[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF53239.1

[Show Plain Result]


## Summary of Sequence Search
    1::134
  182::285     1e-04  31%  400 aa  SSTT_ACIBT RecName: Full=Serine/threonine transporter sstT;AltName:
  182::285     1e-04  31%  400 aa  SSTT_ACIBS RecName: Full=Serine/threonine transporter sstT;AltName:
  182::285     1e-04  31%  400 aa  SSTT_ACIBC RecName: Full=Serine/threonine transporter sstT;AltName:
  147::254     2e-04  25%  285 aa  Y212_LISIN RecName: Full=Putative sugar uptake protein lin0212;
  153::254     2e-04  25%  285 aa  Y169_LISMO RecName: Full=Putative sugar uptake protein lmo0169;
  182::285     2e-04  31%  400 aa  SSTT_ACIBY RecName: Full=Serine/threonine transporter sstT;AltName:
  182::285     2e-04  31%  400 aa  SSTT_ACIB5 RecName: Full=Serine/threonine transporter sstT;AltName:
  182::285     2e-04  31%  400 aa  SSTT_ACIB3 RecName: Full=Serine/threonine transporter sstT;AltName:
  318::396     3e-04  30%  485 aa  YJDL_ECOLI RecName: Full=Inner membrane transporter yjdL;
  190::257     5e-04  27%  282 aa  LGT_BRAJA RecName: Full=Prolipoprotein diacylglyceryl transferase; 
    4::84      6e-04  31%  317 aa  AA3R_SHEEP RecName: Full=Adenosine A3 receptor;
    1::134

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKTFNPTMIAGLIGVLYFVLLTLIFSIQDMELAAEIAFGIVTIVGLIAVWDNFRDRNNSTWKTWTGLVGG
SSTT_ACIBT      -----------------------------------IAFAPVGIFGLVAV--TFADAGLATLESYAQLLAV
SSTT_ACIBS      -----------------------------------IAFAPVGIFGLVAV--TFADAGLATLESYAQLLAV
SSTT_ACIBC      -----------------------------------IAFAPVGIFGLVAV--TFADAGLATLESYAQLLAV
Y212_LISIN      MKKGIVTLLISSVGYVGYVVITRWFDISGWDAILPQAIGMV-VAGLL--FSIKSEEKRFTKQTWLNMIPG
Y169_LISMO      ------TLLISSVGYVGYVVITRWFDISGWDAILPQAIGMV-VAGLL--FSIKSEEKRFTKQTWLNMIPG
SSTT_ACIBY      -----------------------------------IAFAPVGIFGLVAV--TFADAGLATLESYAQLLVV
SSTT_ACIB5      -----------------------------------IAFAPVGIFGLVAV--TFADAGLATLESYAQLLVV
SSTT_ACIB3      -----------------------------------IAFAPVGIFGLVAV--TFADAGLATLESYAQLLVV
YJDL_ECOLI      ----------------------------------------VMLAGVVLAWASPESRGNSTLRVWLKFAFG
LGT_BRAJA       ---------AGMEGILLFTVLAIMIRLGALKRPGMILGAFILIYGLTRIGEHFREPDVQLGFLWGGLTMG
AA3R_SHEEP      ---------------------------------------------------------NSTAVSWTSVTYI


                         .         .         *         .         .         .         .:140
query           LLIAVPGICLLVGNLVLLAVDGNPSTMVNTLLSVAGIGAIFLLPIGIIMCLIAGFNRFYAALKV
SSTT_ACIBT      LLGTMLFVALVINPILVLTIRGNPYPLVFKCLKESGITAFFTIPVNLDLAERLGVNPSTASVSI
SSTT_ACIBS      LLGTMLFVALVINPILVLTIRGNPYPLVFKCLKESGITAFFTIPVNLDLAERLGVNPSTASVSI
SSTT_ACIBC      LLGTMLFVALVINPILVLTIRGNPYPLVFKCLKESGITAFFTIPVNLDLAERLGVNPSTASVSI
Y212_LISIN      VMWATGNLALLFSNKLVGIATGFSLSQMGVVISTIG-GILFL----------------------
Y169_LISMO      VMWATGNLALLFSNKLVGIATGFSLSQMGVVISTIG-GILFL----------------------
SSTT_ACIBY      LLGTMLFVALVINPILVLTIRGNPYPLVFKCLKESGITAFFTIPVNLDLAERLGVNPSTASVSI
SSTT_ACIB5      LLGTMLFVALVINPILVLTIRGNPYPLVFKCLKESGITAFFTIPVNLDLAERLGVNPSTASVSI
SSTT_ACIB3      LLGTMLFVALVINPILVLTIRGNPYPLVFKCLKESGITAFFTIPVNLDLAERLGVNPSTASVSI
YJDL_ECOLI      LLLMACGFMLLAFDARHAAADGQASMVMISGLALMGFAELFIDPVAI-----------------
LGT_BRAJA       MLLSIP----------------------------------------------------------
AA3R_SHEEP      TVEILIGLCAIVGNLVIWVVKLNPSLQTTTFYFIVSLAGVLVMPLAIVISLGVTIH-FYSCL--