[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF53422.1

[Show Plain Result]


## Summary of Sequence Search
    1::100
   12::101     2e-20  49%  101 aa  CSOR_BACSU RecName: Full=Copper-sensing transcriptional repressor
    8::86      2e-10  38%  119 aa  CSOR_MYCTU RecName: Full=Copper-sensing transcriptional repressor
    8::86      2e-10  38%  119 aa  CSOR_MYCTF RecName: Full=Copper-sensing transcriptional repressor
    8::86      2e-10  38%  119 aa  CSOR_MYCBP RecName: Full=Copper-sensing transcriptional repressor
    8::86      2e-10  38%  119 aa  CSOR_MYCBO RecName: Full=Copper-sensing transcriptional repressor
    2::86      3e-10  35%  117 aa  CSOR_MYCUA RecName: Full=Copper-sensing transcriptional repressor
    5::89      3e-08  37%   90 aa  RCNR_SALTY RecName: Full=Transcriptional repressor rcnR;
    5::89      3e-08  37%   90 aa  RCNR_SALTI RecName: Full=Transcriptional repressor rcnR homolog;
    5::89      3e-08  37%   90 aa  RCNR_SALPB RecName: Full=Transcriptional repressor rcnR;
    5::89      3e-08  37%   90 aa  RCNR_SALPA RecName: Full=Transcriptional repressor rcnR;
    5::89      4e-08  34%   90 aa  RCNR_SHISS RecName: Full=Transcriptional repressor rcnR;
    5::89      4e-08  34%   90 aa  RCNR_SHIFL RecName: Full=Transcriptional repressor rcnR homolog;
    5::89      4e-08  34%   90 aa  RCNR_SHIF8 RecName: Full=Transcriptional repressor rcnR;
    5::89      4e-08  34%   90 aa  RCNR_SHIDS RecName: Full=Transcriptional repressor rcnR;
    5::89      4e-08  37%   90 aa  RCNR_SALAR RecName: Full=Transcriptional repressor rcnR;
    5::89      4e-08  34%   90 aa  RCNR_ECOUT RecName: Full=Transcriptional repressor rcnR;
    5::89      4e-08  34%   90 aa  RCNR_ECOLI RecName: Full=Transcriptional repressor rcnR;
    5::89      4e-08  34%   90 aa  RCNR_ECOL6 RecName: Full=Transcriptional repressor rcnR;
    5::89      4e-08  34%   90 aa  RCNR_ECOL5 RecName: Full=Transcriptional repressor rcnR;
    5::89      4e-08  34%   90 aa  RCNR_ECOK1 RecName: Full=Transcriptional repressor rcnR;
    5::89      4e-08  34%   90 aa  RCNR_ECOHS RecName: Full=Transcriptional repressor rcnR;
    5::89      4e-08  34%   90 aa  RCNR_ECO57 RecName: Full=Transcriptional repressor rcnR;
    5::89      4e-08  34%   90 aa  RCNR_ECO24 RecName: Full=Transcriptional repressor rcnR homolog;
    5::89      9e-08  36%   90 aa  RCNR_SALCH RecName: Full=Transcriptional repressor rcnR homolog;
    5::89      9e-08  36%   90 aa  RCNR_CITK8 RecName: Full=Transcriptional repressor rcnR;
    3::91      6e-07  27%   91 aa  YBIOA_SERMA RecName: Full=Uncharacterized protein in bioA
    6::79      1e-06  34%   91 aa  FRMR_SHISS RecName: Full=Transcriptional repressor frmR;
    6::79      1e-06  34%   91 aa  FRMR_ECOUT RecName: Full=Transcriptional repressor frmR;
    6::79      1e-06  34%   91 aa  FRMR_ECOSM RecName: Full=Transcriptional repressor frmR;
    6::79      1e-06  34%   91 aa  FRMR_ECOLI RecName: Full=Transcriptional repressor frmR;
    6::79      1e-06  34%   91 aa  FRMR_ECOLC RecName: Full=Transcriptional repressor frmR;
    6::79      1e-06  34%   91 aa  FRMR_ECOL6 RecName: Full=Transcriptional repressor frmR;
    6::79      1e-06  34%   91 aa  FRMR_ECOL5 RecName: Full=Transcriptional repressor frmR;
    6::79      1e-06  34%   91 aa  FRMR_ECOK1 RecName: Full=Transcriptional repressor frmR;
    6::79      1e-06  34%   91 aa  FRMR_ECOHS RecName: Full=Transcriptional repressor frmR;
    6::79      1e-06  34%   91 aa  FRMR_ECO57 RecName: Full=Transcriptional repressor frmR;
    6::79      1e-06  34%   91 aa  FRMR_ECO24 RecName: Full=Transcriptional repressor frmR;
    1::61      4e-04  26%   63 aa  YRKD_BACSU RecName: Full=Uncharacterized protein yrkD;
   45::130     6e-04  35%  562 aa  AL4A1_MOUSE RecName: Full=Delta-1-pyrroline-5-carboxylate
    1::100

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxHTHGYIEEKQRYLARLKRIEGQTRGIHRMIDEEQYCIDILTQISAVNSALKNVAFGLLDDHLAH
CSOR_BACSU      --------HKSSKEKDQITNRLKRIEGQVRGIQNMVENDRYCVDILVQISAVQAAMKNVALHLLEDHAHH
CSOR_MYCTU      -------------KKRAALNRLKTVRGHLDGIVRMLESDAYCVDVMKQISAVQSSLERANRVMLHNHLET
CSOR_MYCTF      -------------KKRAALNRLKTVRGHLDGIVRMLESDAYCVDVMKQISAVQSSLERANRVMLHNHLET
CSOR_MYCBP      -------------KKRAALNRLKTVRGHLDGIVRMLESDAYCVDVMKQISAVQSSLERANRVMLHNHLET
CSOR_MYCBO      -------------KKRAALNRLKTVRGHLDGIVRMLESDAYCVDVMKQISAVQSSLERANRVMLHNHLET
CSOR_MYCUA      -------SHELTDKKRAALNRLKTARGHLDGIIRMLESDAYCVDVMKQLSAVQSSLERANRVMLHNHLET
RCNR_SALTY      -----------IRDKQKLKARTSKIQGQVIALKKMLDEPHECAAVLQQIAAVNGLMREVIKGHLTEHIVH
RCNR_SALTI      -----------IRDKQKLKARTSKIQGQVIALKKMLDEPHECAAVLQQIAAVNGLMREVIKGHLTEHIVH
RCNR_SALPB      -----------IRDKQKLKARTSKIQGQVIALKKMLDEPHECAAVLQQIAAVNGLMREVIKGHLTEHIVH
RCNR_SALPA      -----------IRDKQKLKARTSKIQGQVIALKKMLDEPHECAAVLQQIAAVNGLMREVIKGHLTEHIVH
RCNR_SHISS      -----------IRDKQKLKARASKIQGQVVALKKMLDEPHECAAVLQQIAAIRGAVNGLMREVIKGHLTH
RCNR_SHIFL      -----------IRDKQKLKARASKIQGQVVALKKMLDEPHECAAVLQQIAAIRGAVNGLMREVIKGHLTH
RCNR_SHIF8      -----------IRDKQKLKARASKIQGQVVALKKMLDEPHECAAVLQQIAAIRGAVNGLMREVIKGHLTH
RCNR_SHIDS      -----------IRDKQKLKARASKIQGQVVALKKMLDEPHECAAVLQQIAAIRGAVNGLMREVIKGHLTH
RCNR_SALAR      -----------IRDKQKLKARTSKIQGQVIALKKMLDEPHECAAVLQQIAAVNGLMREVIKGHLTEHIVH
RCNR_ECOUT      -----------IRDKQKLKARASKIQGQVVALKKMLDEPHECAAVLQQIAAIRGAVNGLMREVIKGHLTH
RCNR_ECOLI      -----------IRDKQKLKARASKIQGQVVALKKMLDEPHECAAVLQQIAAIRGAVNGLMREVIKGHLTH
RCNR_ECOL6      -----------IRDKQKLKARASKIQGQVVALKKMLDEPHECAAVLQQIAAIRGAVNGLMREVIKGHLTH
RCNR_ECOL5      -----------IRDKQKLKARASKIQGQVVALKKMLDEPHECAAVLQQIAAIRGAVNGLMREVIKGHLTH
RCNR_ECOK1      -----------IRDKQKLKARASKIQGQVVALKKMLDEPHECAAVLQQIAAIRGAVNGLMREVIKGHLTH
RCNR_ECOHS      -----------IRDKQKLKARASKIQGQVVALKKMLDEPHECAAVLQQIAAIRGAVNGLMREVIKGHLTH
RCNR_ECO57      -----------IRDKQKLKARASKIQGQVVALKKMLDEPHECAAVLQQIAAIRGAVNGLMREVIKGHLTH
RCNR_ECO24      -----------IRDKQKLKARASKIQGQVVALKKMLDEPHECAAVLQQIAAIRGAVNGLMREVIKGHLTH
RCNR_SALCH      -----------IRDKQKLKARTSKIQGQVIALKKMLDEPHECAAVLQQIAAVNGLMREVIKGHLTEHIVH
RCNR_CITK8      -----------IRDKQKLKARASKIQGQVVALKKMLDEPHECAAVLQQIAAVNGLMREVIKGHLTEHIVH
YBIOA_SERMA     ------HTH---RDQKKLLARVRRIKGQAEALERALESGGECSAVLQQIAAVRGAVNGLMAQVLEGHVRE
FRMR_SHISS      ------------EEKKKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAVRGAANGLMAEVLESHIRE
FRMR_ECOUT      ------------EEKKKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAVRGAANGLMAEVLESHIRE
FRMR_ECOSM      ------------EEKKKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAVRGAANGLMAEVLESHIRE
FRMR_ECOLI      ------------EEKKKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAVRGAANGLMAEVLESHIRE
FRMR_ECOLC      ------------EEKKKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAVRGAANGLMAEVLESHIRE
FRMR_ECOL6      ------------EEKKKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAVRGAANGLMAEVLESHIRE
FRMR_ECOL5      ------------EEKKKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAVRGAANGLMAEVLESHIRE
FRMR_ECOK1      ------------EEKKKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAVRGAANGLMAEVLESHIRE
FRMR_ECOHS      ------------EEKKKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAVRGAANGLMAEVLESHIRE
FRMR_ECO57      ------------EEKKKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAVRGAANGLMAEVLESHIRE
FRMR_ECO24      ------------EEKKKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAVRGAANGLMAEVLESHIRE
YRKD_BACSU      ----------------------------------MMEQGKDCREVVTQLAASRNAIDRAMGLIVSTNLEH
AL4A1_MOUSE     -------------ERDALQKALKDLKGQTEAIPCVVDEEVWTSDIQYQLSPFNHAHKVAKFCYADKALLN


                         .         .         *         .         .         .         .:140
query           CVKEAADLGGDELDAKLKEVSDAIARFSKA
CSOR_BACSU      CVADAIKSGDGE--QAISELLDVFKKFTKS
CSOR_MYCTU      CFSTAVLDGHGQ--AAIEELIDAV------
CSOR_MYCTF      CFSTAVLDGHGQ--AAIEELIDAV------
CSOR_MYCBP      CFSTAVLDGHGQ--AAIEELIDAV------
CSOR_MYCBO      CFSTAVLDGHGQ--AAIEELIDAV------
CSOR_MYCUA      CFSAAVLDGRGQ--AAIDELIDAV------
RCNR_SALTY      QSDEAR--REEDLDVILKVLDSYI------
RCNR_SALTI      QSDEAR--REEDLDVILKVLDSYI------
RCNR_SALPB      QSDEAR--REEDLDVILKVLDSYI------
RCNR_SALPA      QSDEAR--REEDLDVILKVLDSYI------
RCNR_SHISS      IVHQGDELKREELDVVLKVLDSYI------
RCNR_SHIFL      IVHQGDELKREELDVVLKVLDSYI------
RCNR_SHIF8      IVHQGDELKREELDVVLKVLDSYI------
RCNR_SHIDS      IVHQGDELKREELDVVLKVLDSYI------
RCNR_SALAR      QGDEAR--REEDLDVILKVLDSYI------
RCNR_ECOUT      IVHQGDELKREELDVVLKVLDSYI------
RCNR_ECOLI      IVHQGDELKREELDVVLKVLDSYI------
RCNR_ECOL6      IVHQGDELKREELDVVLKVLDSYI------
RCNR_ECOL5      IVHQGDELKREELDVVLKVLDSYI------
RCNR_ECOK1      IVHQGDELKREELDVVLKVLDSYI------
RCNR_ECOHS      IVHQGDELKREELDVVLKVLDSYI------
RCNR_ECO57      IVHQGDELKREELDVVLKVLDSYI------
RCNR_ECO24      IVHQGDELKREELDVVLKVLDSYI------
RCNR_SALCH      QSDEVR--REEDLDVILKVLDSYI------
RCNR_CITK8      QSDEVK--REDDLEVILKVLDSYI------
YBIOA_SERMA     HL-AAADATPQQREQDIEQLMTVLRSYMK-
FRMR_SHISS      TF--------DRNDCYSREVSQSV------
FRMR_ECOUT      TF--------DRNDCYSREVSQSV------
FRMR_ECOSM      TF--------DRNDCYSREVSQSV------
FRMR_ECOLI      TF--------DRNDCYSREVSQSV------
FRMR_ECOLC      TF--------DRNDCYSREVSQSV------
FRMR_ECOL6      TF--------DRNDCYSREVSQSV------
FRMR_ECOL5      TF--------DRNDCYSREVSQSV------
FRMR_ECOK1      TF--------DRNDCYSREVSQSV------
FRMR_ECOHS      TF--------DRNDCYSREVSQSV------
FRMR_ECO57      TF--------DRNDCYSREVSQSV------
FRMR_ECO24      TF--------DRNDCYSREVSQSV------
YRKD_BACSU      CVRESLEKGEDTQNL-VKEAVDLLVK----
AL4A1_MOUSE     RAIDAALAARKEWD--LKPMADRAQVFLKA