEAKTFKPNLVYVNAHNAI----------------------
PAND_BURCM      LNGSAARRAQLGDLVIIAAFAMVDEAELQAWKPKLVFIDEGNKI----------------------
PAND_XANAC      LNGGAARHVQVGDLIIVAAFASMSEDEAKTFKPNLVYVNAHNAI----------------------
PAND_TERTT      MNGAAARKVQVGDRIIIAAYAGMEEAEADRHKPKLVYLNSDNSVNRTSNTI---------------
PAND_CYAP8      VRGAAARLAEVGDIVIIFTYIEIEEPIPVPWHPRVVMVNEKNQI----------------------
PAND_BURS3      LNGSAARRAQLGDLVIIAAFAMVDEAELQAWKPKLVFMDDGNKI----------------------
PAND_BURP6      LNGSAARRAQLGDLVIIAAFAMIDEQELKAWKPDLVFVDEDNKI----------------------
PAND_BURM1      LNGSAARRAQLGDLVIIAAFAMVEEAELQAWKPKLVFIDEGNKI----------------------
PAND_ACIBT      VNGGAAHQADVGDLVIIATFGDFTEAEANAHKPRLVYANPDNTV----NHTANCIP----------
PAND_ACIBS      VNGGAAHQADVGDLVIIATFGDFTEAEANAHKPRLVYANPDNTV----NHTANCIP----------
PAND_ACIBC      VNGGAAHQADVGDLVIIATFGDFTEAEANAHKPRLVYANPDNTV----NHTANCIP----------
PAND_POLNA      VNGSAARRAAVGDLVIIAAFAQVEEKEVAGFSPKLVFVNPDNRI----------------------
PAND_METCA      VNGAAARLAAVGDIVIICAYVGLNQAELAAYRPNLVYVDENNQI----------------------
PAND_EDWI9      VNGAAARCACVGDTLIICSYVQIPDEQARTHHPRVVYFEGANQMKRLAKSV---------------
PAND_CHLPB      LNGAAARCALPGDEIIIMTFAEIEAREAKSFKPMILIVDKHN------------------------
PAND_BURXL      LNGSAARRAQLGDLVIIAAFAVVDEAELKAWKPDLVFVDDNNRI----------------------
PAND_BURPS      LNGSAARRAQLGDLVIIAAFAMIDEQELKAWKPDLVFVDEDNKI----------------------
PAND_BURP1      LNGSAARRAQLGDLVIIAAFAMIDEQELKAWKPDLVFVDEDNKI----------------------
PAND_BURP0      LNGSAARRAQLGDLVIIAAFAMIDEQELKAWKPDLVFVDEDNKI----------------------
PAND_BURMS      LNGSAARRAQLGDLVIIAAFAMIDEQELKAWKPDLVFVDEDNKI----------------------
PAND_BURMA      LNGSAARRAQLGDLVIIAAFAMIDEQELKAWKPDLVFVDEDNKI----------------------
PAND_BURM9      LNGSAARRAQLGDLVIIAAFAMIDEQELKAWKPDLVFVDEDNKI----------------------
PAND_BURM7      LNGSAARRAQLGDLVIIAAFAMIDEQELKAWKPDLVFVDEDNKI----------------------
PAND_BORPA      LNGAAARRAQVGDLLIICTYGPMSEEQSATHKPQVVLVDDANRV----------------------
PAND_BORBR      LNGAAARRAQVGDLLIICTYGPMSEEQSATHKPQVVLVDDANRV----------------------
PAND_YERPP      VNGAAARCACVGDKLIICSYVQMSYAAARLHHPKVAYFEGENQL----------------------
PAND_YERPN      VNGAAARCACVGDKLIICSYVQMSYAAARLHHPKVAYFEGENQL----------------------
PAND_YERPG      VNGAAARCACVGDKLIICSYVQMSYAAARLHHPKVAYFEGENQL----------------------
PAND_YERPE      VNGAAARCACVGDKLIICSYVQMSYAAARLHHPKVAYFEGENQL----------------------
PAND_YERPA      VNGAAARCACVGDKLIICSYVQMSYAAARLHHPKVAYFEGENQL----------------------
PAND_DESPS      LNGAAARKGMIGDFLIIVTYALCSDDEVDEHRPNVVLLNPDNTI----------------------
PAND1_POLSJ     VNGSAARRAAVGDLVIIAAFAQVHEEYVAGFRPKLVFVDPDNRI----------------------
PAND_PERMH      LNGAAARLGHAGDIIIIVSWADLDEEELKNFKVNLVYMDEENNI----------------------
PAND_METPP      LNGAAARKAHVGDLLIICTYAPMNDAEVATHKPKVVLLGPGNRI----------------------
PAND_HYDS0      LNGAAARLCMPGDIIIIASYAEVEEEELHHFRPYLVYVDDKNNILEVKRDM---------------
PAND_SODGM      VNGAAARCACVGDLLIICAYVQMPDEEARHHAPRVAYFDQHNQL----QRTAKALP----------
PAND_CELJU      MNGAAARKVAVGDRVIIATYGHFTEAELLNHKPKLVYLNENNGVERTSN-----------------
PAND_BURPP      LNGSAARRAQLGDLVIIAAFAVVDEAELKAWKPDLVFVDDNNKI----------------------
PAND_ACIBY      VNGGAAHQADVGDLVIIATFGDFTEAEANVHKPRLVYANPDNTV----NHTANCIP----------
PAND_ACIB5      VNGGAAHQADVGDLVIIATFGDFTEAEANVHKPRLVYANPDNTV----NHTANCIP----------
PAND_ACIB3      VNGGAAHQADVGDLVIIATFGDFTEAEANVHKPRLVYANPDNTV----NHTANCIP----------
PAND_THICR      VNGAAAHKAAPGDLLIIATYASMDEKEAEEFKPIMVYFDEKNQITHTRNTIPKQM-----------
PAND_BACCN      LNGAAARLVQPGDKVIIICYGLVSAEEVYKQIPKIAVLDDRNQIIEM-------------------
PAND2_GLOVI     XXXXXXXXXXXXDQVIVLAYGQGTAVELEHHQPQVVYVDAQNRIVSVHRSVEHA------------
PAND_CHLL2      LNGAAARCALPGDEIIIMTFAVMDEKEAGSHKPMVLIVDRNN------------------------
PAND_BURTA      LNGSAARRAQLGDLVIIAAFAMIDEEELKAWKPDLVFVDEGNKI----------------------
PAND_ACIAD      VNGGAAHQAEVGDLVIIATFGDFTEVEANAHKPRLVYANPDNTV----NHTANCIP----------
PAND_PROVI      LNGAAARCALPGDEIIIMTFCEIEAEEAPDFKPMVLIVDKNN------------------------
PAND_KOSOT      LNGAAARLAEIGDRVIIISYAIYNDDEYK--PPKIVKVTEKN------------------------
PAND_TOLAT      LNGAAARKAAVGDRIIICAYGPMTEDEVAQHKPRLVYLDAQNNIVRTSKDI---------------
PAND_PROA2      LNGAAARCALPGDEIIIMTFAEIEAEKAKDFKPMILIVDHQN------------------------
PAND_HELHP      LNGAAARKVQIGDXXXXXXXXXXXHNELEHYKPTIVQVNESNQILSITNEV---------------
PAND_PELPB      LNGAAARCALVGDEIIIMTFALMDEAEARNYKPMVLIVDKEN------------------------
PAND_CHLTE      LNGAAARCALPGDEIIIMTFAEMEPEEARNWKPMIVIVDRMN------------------------
PAND_POLSQ      LNGAAARKAHVGDHLIICTYGSVPDAEVNNHVPKIVLVGDNNSI----------------------
PAND_CHLP8      LNGAAARCALPGDEIIIMAFAEMEPEEARNWQPMIVIVDRMN------------------------
PAND_BURP8      LNGSAARRAQLGDLVIIAAFANVDEEELKAWKPDLVFVDDKNAI----------------------
PAND_CYAA5      PNGGAALLCQPGDLLIIYAYENCDRQEVRGHTARVIVADEDNKI----------------------
PAND_SULSY      LNGAAARLGHYGDIIIIASYAAVNEKDLESFKVNLVYIDENTNTI---------------------
PAND_PELLD      LNGAAARCALPGDEIIIMTFCEIDAEESREFKPMVLIVDRNN------------------------
PAND_CYAP7      PNGGAALLCQPGDLLIIYAYEERDRSEVQGHHARVIVADENNQI----------------------
PAND_ANAVT      LNGAAARLGIIGDRVIIMTYGQFTSEELKSYTPTVVIVDEKNR-----------------------
PAND_ANASP      LNGAAARLGIIGDRVIIMTYGQFTSEELKSYTPTVVIVDEKNR-----------------------
PAND_CHRSD      INGAAAHQAQVGDRVIICSYAHYAEHELATHQPALVYLQDGNQI----------------------
PAND_NOSP7      LNGGAARLGIIGDRLIIMTYGQFTPEELKNYSPTVVIVDEKNRLL---------------------
PAND_CHLPD      LNGAAARCALPGDEIIIMTFAVMDEKKARTFQPMVLIVD---------------------------
PAND_RHOFD      VNGSAARRAAVGDLIIIAAFAQVPEAQLDGFKPQLVFVDANNRV----------------------
PAND_PHOLL      VNGXXXXXXXVGDKLIICSYVQIPNEDARHHKPNIAYFDGDN----IMRRIAKAVP----------
PAND_NITOC      VNGAAAHKACPGDRLIICTYAVFERSEMDSFKPLLIYLDDRNFITHTGN-----------------
PAND_FRATN      LNGPAARRCEIGDQLFIISYAQ-VDPTRENIKPKLV------------------------------
PAND_THELT      LNGAAARLVEKGDRIIVMSFGIFNDGEYSG--PKVAILNEKNQVIHL-------------------
PAND_PSYCK      LNGAAAHMADLGDIVIICAYAHFDEVEASTYQPRLVYCNEDNTV----KDTANIIP----------
PAND_PSYA2      LNGAAAHMADLGDIVIICAYAHFDEVEASTYQPRLVYCNEDNTV----KDTANIIP----------
PAND_HYPNA      VNGAAARHFAVGDTVIIAAFCGVEAEKARQHAPTVVLLGEGNEI----------------------
PAND_MICAN      PNGGAALLCQPGDILIIYAYEQRPRQEVKGHFAKVLVADAENR-----------------------
PAND_FRATW      LNGPAARRCEIGDQLFIISYTQ-VDPTRENIKPKLV------------------------------
PAND_FRATT      LNGPAARRCEIGDQLFIISYTQ-VDPTRENIKPKLV------------------------------
PAND_FRATO      LNGPAARRCEIGDQLFIISYAQ-VDPTRENIKPKLV------------------------------
PAND_FRATH      LNGPAARRCEIGDQLFIISYAQ-VDPTRENIKPKLV------------------------------
PAND_FRAT1      LNGPAARRCEIGDQLFIISYTQ-VDPTRENIKPKLV------------------------------
PAND_MARMM      INGAAARLAQVGDRIIVVXXXXXXXXXXXQHDPVVVLLDEHNKVIA--------------------
PAND_PSYIN      VNGAAARLAAVGDRVIICTYASLNAAEIVNHKPSLVYLDAQNNIVRTSKDV---------------
PAND_XANP2      LNGAAARTCQPGDEVIICNSVYVPEGEIVALRPRVLTFDKDNRVTS--------------------
PAND_RUTMC      VNGAAAHKVNVGDMLIIAAYGVYSEKELESYTPRLCYVNDQNILTKISS-----------------
PAND2_RHILO     LNGAAARTCQPGDQIIVCNSIYLDEAHITSLKPRIVTFDQDNNIL---------------------
PAND_PSEAE      VNGAAAHKAKVGDRVIICAYAHYSEAELASHKPRMLYMAPGNQL----SHTSEAIP----------
PAND_HALWD      LNGAAARLAETGDVIIVISYLYVKDEQP---EPTVLLLDEENRI----------------------
PAND_DIAST      VNGSAARRACVGDLLIIXXXXXXXXXXXXXHQPQLVFVNDQNRQVEL-------------------
PAND_ACISJ      VNGSAARRACVGDLLIIXXXXXXXXXXXXXHQPQLVFVNDQNRQVEL-------------------
PAND_PSEAB      VNGAAAHKAKVGDRVIICAYAHYSEAELASHKPRMLYMAPGNQL----SHTSEAIP----------
PAND_PSEA8      VNGAAAHKAKVGDRVIICAYAHYSEAELASHKPRMLYMAPGNQL----SHTSEAIP----------
PAND_PSEFL      VNGAAAHKAKVGDRVIICAYAHYSEAELVNFKPRMLYMAPGNELSRASN-----------------
PAND_METNO      LNGAAARTCQPGDQIIICNSIYIRESELPDIRPRVLTFDSDNRVL---------------------
PAND_PSEA7      VNGAAAHKAKVGDRVIICAYAHYGEAELASHKPRMLYMAPGNQL----SHTSEAIP----------
PAND_TRIEI      PNGGAALLCKKDDILIIWANEQCDRAEVNGHKAKIFVADENN------------------------
PAND_THEAB      INGAAARLVEQGDRVIIMAFGMYDSNEYKG--PKVIIMNEKNEIVEI-------------------
PAND_FERNB      LNGAAARLVEKGDKIIIMAFGLYSKDEYKS--PKILIMNSDNTV----------------------
PAND1_RHILO     LNGAAARTCQPDDPIIVCNSIYLDEAHITSLKPRIVTFDQDNHIL---------------------
PAND_PSEU5      VNGAAAHKAGVGHRLIICAYAHYSEAELANFKPHVLYMGADGELSHTSN-----------------
PAND_THESQ      LNGAAARLAEEGDRVIIMAFLSETPVKSK-------------------------------------
PAND_AZOVD      VNGAAAHKAQKGDRVIICAYAHYSEAELATHKPRMLYMAPGN------------------------
PAND_SYNY3      PNGGAALLCQPGDRLIIFAYELCDRREVKGHQAKVLVTNESNETV---------------------
PAND_METSB      LNGAAARTCQPGDELIICSSVYLDGAEITNLSPAVLTFDANNNIV---------------------
PAND_THEM4      VNGAAARLVEQGDRVIIMAFGMYENDEYKG--PRVLIMNEDNEVVEI-------------------
PAND_COPPD      LNGAAARSAVVGDRVIVMAFMKEPDEEV---DTTVLIMDEENNI----------------------
PAND_RHOCS      LNGAAARTCQRGDVIIIAASEYTTPDRLYTLKPRILTFTAGNRV----------------------
PAND_BEII9      LNGAAARTCQVGDEIIICSSHYIEAERIADFQPKILTFDKGNHIV---------------------
PAND_COXBU      LNGPAARKGEIGDQLFILSY----------------------------------------------
PAND_VESOH      VNGAAARKVNVGDVLIIXXXXXXXXXXXXXXXPRLCYVNNKN------------------------
PAND_PYRIL      LNGAAARLGEVGDVIIVAAY----------------------------------------------
PAND_DESDA      LNGAAARTCQKGDEVIISAFYVAGPGDISQRSPVVLTFDAHNRV----------------------
PAND_THEMA      LYGAAARLGEEGDRVIIMAF-TFSDKPVKA---KTIVLNEKNEIV---------------------
PAND_THEP1      LYGAAARLGEEGDRVIIMAF-TFSDKPVKA---KTIVLNEKNEII---------------------
PAND_AGRT5      LNGAAARTCQRGDQVIISSYVEET------------------------------------------
PAND_MAGSA      LNGAAARTCQKGDELIIAASADISGPE-KLYDPRILTFLPDNHV----------------------
LPTD_PSYCK      VNGA--------------------------------------------------------------