[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF53444.1

[Show Plain Result]


## Summary of Sequence Search
    1::302
    8::305     e-113  68%  344 aa  Y507_MYCBO RecName: Full=Uncharacterized protein Mb0507;
    8::305     e-113  68%  344 aa  Y496_MYCTU RecName: Full=Uncharacterized protein Rv0496/MT0516;
    8::305     e-109  65%  339 aa  Y2434_MYCLE RecName: Full=Uncharacterized protein ML2434;
    8::305     1e-83  52%  309 aa  Y3348_STRCO RecName: Full=Uncharacterized protein SCO3348;
    8::307     4e-55  41%  336 aa  Y757_STRCO RecName: Full=Uncharacterized protein SCO0757;
   22::308     1e-22  29%  506 aa  PPX_PSEAE RecName: Full=Exopolyphosphatase;       
   13::296     1e-19  25%  498 aa  GPPA_ERWCT RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   14::297     8e-18  26%  498 aa  GPPA_YERE8 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   14::297     1e-17  25%  498 aa  GPPA_YERPY RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   14::297     1e-17  25%  498 aa  GPPA_YERPS RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   14::297     1e-17  25%  498 aa  GPPA_YERPP RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   14::297     1e-17  25%  498 aa  GPPA_YERPG RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   14::297     1e-17  25%  498 aa  GPPA_YERPE RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   14::297     1e-17  25%  498 aa  GPPA_YERPB RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   14::297     1e-17  25%  498 aa  GPPA_YERP3 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   12::295     1e-17  26%  496 aa  GPPA_AERS4 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::296     4e-17  25%  494 aa  GPPA_ECOLU RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     5e-17  24%  494 aa  GPPA_SHISS RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   22::306     7e-17  25%  323 aa  PPX_HAEIN RecName: Full=Putative exopolyphosphatase;       
   13::305     9e-17  24%  494 aa  GPPA_SHIDS RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     9e-17  24%  494 aa  GPPA_SHIBS RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     9e-17  24%  494 aa  GPPA_SHIB3 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     9e-17  24%  494 aa  GPPA_ESCF3 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     9e-17  24%  494 aa  GPPA_ECOSE RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     9e-17  24%  494 aa  GPPA_ECOLI RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     9e-17  24%  494 aa  GPPA_ECOLC RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     9e-17  24%  494 aa  GPPA_ECOHS RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     9e-17  24%  494 aa  GPPA_ECODH RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     9e-17  24%  494 aa  GPPA_ECOBW RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     9e-17  24%  494 aa  GPPA_ECO8A RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     9e-17  24%  494 aa  GPPA_ECO7I RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     9e-17  24%  494 aa  GPPA_ECO5E RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     9e-17  24%  494 aa  GPPA_ECO57 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     9e-17  24%  494 aa  GPPA_ECO55 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     9e-17  24%  494 aa  GPPA_ECO24 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   15::304     1e-16  24%  497 aa  GPPA_VIBF1 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::296     1e-16  24%  494 aa  GPPA_ECOUT RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::296     1e-16  24%  494 aa  GPPA_ECOSM RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::296     1e-16  24%  494 aa  GPPA_ECOL6 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::296     1e-16  24%  494 aa  GPPA_ECOK1 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::296     1e-16  24%  494 aa  GPPA_ECO81 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::296     1e-16  24%  494 aa  GPPA_ECO45 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::296     1e-16  24%  494 aa  GPPA_ECO27 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   15::304     2e-16  24%  497 aa  GPPA_VIBPA RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   12::295     2e-16  25%  496 aa  GPPA_AERHH RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     4e-16  24%  494 aa  GPPA_SHIFL RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   15::304     6e-16  24%  497 aa  GPPA_VIBHB RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   15::304     6e-16  23%  497 aa  GPPA_VIBFM RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::296     7e-16  24%  498 aa  GPPA_PECCP RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::296     1e-15  23%  502 aa  GPPA_PROMH RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   16::306     1e-15  25%  500 aa  PPX_VIBCH RecName: Full=Exopolyphosphatase;       
   16::303     2e-15  26%  497 aa  GPPA_PSEHT RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     2e-15  23%  494 aa  GPPA_SHIF8 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::296     4e-15  24%  498 aa  GPPA_SERP5 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   15::304     8e-15  22%  497 aa  GPPA_PHOPR RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   12::304     1e-14  24%  499 aa  GPPA_KLEP3 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::296     2e-14  25%  494 aa  GPPA_ENTS8 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   18::302     5e-14  25%  513 aa  PPX_ECOLI RecName: Full=Exopolyphosphatase;       
   18::302     5e-14  25%  513 aa  PPX_ECOL6 RecName: Full=Exopolyphosphatase;       
   18::302     5e-14  25%  513 aa  PPX_ECO57 RecName: Full=Exopolyphosphatase;       
   18::302     7e-14  25%  513 aa  PPX_SALTY RecName: Full=Exopolyphosphatase;       
   18::302     7e-14  25%  513 aa  PPX_SALTI RecName: Full=Exopolyphosphatase;       
   12::304     7e-14  24%  499 aa  GPPA_KLEP7 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::296     1e-13  24%  494 aa  GPPA_CITK8 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::296     2e-13  23%  494 aa  GPPA_ERWT9 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   15::297     3e-13  24%  497 aa  GPPA_VIBVY RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   15::297     3e-13  24%  497 aa  GPPA_VIBVU RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   15::298     3e-13  24%  497 aa  GPPA_VIBCM RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   15::298     3e-13  24%  497 aa  GPPA_VIBCH RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   15::298     3e-13  24%  497 aa  GPPA_VIBC3 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   12::295     1e-12  23%  493 aa  GPPA_SALG2 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   14::306     1e-12  23%  495 aa  GPPA_ENT38 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   12::295     1e-12  23%  493 aa  GPPA_SALTY RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   12::295     1e-12  23%  493 aa  GPPA_SALTI RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   12::295     1e-12  23%  493 aa  GPPA_SALSV RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   12::295     1e-12  23%  493 aa  GPPA_SALPB RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   12::295     1e-12  23%  493 aa  GPPA_SALNS RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   12::295     1e-12  23%  493 aa  GPPA_SALHS RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   12::295     1e-12  23%  493 aa  GPPA_SALEP RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   12::295     1e-12  23%  493 aa  GPPA_SALDC RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   12::295     1e-12  23%  493 aa  GPPA_SALCH RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   12::295     1e-12  23%  493 aa  GPPA_SALA4 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::305     1e-12  23%  500 aa  GPPA_PHOLL RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   12::295     4e-12  23%  493 aa  GPPA_SALPK RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   12::295     4e-12  23%  493 aa  GPPA_SALPA RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   13::296     5e-12  23%  494 aa  GPPA_SALAR RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   15::304     9e-12  23%  497 aa  GPPA_VIBSL RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   12::295     1e-11  23%  493 aa  GPPA_SALPC RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
   21::304     1e-11  24%  503 aa  GPPA_PSEA6 RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
  435::632     1e-10  25%  664 aa  AROB_FUSNN RecName: Full=Bifunctional 3-dehydroquinate
  105::296     5e-06  26%  499 aa  GPPA_SODGM RecName: Full=Guanosine-5'-triphosphate,3'-diphosphate
  104::192     5e-05  37%  588 aa  RTG2_YEAST RecName: Full=Retrograde regulation protein 2;
   66::164     9e-04  32%  397 aa  SUCC_RHOSK RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit
   66::164     9e-04  32%  397 aa  SUCC_RHOS4 RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit
   66::164     9e-04  32%  397 aa  SUCC_RHOS1 RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit
    1::302

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGSNTVHLVAVDARPGGHPTPMSNWRTPLRLVELLDDSGAISEKGINKLTSAVGEAADLAKTLGCAELMP
Y507_MYCBO      VGSNTVHLLVVDAHRGGHPTPMSSTKATLRLAEATDSSGKITKRGADKLISTIDEFAKIAISSGCAELMA
Y496_MYCTU      VGSNTVHLLVVDAHRGGHPTPMSSTKATLRLAEATDSSGKITKRGADKLISTIDEFAKIAISSGCAELMA
Y2434_MYCLE     VGSNTVHLLVVDAYRGGHPTPMSSTKATLRMVEATDSSGKITKRAADKLVSTIGEFAKIAVSSGCAELMA
Y3348_STRCO     VGSNTVHLLVVDAHPGARPLPAHSHKVELRLAQLLDEDGAIGPDGVDQLAAVVREALQAAEDKGVEDLLP
Y757_STRCO      VGSNTVRLMVADAE-GGVPLPVHTAKWRLRLSEQVRPGDPVPEEAVERLVGAVADASRTADRWGASGPLA
PPX_PSEAE       LGSNSFHLCLAKANIHGEVRILERLGEKVQLAAGLDEERNLSEEATQRGLDCLRRFAQFISGMPQGSVRV
GPPA_ERWCT      LGSNSFHMLVTRETAGSIQT-LAKIKRKVRLAAGLDKQNRLSQEAMQRGWQCLQLFSERLQDIPQDQVRV
GPPA_YERE8      LGSNSFHMLVVREVAGSIQT-LARIKRKVRLAAGLDTQNHLSQEAMERGWQCLKLFSERLQDIPLDQIRV
GPPA_YERPY      LGSNSFHMLVVREVAGSIQT-LARIKRKVRLAAGLDNQNHLSQEAMERGWQCLKLFSERLQDIPLDQIRV
GPPA_YERPS      LGSNSFHMLVVREVAGSIQT-LARIKRKVRLAAGLDNQNHLSQEAMERGWQCLKLFSERLQDIPLDQIRV
GPPA_YERPP      LGSNSFHMLVVREVAGSIQT-LARIKRKVRLAAGLDNQNHLSQEAMERGWQCLKLFSERLQDIPLDQIRV
GPPA_YERPG      LGSNSFHMLVVREVAGSIQT-LARIKRKVRLAAGLDNQNHLSQEAMERGWQCLKLFSERLQDIPLDQIRV
GPPA_YERPE      LGSNSFHMLVVREVAGSIQT-LARIKRKVRLAAGLDNQNHLSQEAMERGWQCLKLFSERLQDIPLDQIRV
GPPA_YERPB      LGSNSFHMLVVREVAGSIQT-LARIKRKVRLAAGLDNQNHLSQEAMERGWQCLKLFSERLQDIPLDQIRV
GPPA_YERP3      LGSNSFHMLVVREVAGSIQT-LARIKRKVRLAAGLDNQNHLSQEAMERGWQCLKLFSERLQDIPLDQIRV
GPPA_AERS4      LGSNSFHMLVVREVAGALRT-VTKVKRKVRLAAGLDPEFRLSRAAMERGWDCLRLFSEQLQDIPADNIRV
GPPA_ECOLU      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_SHISS      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
PPX_HAEIN       LGSNSFHMI-VARIVNGSIQVLSRLKQKVKLAEGLDENAVLNQEAITRGVNCLALFAERLQGFPMENVNV
GPPA_SHIDS      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_SHIBS      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_SHIB3      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ESCF3      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECOSE      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECOLI      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECOLC      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECOHS      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECODH      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECOBW      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECO8A      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECO7I      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECO5E      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECO57      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECO55      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECO24      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_VIBF1      LGSNSFHMLVVRHINGSVQT-MAKIKRKVRLAAGLNENNTLSHEAMQRGWDCLSLFAERLQDIPVENIRI
GPPA_ECOUT      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECOSM      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECOL6      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECOK1      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECO81      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECO45      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_ECO27      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENALSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_VIBPA      LGSNSFHMLVVRHIDGSVQT-MAKIKRKVRLAAGLDEHNSLSMEAMQRGWDCLSLFAERLQDIPTQNIRI
GPPA_AERHH      LGSNSFHMLVVREVAGALRT-VTKVKRKVRLAAGLDPEFRLSRAAMERGWDCLRLFSEQLQDIPADNIRV
GPPA_SHIFL      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENDLSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_VIBHB      LGSNSFHMLVVRHIDGSVQT-MAKIKRKVRLAAGLDEHNSLSMEAMQRGWDCLSLFAERLQDIPKQNIRI
GPPA_VIBFM      LGSNSFHMLVVRHINGSVQT-MAKIKRKVRLAAGLNENNTLSHEAMQRGWDCLSLFAERLQDIPVENIRI
GPPA_PECCP      LGSNSFHMLVARETAGSIQT-LAKIKRKVRLAAGLDKQNRLSQDAMQRGWQCLQLFSERLQDIPQDQVRV
GPPA_PROMH      LGSNSFHMLVVREIAGSIQV-LSRVKRKVRLAAGLNKENELSEQAMERGWQCLRLFSEYLRDIPAEQIRV
PPX_VIBCH       LGSNSFHMVVAKVVDQDLQL-ISRHKQRVRLAAGLDEQKNLDEESIQRGLECLAMFAERLQGFEPRNVRI
GPPA_PSEHT      LGSNSFHMLIAKSIAGGLQT-IGRVKRKVRLAAGLDIDNVLSSEAMHRGWECLALFAERLQDIPKQNITI
GPPA_SHIF8      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSENDLSNEAMERGWQCLRLFAERLQDIPPSQIRV
GPPA_SERP5      LGSNSFHMLVVREVAGSIQT-LARIKRKVRLAAGLDQNNLLSHEAMQRGWQCLKLFSERLQDIPRAQIRV
GPPA_PHOPR      LGSNSFHMWIVREVAGSVQT-LAKIKRKVRLAAGLNSQNELSEEAMQRGWDCLSLFAERLQDIPAERVRI
GPPA_KLEP3      LGSNSFHMLVVREVAGSIQT-LSRIKRKVRLAAGLNSDNTLSAEAMERGWQCLRLFAERLQDIPPTQIRV
GPPA_ENTS8      LGSNSFHMLVVREVAGSIQT-LTRVKRKVRLAAGLGADNALSADAMERGWQCLRLFAERLQDIPPSQIRV
PPX_ECOLI       LGSNSFHMVIARVVDGAMQI-IGRLKQRVHLADGLGPDNMLSEEAMTRGLNCLSLFAERLQGFSPASVCI
PPX_ECOL6       LGSNSFHMVIARVVDGAMQI-IGRLKQRVHLADGLGPDNMLSEEAMTRGLNCLSLFAERLQGFSPASVCI
PPX_ECO57       LGSNSFHMVIARVVDGAMQI-IGRLKQRVHLADGLGPDNMLSEEAMTRGLNCLSLFAERLQGFSPASVCI
PPX_SALTY       LGSNSFHMVIARVVDGAMQI-IGRLKQRVHLADGLGADNKLSEEAMERGLSCLSLFAERLQGFSPSSVCI
PPX_SALTI       LGSNSFHMVIARVVDGAMQI-IGRLKQRVHLADGLGADNKLSEEAMERGLSCLSLFAERLQGFSPSSVCI
GPPA_KLEP7      LGSNSFHMLVVREVAGSIQT-LSRIKRKVRLAAGLNSDNTLSAEAMERGWQCLRLFAERLQDIPPTQIRV
GPPA_CITK8      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLNSDNSLSAEAMERGWQCLRLFAERLQDIPQPQICV
GPPA_ERWT9      LGSNSFHMLVVREVAGSIQT-IARIKRKVRLAAGLDADNNLSAEAMDRGWQCLRLFSEQLQDIPPEQIRV
GPPA_VIBVY      LGSNSFHMLVVRHIDGSVQT-MAKIKRKVRLAAGLDEHNALSKEAMQRGWDCLSLFAERLQDIPAEHIRI
GPPA_VIBVU      LGSNSFHMLVVRHIDGSVQT-MAKIKRKVRLAAGLDEHNALSKEAMQRGWDCLSLFAERLQDIPAEHIRI
GPPA_VIBCM      LGSNSFHMLVVRHIDGSVQT-MAKIKRKVRLAAGLDEHNALSLDAMQRGWDCLSLFAERLQDIPAENIRI
GPPA_VIBCH      LGSNSFHMLVVRHIDGSVQT-MAKIKRKVRLAAGLDEHNALSLDAMQRGWDCLSLFAERLQDIPAENIRI
GPPA_VIBC3      LGSNSFHMLVVRHIDGSVQT-MAKIKRKVRLAAGLDEHNALSLDAMQRGWDCLSLFAERLQDIPAENIRI
GPPA_SALG2      LGSNSFHMLVVREAAGSIQT-LTRIKRKVRLAAGLNNDNHLSAEAMERGWQCLRLFAERLQDIPQPQIRV
GPPA_ENT38      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLSQDNHLSPEAMERGWQCLRLFAERLQDIPHNQIRV
GPPA_SALTY      LGSNSFHMLVVREAAGSIQT-LTRIKRKVRLAAGLNNDNHLSAEAMERGWQCLRLFAERLQDIPQPQIRV
GPPA_SALTI      LGSNSFHMLVVREAAGSIQT-LTRIKRKVRLAAGLNNDNHLSAEAMERGWQCLRLFAERLQDIPQPQIRV
GPPA_SALSV      LGSNSFHMLVVREAAGSIQT-LTRIKRKVRLAAGLNNDNHLSAEAMERGWQCLRLFAERLQDIPQPQIRV
GPPA_SALPB      LGSNSFHMLVVREAAGSIQT-LTRIKRKVRLAAGLNNDNHLSAEAMERGWQCLRLFAERLQDIPQPQIRV
GPPA_SALNS      LGSNSFHMLVVREAAGSIQT-LTRIKRKVRLAAGLNNDNHLSAEAMERGWQCLRLFAERLQDIPQPQIRV
GPPA_SALHS      LGSNSFHMLVVREAAGSIQT-LTRIKRKVRLAAGLNNDNHLSAEAMERGWQCLRLFAERLQDIPQPQIRV
GPPA_SALEP      LGSNSFHMLVVREAAGSIQT-LTRIKRKVRLAAGLNNDNHLSAEAMERGWQCLRLFAERLQDIPQPQIRV
GPPA_SALDC      LGSNSFHMLVVREASGSIQT-LTRIKRKVRLAAGLNNDNHLSAEAMERGWQCLRLFAERLQDIPQPQIRV
GPPA_SALCH      LGSNSFHMLVVREAAGSIQT-LTRIKRKVRLAAGLNNDNHLSAEAMERGWQCLRLFAERLQDIPQPQIRV
GPPA_SALA4      LGSNSFHMLVVREAAGSIQT-LTRIKRKVRLAAGLNNDNHLSAEAMERGWQCLRLFAERLQDIPQPQIRV
GPPA_PHOLL      LGSNSFHMLVV-REVSGSMQILARIKRKVRLAAGLDKNNRLSQQAMERGWQCLRIFSERLQDIPPSQIRV
GPPA_SALPK      LGSNSFHMLVVREAAGSIQT-LTRIKRKVRLAAGLNNDNHLSAEAMERGWQCLRLFAERLQDIPQPQIRV
GPPA_SALPA      LGSNSFHMLVVREAAGSIQT-LTRIKRKVRLAAGLNNDNHLSAEAMERGWQCLRLFAERLQDIPQPQIRV
GPPA_SALAR      LGSNSFHMLVVREVAGSIQT-LTRIKRKVRLAAGLSSDNQLSAEAMERGWQCLRLFAERLQDIPQPQIRV
GPPA_VIBSL      LGSNSFHMLVVRHIDGSVQT-MAKIKRKVRLAAGLDENNALSTEAMQRGWDCLSLFAERLRDIPKENIRI
GPPA_SALPC      LGSNSFHMLVVREAAESIQT-LTRIKRKVRLAAGLNNDNHLSAEAMERGWQCLRLFAERLQDIPQPQIRV
GPPA_PSEA6      LGSNSFHLVIVRVVAGSVQI-IGKVKQKVRLAAGLDDNMMLDNESLERGWRCLETFAERLQDIPRDNIRV
AROB_FUSNN      ----------------------------------------------------------------------
GPPA_SODGM      ----------------------------------------------------------------------
RTG2_YEAST      ----------------------------------------------------------------------
SUCC_RHOSK      ------------------------------------------EKGGVRLAKSVGEAAELAKQMLGRTLVT
SUCC_RHOS4      ------------------------------------------EKGGVRLAKSVGEAAELAKQMLGRTLVT
SUCC_RHOS1      ------------------------------------------EKGGVRLAKSVGEAAELAKQMLGRTLVT


                         .         .         *         .         .         .         .:140
query           FATSAVRSATNSEAVLDHVEEETGVRLSILSGEDEARQTFLAVRRWYGWSAGRITNLDIGGGSLELSSGT
Y507_MYCBO      FATSAVRDAENSEDVLSRVRKETGVELQALRGEDESRLTFLAVRRWYGWSAGRILNLDIGGGSLEVSSGV
Y496_MYCTU      FATSAVRDAENSEDVLSRVRKETGVELQALRGEDESRLTFLAVRRWYGWSAGRILNLDIGGGSLEVSSGV
Y2434_MYCLE     FATSAVREAGNSDDVLSRVRKETGVRLQVLRGVDESRLTFLAVRRWFGWSAGRIINLDIGGGSLELSNGV
Y3348_STRCO     FATSAVREASNADDVLARVRAETGVELTVLTGAEEARLTFLAARRWFGWSAGRLLVLDIGGGSLEIAYGM
Y757_STRCO      FATAVVRAAPNRREVLRTVQARTGVPLCTLPGEVEAELTFLAARRWMGWRSGPLALLDIGGGSLEVAFGR
PPX_PSEAE       VATNALREARNRSDFIRRAEEVLGHPVEVISGREEARLIYLGVANSMPDSGGRRLVSDIGGGSTEFIIGQ
GPPA_ERWCT      VATATLRLATNADEFLQRAQEILGLPIQVISGEEEARLIYQGVAHTTGGPDARLV-VDIGGGSTELATGI
GPPA_YERE8      VATATLRLASNAEEFLQTATEILGCPIQVISGEEEARLIYHGVAHTTGGPEQRLV-VDIGGGSTELVTGN
GPPA_YERPY      VATATLRLASNADEFLRTATEILGCPIQVISGEEEARLIYHGVAHTTGGPEQRLV-VDIGGGSTELVTGN
GPPA_YERPS      VATATLRLASNADEFLRTATEILGCPIQVISGEEEARLIYHGVAHTTGGPEQRLV-VDIGGGSTELVTGN
GPPA_YERPP      VATATLRLASNADEFLRTATEILGCPIQVISGEEEARLIYHGVAHTTGGPEQRLV-VDIGGGSTELVTGN
GPPA_YERPG      VATATLRLASNADEFLRTATEILGCPIQVISGEEEARLIYHGVAHTTGGPEQRLV-VDIGGGSTELVTGN
GPPA_YERPE      VATATLRLASNADEFLRTATEILGCPIQVISGEEEARLIYHGVAHTTGGPEQRLV-VDIGGGSTELVTGN
GPPA_YERPB      VATATLRLASNADEFLRTATEILGCPIQVISGEEEARLIYHGVAHTTGGPEQRLV-VDIGGGSTELVTGN
GPPA_YERP3      VATATLRLASNADEFLRTATEILGCPIQVISGEEEARLIYHGVAHTTGGPEQRLV-VDIGGGSTELVTGN
GPPA_AERS4      VGTATLRLATNVDEFLSEAERVLNHSIEIISGEEEAKTIYEGVS-WTSAGEGNRLVIDIGGASTELVIGE
GPPA_ECOLU      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_SHISS      VATATLRLAVNAGDFIANAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
PPX_HAEIN       VGTYTLRRAVNNDEFLRQAAKVFPYPINIISGQTEAKTIYAGVCHTQP-EKGRKLVIDIGGGSTEMIIGD
GPPA_SHIDS      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_SHIBS      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_SHIB3      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ESCF3      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECOSE      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECOLI      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECOLC      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECOHS      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECODH      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECOBW      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECO8A      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECO7I      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECO5E      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECO57      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECO55      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECO24      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_VIBF1      VGTATLRVASNVDIFLEKANQILGHNINVIEGEEEARMIYQGVAHTSGGNGRRLV-VDIGGASTELIIGE
GPPA_ECOUT      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECOSM      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECOL6      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECOK1      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECO81      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECO45      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ECO27      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_VIBPA      VGTATLRTATNVDVFLEKANQILGQPIEVISGEEEAATIYKGVAHTSGGSGRRLV-VDIGGASTELIIGE
GPPA_AERHH      VGTATLRLATNVDEFLSEAERVLNHSIEIISGEEEAKTIYEGVS-WTSAGEGNRLVIDIGGASTELVIGE
GPPA_SHIFL      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_VIBHB      VGTATLRTATNVDVFLEKANQILGQPIEVITGEEEAATIYKGVAHTSGGSGRRLV-VDIGGASTELIIGE
GPPA_VIBFM      VGTATLRVASNVDIFLEKANQILGHNINVIEGEEEARMIYQGVAHTSGGNGRRLV-VDIGGASTELIIGE
GPPA_PECCP      VATATLRLATNADEFLQRAQEILGLPIQVISGEEEARLIYQGVAHTTGGPDARLV-VDIGGGSTELATGV
GPPA_PROMH      VATATLRIAKNADIFVAKASEILGNTVHVISGEEEARLIYRGVAHTTGGAEQRLV-VDIGGGSTELVTGT
PPX_VIBCH       AATHTLRQARNANLFIQRALDVLPFPIEIIPGSEEARLIYLGVAHTQP-QADSMLVVDIGGGSTEMIIGK
GPPA_PSEHT      VATATLRLASNADVFKAQAEKILGHKVNVISGELEARTIYKGVAHTSSCTGSQLV-IDIGGASTEVIIGK
GPPA_SHIF8      VATATLRLAVNAGDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDISGASTELVTGT
GPPA_SERP5      VATATLRLASNADEFLQTAEQILGCPIQVISGEEEARLIYHGVAHTTGGPDQRLV-VDIGGGSTELVTGT
GPPA_PHOPR      IGTAALRTAVNADIFLSKAKDILGSKVDVIPGEEEARIIYQGVAHTSGGSDKRLV-VDIGGASTEVIIGE
GPPA_KLEP3      VATATLRLAVNAEEFLAKAQEILGTPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ENTS8      VATATLRLATNADVFVARAQEILGCPVQVIAGEEEARLIYQGVAHTTGGADRRLV-VDIGGASTELVTGT
PPX_ECOLI       VGTHTLRQALNATDFLKRAEKVIPYPIEIISGNEEARLIFMGVEHTQP-EKGRKLVIDIGGGSTELVIGE
PPX_ECOL6       VGTHTLRQALNATDFLKRAEKVIPYPIEIISGNEEARLIFMGVEHTQP-EKGRKLVIDIGGGSTELVIGE
PPX_ECO57       VGTHTLRQALNATDFLKRAEKVIPYPIEIISGNEEARLIFMGVEHTQP-EKGRKLVIDIGGGSTELVIGE
PPX_SALTY       VGTHTLRQAQNAADFLKRAEKVIPYPIEIISGNEEARLIFMGVEHTQP-EKGRKLVIDIGGGSTELVIGE
PPX_SALTI       VGTHTLRQAQNAADFLKRAEKVIPYPIEIISGNEEARLIFMGVEHTQP-EKGRKLVIDIGGGSTELVIGE
GPPA_KLEP7      VATATLRLAVNAGEFLAKAQEILGTPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_CITK8      VATATLRLAVNAGEFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ERWT9      VATATLRIAANAGSFLAQAQKLLGCPVNVISGEEEARLIYQGVSHTTGGSDKRLV-VDIGGGSTELVTGR
GPPA_VIBVY      VGTATLRTATNVDLFLQKANQILGHPIEVISGEEEAATIYKGVAHTSGGSGRRLV-VDIGGASTELIIGE
GPPA_VIBVU      VGTATLRTATNVDLFLQKANQILGHPIEVISGEEEAATIYKGVAHTSGGSGRRLV-VDIGGASTELIIGE
GPPA_VIBCM      VGTATLRTATNAGEFIAKANQILGHPIDVISGEEEAATIYKGVAHTSG-GLGRRLVVDIGGASTELIIGE
GPPA_VIBCH      VGTATLRTATNAGEFIAKANQILGHPIDVISGEEEAATIYKGVAHTSG-GLGRRLVVDIGGASTELIIGE
GPPA_VIBC3      VGTATLRTATNAGEFIAKANQILGHPIDVISGEEEAATIYKGVAHTSG-GLGRRLVVDIGGASTELIIGE
GPPA_SALG2      VATATLRLAVNAGEFIAKAQTILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_ENT38      VATATLRLAVNSVDFIAKAQEILGCPVQVISGEEEARLIYQGVAHTTGGDDRRLV-VDIGGASTELVTGT
GPPA_SALTY      VATATLRLAVNAGEFIAKAQTILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_SALTI      VATATLRLAVNAGEFIAKAQTILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_SALSV      VATATLRLAVNAGEFIAKAQTILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_SALPB      VATATLRLAVNAGEFIAKAQTILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_SALNS      VATATLRLAVNAGEFIAKAQTILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_SALHS      VATATLRLAVNAGEFIAKAQTILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_SALEP      VATATLRLAVNAGEFIAKAQTILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_SALDC      VATATLRLAVNAGEFIAKAQTILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_SALCH      VATATLRLAVNAGEFIAKAQTILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_SALA4      VATATLRLAVNAGEFIAKAQTILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_PHOLL      VATATLRIAENSDEFVGKASEILDCPVKVISGEDEARLIYQGVAHTTGGPEKRLV-VDIGGASTELVTGN
GPPA_SALPK      VATATLRLAVNAGEFIAKAQTILGCPVQVISGEEEARLIYQGAAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_SALPA      VATATLRLAVNAGEFIAKAQTILGCPVQVISGEEEARLIYQGAAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_SALAR      VATATLRLAVNAGEFIAKAQTILGCPVQVISGEEEARLIYQGVAHTTGGAEQRLV-VDIGGASTELVTGT
GPPA_VIBSL      VGTATLRTAINVDIFLEKANQILGYDINVISGEEEAATIYKGVAHTSGGSGRRLV-VDIGGASTEMIIGE
GPPA_SALPC      VATATLRLAVNAGEFIAKAQTILGCPVQVISGEEEARLIYQGVAHTTGGADQRLV-VDIGGASTELVTGT
GPPA_PSEA6      VATATLRLAKNADVFTVKAQQILDHTLSVISGEEEARQIYLGV-AYTSANQGNSLVIDIGGASTEIIIGN
AROB_FUSNN      FATSATRDSTNKDYFIKKVFDETKIKINCISGDKEAYINFKGVISSFDRDKDNILVFDIGGGSTEFTLGN
GPPA_SODGM      -----------------------GCPVQVISGEEEARLIYQGVAHTTGGSDERLV-VDIGGGSTELVVGR
RTG2_YEAST      -ATEATRDAINADEFVNAVYGSTGWKVEILGQEDETRVGIYGVVSSFNTVRG--LYLDVAGGSTQLSHGE
SUCC_RHOSK      HQTGPAGKQVN--------------RIYIEEGSDIARELYLALLVDRGTSRISFVVSTEGGMDIEEVAAS
SUCC_RHOS4      HQTGPAGKQVN--------------RIYIEEGSDIARELYLALLVDRGTSRISFVVSTEGGMDIEEVAAS
SUCC_RHOS1      HQTGPAGKQVN--------------RIYIEEGSDIARELYLALLVDRGTSRISFVVSTEGGMDIEEVAAS


                         +         .         .         .         .         *         .:210
query           DESPDLAFSLDLGAGRLTHNWFDTDPPARKKINLLRDYIDAELAEPARQMRTLGPARLAVGTSKTFRTLA
Y507_MYCBO      DEEPEIALSLPLGAGRLTREWLPDDPPGRRRVAMLRDWLDAELAEPSVTVLEAGSPDLAVATSKTFRSLA
Y496_MYCTU      DEEPEIALSLPLGAGRLTREWLPDDPPGRRRVAMLRDWLDAELAEPSVTVLEAGSPDLAVATSKTFRSLA
Y2434_MYCLE     DEEPEVALSLPLGAGRLTREWLPDDPPGRRRVAMLRDWLDSELSDASVTVLEAGKPDLAVATSKTFRSLA
Y3348_STRCO     DEEPDAAVSLPLGAGRLTAARLPDDPPHPDDVRALRRHVRTEIARTVGEFSRLGAPDHVVATSKTFRQLA
Y757_STRCO      GRLPGFVASLPLGAARLTHEFLGRDPASPEQVKALRRRVRHQLRDAAARIRWEGP-RTAVATSRTFQQLG
PPX_PSEAE       GFESELRESLQMGCVSYTQRYFRDGKITPARYAQAYTAARLELMGIENSLRRLG-WQQAVGASGTIRAV-
GPPA_ERWCT      GAKTTQLISLPMGCVTWLDRYFSDRNLEAGNFERAENAAREMLRPVAASLREQG-WQICVGASGTVQALQ
GPPA_YERE8      GAQANILVSLPMGCVTWLERYFSDR-------NLAKDNFDREMLKPVAQRFREHGWQICVGASGTVQALQ
GPPA_YERPY      GAQANILVSLSMGCVTWLERYFGDRHLAKE--NFERAELAAEMIKPVAQRFREHGWQVCVGASGTVQALQ
GPPA_YERPS      GAQANILVSLSMGCVTWLERYFGDRHLAKE--NFERAELAAEMIKPVAQRFREHGWQVCVGASGTVQALQ
GPPA_YERPP      GAQANILVSLSMGCVTWLERYFGDRHLAKE--NFERAELAAEMIKPVAQRFREHGWQVCVGASGTVQALQ
GPPA_YERPG      GAQANILVSLSMGCVTWLERYFGDRHLAKE--NFERAELAAEMIKPVAQRFREHGWQVCVGASGTVQALQ
GPPA_YERPE      GAQANILVSLSMGCVTWLERYFGDRHLAKE--NFERAELAAEMIKPVAQRFREHGWQVCVGASGTVQALQ
GPPA_YERPB      GAQANILVSLSMGCVTWLERYFGDRHLAKE--NFERAELAAEMIKPVAQRFREHGWQVCVGASGTVQALQ
GPPA_YERP3      GAQANILVSLSMGCVTWLERYFGDRHLAKE--NFERAELAAEMIKPVAQRFREHGWQVCVGASGTVQALQ
GPPA_AERS4      HSEAKLLNSLHMGCVTWLNNHFGDGELSEXXXXXXXXXXXXVLEKVAEDYCVLG-WRTCVGASGTVQALQ
GPPA_ECOLU      GAQTTSLFSLSMGCVTWLERYFADRNLAQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_SHISS      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
PPX_HAEIN       DFTPLMAESRHMGCVSFATQFFTDGIISPENFQRARQSAVNKIEDLGLEYRKLG-WQSVLGSSGTIKTVA
GPPA_SHIDS      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPIADELRYHG-WKVCVGASGTVQALQ
GPPA_SHIBS      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_SHIB3      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ESCF3      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECOSE      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECOLI      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECOLC      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECOHS      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECODH      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECOBW      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECO8A      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECO7I      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAARKVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECO5E      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECO57      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECO55      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECO24      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_VIBF1      GFEAQALTSLKMGCVTWLEGYFKDRALTQKNFNAAIAGAKETLAPILQQYTDLG-WQTCVGASGTVQALQ
GPPA_ECOUT      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECOSM      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECOL6      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECOK1      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECO81      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECO45      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_ECO27      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_VIBPA      GFEAKALTSLKMGCVTWLENFFKDRQLNARNFEAAIEGAKQTIKPILEQYTDLG-WDVCVGASGTVQALQ
GPPA_AERHH      HSEAKLLNSLHMGCVTWLNNHFGDGELSXXXXXXXXXXXXXXXXXXXXDYRALG-WRTCVGASGTVQALQ
GPPA_SHIFL      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_VIBHB      GFEAKALTSLKMGCVTWLENFFKDRQLNARNFDAAIEGAKQTLMPILGQYTDLG-WDVCVGASGTVQALQ
GPPA_VIBFM      GFEAQALTSLKMGCVTWLEGYFKDRALTQKNFDSAIAGAKETLAPILQQYTDLG-WQTCVGASGTVQALQ
GPPA_PECCP      GAKTTQLISLPMGCVTWLDRYFSDRNLEAGNFERAEQAAREMLRPVAASLREQG-WQICVGASGTVQALQ
GPPA_PROMH      GAKTTQLMSLSMGCVTWLERYFSDRSLTEENFXXXXXXXXXXXXXXXEKLIQQG-WQVCVGASGTVQALQ
PPX_VIBCH       GFEAELLNSKQMGCVNFTERYFANGKLSRKNFAQAIVASEQKLESIASKYRKKG-WQMAFGSSGTIKAIH
GPPA_PSEHT      NFDALLYKSLNIGCVTYLERYFKDCKLSNANFNTAIKAARTVIDEIASEYKVKG-WQIASGASGTVQAIQ
GPPA_SHIF8      GAQTTSLFSLSMGCVTWLERYFADRNLGQENFDAAEKAAREVLRPVADELRYHG-WKVCVGASGTVQALQ
GPPA_SERP5      GAQAAQLYSLSMGCVTWLERFFSDRNLGQENFERAEQAAREMVRPIAPQLRQHG-WQVCVGASGTVQALQ
GPPA_PHOPR      GFDASALTSLKIGCVTWLERYFKDRYLTAENFDAAIDAAKNAIEPIVEQYTQLG-WETCVGASGTVQALQ
GPPA_KLEP3      GAQTTSLFSLSMGCVTWLERYF-ADRSLTKENFDLAEAAAREVLLPIADVLRYHGWKVCVGASGTVQALQ
GPPA_ENTS8      GARATSLFSLPMGCVTFLERFF-TDRSLTQEHFASAEQAARDILQPVAQLRGQG-WKICVGASGTVQALQ
PPX_ECOLI       NFEPILVESRRMGCVSFAQLYFPGGVINKENFQRARMAAAQKLETLTWQFRIQG-WNVAMGASGTIKAAH
PPX_ECOL6       NFEPILVESRRMGCVSFAQLYFPGGVINKENFQRARMAAAQKLETLTWQFRIQG-WNVAMGASGTIKAAH
PPX_ECO57       NFEPILVESRRMGCVSFAQLYFPGGVINKENFQRARMAAAQKLETLTWQFRIQG-WNVAMGASGTIKAAH
PPX_SALTY       NFEPRLVESRRMGCVSFAQLYFPGGVINKENFQRARMAAAQKLETLTWQYRIQG-WNVAMGASGTIKAAH
PPX_SALTI       NFEPRLVESRRMGCVSFAQLYFPGGVINKENFQRARMAAAQKLETLTWQYRIQG-WNVAMGASGTIKAAH
GPPA_KLEP7      GAQTTSLFSLSMGCVTWLERYF-ADRSLTKENFDLAEAAAREVLLPVADVLRYHGWKVCVGASGTVQALQ
GPPA_CITK8      GAQTTSLFSLSMGCVTWLERYFTDRNLAQENFDEAEKAAREVLRPVADELRKHG-WKVCVGASGTVQALQ
GPPA_ERWT9      GSQPTTLYSLSMGCVTWLERYFSDRQLGKVNFEQAEQAARAMIRPIADSLKAQG-WQVCVGASGTVQALQ
GPPA_VIBVY      GFEAKALTSLKMGCVTWLENFFKDRQLSARNFEAAIEGAKQTLLPILEQYKSLG-WDVCVGASGTVQALQ
GPPA_VIBVU      GFEAKALTSLKMGCVTWLENFFKDRQLSARNFEAAIEGAKQTLLPILEQYKSLG-WDVCVGASGTVQALQ
GPPA_VIBCM      GFEAKALTSLKMGCVTLERHFKDRQLTATNFNNAI--LAAKQMLDPILTQYTELGWNVCVGASGTVQALQ
GPPA_VIBCH      GFEAKALTSLKMGCVTLERHFKDRQLTATNFNNAI--LAAKQMLDPILTQYTELGWNVCVGASGTVQALQ
GPPA_VIBC3      GFEAKALTSLKMGCVTLERHFKDRQLTATNFNNAI--LAAKQMLDPILTQYTELGWNVCVGASGTVQALQ
GPPA_SALG2      GAQTTSLFSLSMGCVTWLERYFSDRNLAQENFDDAEKVARDVLRPVADELRFHG-WKVCVGASGTVQALQ
GPPA_ENT38      GAQATSLFSLSMGCVTWLERYFTDRNLAQENFDEAEN-AAREVLRPVMDKLRYHGWKVCVGASGTVQALQ
GPPA_SALTY      GAQTTSLFSLSMGCVTWLERYFSDRNLAQENFDDAEKAARDVLRPVADELRFHG-WKVCVGASGTVQALQ
GPPA_SALTI      GAQTTSLFSLSMGCVTWLERYFSDRNLAQENFDDAEKAARDVLRPVADELRFHG-WKVCVGASGTVQALQ
GPPA_SALSV      GAQTTSLFSLSMGCVTWLERYFSDRNLAQENFDDAEKAARDVLRPVADELRFHG-WKVCVGASGTVQALQ
GPPA_SALPB      GAQTTSLFSLSMGCVTWLERYFSDRNLAQENFDDAEKAARDVLRPVADELRFHG-WKVCVGASGTVQALQ
GPPA_SALNS      GAQTTSLFSLSMGCVTWLERYFSDRNLAQENFDDAEKAARDVLRPVADELRFHG-WKVCVGASGTVQALQ
GPPA_SALHS      GAQTTSLFSLSMGCVTWLERYFSDRNLAQENFDDAEKAARDVLRPVADELRFHG-WKVCVGASGTVQALQ
GPPA_SALEP      GAQTTSLFSLSMGCVTWLERYFSDRNLAQENFDDAEKAARDVLRPVADELRFHG-WKVCVGASGTVQALQ
GPPA_SALDC      GAQTTSLFSLSMGCVTWLERYFSDRNLAQENFDDAEKAARDVLRPVADELRFHG-WKVCVGASGTVQALQ
GPPA_SALCH      GAQTTSLFSLSMGCVTWLERYFSDRNLAQENFDDAEKAARDVLRPVADELRFHG-WKVCVGASGTVQALQ
GPPA_SALA4      GAQTTSLFSLSMGCVTWLERYFSDRNLAQENFDDAEKAARDVLRPVADELRFHG-WKVCVGASGTVQALQ
GPPA_PHOLL      GAKASQLSSLSMGCVTWLEGYFNDR-------SLTEENFARAEAAAHETLKLIAPKQICVGASGTVQALQ
GPPA_SALPK      GAQTTSLFSLSMGCVTWLERYFSDRNLAQENFDDAEKAARDVLRPVADELRFHG-WKVCVGASGTVQALQ
GPPA_SALPA      GAQTTSLFSLSMGCVTWLERYFSDRNLAQENFDDAEKAARDVLRPVADELRFHG-WKVCVGASGTVQALQ
GPPA_SALAR      GAQTTSLFSLSMGCVTWLEHYFSDRNLAQENFDDAEKAARDVLRPVADKLRFHG-WKVCVGASGTVQALQ
GPPA_VIBSL      GFSAKALTSLKMGCVTWLERHFKDRQLTATNFNNAIEAAKSTLAPILDSYTDIG-WDVCVGASGTVQALQ
GPPA_SALPC      GAQTTSLFSLSMGCVTWLERYFSDRNLAQENFDDAEKAARDVLRPVADELRFHG-WKVCVGASGTVQALQ
GPPA_PSEA6      DMTPIHLVSLNMGCVTFKERHFAGDVLSEENXXXXXXXXXXXXXXXXXXXXCF-DWQQCLGASGTPQAIT
AROB_FUSNN      MQGIEKKISLNIGSVRITEKFFLNNKYSEENRIKAKDWVKENLKE-LEDFKKLNFSLIGVAGTTTTQVSV
GPPA_SODGM      GAQALELFSLEMGCVTWLERYFNDRSLTRENFERAEQAAREKIRPVAFRLLAQG-WQVCVGASGTVQALQ
RTG2_YEAST      VKQSSKPVSLPYGAGTL-----------------------------------------------------
SUCC_RHOSK      TPEKIVSFSVDPASG-------------------------------------------------------
SUCC_RHOS4      TPEKIVSFSVDPASG-------------------------------------------------------
SUCC_RHOS1      TPEKIVSFSVDPASG-------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RLTGAAPSSAGPHVTRTLTAPGLRQLIAFISRMTAADRAELEGISSDRSHQIVAGALVAEAAMRALDIDK
Y507_MYCBO      RLTGAAPSMAGPRVKRTLTANGLRQLIAFISRMTAVDRAELEGVSADRAPQIVAGALVAEASMRALSIEA
Y496_MYCTU      RLTGAAPSMAGPRVKRTLTANGLRQLIAFISRMTAVDRAELEGVSADRAPQIVAGALVAEASMRALSIEA
Y2434_MYCLE     RLTGAAPSAAGPRAKRALTVNGLRQLIAFISRMTASDRAELEGISTERAPQIVAGALVAEASMRALSIET
Y3348_STRCO     RITGAARSAEGLYVQRELKRASLEAWVPRLAAMTSTERAELPGVSEGRAHQLLAGALVAEGAMDLFRVES
Y757_STRCO      RLCGAPPGRYGPFTERRMRCSDLGDAVGXXXXXXXXXXXXXPGISAPRAAQSLAGAVVGHTAMKLTGLEA
PPX_PSEAE       ----ALAIKAGGHGNGEISPDGLAWLKRKVLKLGDVEKLDLEGIKPDRRTIFPAGLAILEAIFDALELEQ
GPPA_ERWCT      EIMVA------QGMDEYITLPKLRQLKEHAIQCDKLEELEIDGLTLERALVFPSGLAILLAIFQELDIKT
GPPA_YERE8      EIMVA------QGMDELITLAKLQQLKQRAIQCGKLEELEIPGLTLERALVFPSGLSILIAIFQELAIES
GPPA_YERPY      EIMVA------QGMDELITLAKLQQLKQRAIQCGKLEELEIPGLTLERALVFPSGLSILIAIFQELSIES
GPPA_YERPS      EIMVA------QGMDELITLAKLQQLKQRAIQCGKLEELEIPGLTLERALVFPSGLSILIAIFQELSIES
GPPA_YERPP      EIMVA------QGMDELITLAKLQQLKQRAIQCGKLEELEIPGLTLERALVFPSGLSILIAIFQELSIES
GPPA_YERPG      EIMVA------QGMDELITLAKLQQLKQRAIQCGKLEELEIPGLTLERALVFPSGLSILIAIFQELSIES
GPPA_YERPE      EIMVA------QGMDELITLAKLQQLKQRAIQCGKLEELEIPGLTLERALVFPSGLSILIAIFQELSIES
GPPA_YERPB      EIMVA------QGMDELITLAKLQQLKQRAIQCGKLEELEIPGLTLERALVFPSGLSILIAIFQELSIES
GPPA_YERP3      EIMVA------QGMDELITLAKLQQLKQRAIQCGKLEELEIPGLTLERALVFPSGLSILIAIFQELSIES
GPPA_AERS4      EIMLAQGKS------ERVTLPKLQELMGQAIACGRLDRLQLEGLAAERLTVFPSGLAILIAIFETLNIES
GPPA_ECOLU      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_SHISS      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
PPX_HAEIN       QVIATNLDPNG-----TITAERLNALIEQTLQAKHFTELNINGLNQDRVDVFVPGLAILSAVFDVFHIQQ
GPPA_SHIDS      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQY
GPPA_SHIBS      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_SHIB3      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ESCF3      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECOSE      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECOLI      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECOLC      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECOHS      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECODH      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECOBW      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECO8A      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECO7I      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECO5E      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECO57      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECO55      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECO24      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_VIBF1      EIMLA------QGMDEVITLAKLKRLQKQAMQYEHLEELDIDGLTLERALVFPSGLSILIAIFELLNIDS
GPPA_ECOUT      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECOSM      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECOL6      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECOK1      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECO81      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECO45      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_ECO27      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_VIBPA      EIMLA------QGMDEVITHSKLKRLQKQAMLADHLEELDIEGLTLERALVFPSGLSILIAIFELLEIDA
GPPA_AERHH      EIMLAQGKS------ERVTLPKLQELMGQAIACGKLDQLQLEGLAAERLTVFPSGLAILIAIFETLGIES
GPPA_SHIFL      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_VIBHB      EIMLA------QGMDEVITHSKLKRLQKQAMLADHLEELDIEGLTLERALVFPSGLSILIAIFEQLEIDA
GPPA_VIBFM      EIMLA------QGMDEVITLAKLKRLQKQAMQYEHLEELDIDGLTLERALVFPSGLSILIAIFELLNIDS
GPPA_PECCP      EIMVA------QGMDEYITLPKLRQLKEHAIQCDKXXXXXXXXXXXXRALVFPSGLAILLAIFQELDIKT
GPPA_PROMH      EIMIA------QGMDELITLPKLERLKQKAIECGKLEELEIEGLTFERALVFPSGLAILIAIFETLHIEN
PPX_VIBCH       ELIGQG------HEDGLITFERLSKLIEKLCEWDSIDDLQLPGLTDDRKPVFAAGVAILSAIFHGLNIKE
GPPA_PSEHT      EIMIAQ------NLDELLTLEKLKQSIAY--KTIAA--LDLPGLSEDRRLVFVSGLAILIALFESLEIEK
GPPA_SHIF8      EIMMA------QGMDERITLEKLQQLKQRAIHCGRLEELEIDGLTLERALVFPSGLAILIAIFTELNIQC
GPPA_SERP5      EIMVA------QGMDERITLSKLRQLKQRAIQCGKXXXXXXXXXXXXRALVFPSGLSILLAIFQELGIES
GPPA_PHOPR      EIMLA------QGMDEIITLSKLKRMQRQAMQYERLEDLDIEGLTLERALVFPSGLSILIAVFESLNIES
GPPA_KLEP3      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFSELNIQC
GPPA_ENTS8      EIMMA------QGMDERITLAKLQQLKARAIHCGRXXXXXXXXXXXXRALVFPSGLAILIAIFSELEIEC
PPX_ECOLI       EVLMEMGEKDG-----IITPERLEKLVKEVLRHRNFASLSLPGLSEERKTVFVPGLAILCGVFDALAIRE
PPX_ECOL6       EVLMEMGEKDG-----IITPERLEKLVKEVLRHRNFASLSLPGLSEERKTVFVPGLAILCGVFDALAIRE
PPX_ECO57       EVLMEMGEKDG-----IITPERLEKLVKEVLRHRNFASLSLPGLSEERKTVFVPGLAILCGVFDALAIRE
PPX_SALTY       EVLLALGEKDG-----FITPERLDKLKSEVLKHRSFNALSLPGLSEERKAVFVPGLAILCGVFDALAIRE
PPX_SALTI       EVLLALGEKDG-----FITPERLDKLKSEVLKHRSFNALSLPGLSEERKAVFVPGLAILCGVFDALAIRE
GPPA_KLEP7      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFSELNIQC
GPPA_CITK8      EIMMA------QGMDERITLAKLQQLKQRAIHCGRXXXXXXXXXXXXRALVFPSGLAILIAIFTELDIQC
GPPA_ERWT9      EIMMA------QGMDERITLNKLQQLKQRAIECGKXXXXXXXXXXXXRALVFPSGLSILIAIFSELNISS
GPPA_VIBVY      EIMLA------QGMDEVITHAKLKRLQKQAMLADHXXXXXXXXXXXXRALVFPSGLSILIAIFELLEIDA
GPPA_VIBVU      EIMLA------QGMDEVITHAKLKRLQKQAMLADHXXXXXXXXXXXXRALVFPSGLSILIAIFELLEIDA
GPPA_VIBCM      EIMLA------QGMDEVITLTKLKRLQKQAMLADHLEELDIEGLTLERALVFPSGLSILIAIFESLNIEA
GPPA_VIBCH      EIMLA------QGMDEVITLTKLKRLQKQAMLADHLEELDIEGLTLERALVFPSGLSILIAIFESLNIEA
GPPA_VIBC3      EIMLA------QGMDEVITLTKLKRLQKQAMLADHLEELDIEGLTLERALVFPSGLSILIAIFESLNIEA
GPPA_SALG2      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFTELNIQS
GPPA_ENT38      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFSELDIHC
GPPA_SALTY      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFTELNIQS
GPPA_SALTI      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFTELNIQS
GPPA_SALSV      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFTELNIQS
GPPA_SALPB      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFTELNIQS
GPPA_SALNS      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFTELNIQS
GPPA_SALHS      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFTELNIQS
GPPA_SALEP      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFTELNIQS
GPPA_SALDC      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFTELNIQS
GPPA_SALCH      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFTELNIQS
GPPA_SALA4      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFTELNIQS
GPPA_PHOLL      EIMIA------QGMDELITLPKLQELKHKAIECGKXXXXXXXXXXXXRALVFPSGLAILIAIFQALNIES
GPPA_SALPK      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFTELNIQS
GPPA_SALPA      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFTELNIQS
GPPA_SALAR      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFTELNIQF
GPPA_VIBSL      EIMLA------QGMDEVITHAKLKRLQKQAMXXXXXXXXXXXXXXXXXALVFPSGLSILIAIFELLEIDS
GPPA_SALPC      EIMMA------QGMDERITLAKLQQLKQRAIQCGRXXXXXXXXXXXXRALVFPSGLAILIAIFTELNIQS
GPPA_PSEA6      EILVAQGIS---DAIRLDYLYNLRQQCIDCSTL---DNLIIDGLDESRRIIFPSGLAILIALFESLSIRD
AROB_FUSNN      REKMEVYDSEKIHLSNLTSKEINDNLSLFIKNI---NKQEIKGLDPKRKDVIIGGTII------------
GPPA_SODGM      EIMVA--QGMDEHITLS----KLLQLKQRAIHCGKXXXXXXXXXXXXRALVFPSGLAILLAVFAELGITT
RTG2_YEAST      ----------------------------------------------------------------------
SUCC_RHOSK      ----------------------------------------------------------------------
SUCC_RHOS4      ----------------------------------------------------------------------
SUCC_RHOS1      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VEICPWALREGVILTRIDKGLE
Y507_MYCBO      VEICPWALREGLILRKLD----
Y496_MYCTU      VEICPWALREGLILRKLD----
Y2434_MYCLE     VDICPWALREGLILRKLD----
Y3348_STRCO     LEICPWALREGVILRRLD----
Y757_STRCO      VALCPWAIREGVLLRHIEDG--
PPX_PSEAE       MVHSEGALREGVL---------
GPPA_ERWCT      MTLAGGALREGLV---------
GPPA_YERE8      MTLAGGALREGLV---------
GPPA_YERPY      MTLAGGALREGLV---------
GPPA_YERPS      MTLAGGALREGLV---------
GPPA_YERPP      MTLAGGALREGLV---------
GPPA_YERPG      MTLAGGALREGLV---------
GPPA_YERPE      MTLAGGALREGLV---------
GPPA_YERPB      MTLAGGALREGLV---------
GPPA_YERP3      MTLAGGALREGLV---------
GPPA_AERS4      MTLAGGALREGLI---------
GPPA_ECOLU      MTLAGGALREGLV---------
GPPA_SHISS      MTLAGGALREGLVYGMLHLAVE
PPX_HAEIN       MRYSDGALREGVI---------
GPPA_SHIDS      MTLAGGALREGLVYGMLHLAVE
GPPA_SHIBS      MTLAGGALREGLVYGMLHLAVE
GPPA_SHIB3      MTLAGGALREGLVYGMLHLAVE
GPPA_ESCF3      MTLAGGALREGLVYGMLHLAVE
GPPA_ECOSE      MTLAGGALREGLVYGMLHLAVE
GPPA_ECOLI      MTLAGGALREGLVYGMLHLAVE
GPPA_ECOLC      MTLAGGALREGLVYGMLHLAVE
GPPA_ECOHS      MTLAGGALREGLVYGMLHLAVE
GPPA_ECODH      MTLAGGALREGLVYGMLHLAVE
GPPA_ECOBW      MTLAGGALREGLVYGMLHLAVE
GPPA_ECO8A      MTLAGGALREGLVYGMLHLAVE
GPPA_ECO7I      MTLAGGALREGLVYGMLHLAVE
GPPA_ECO5E      MTLAGGALREGLVYGMLHLAVE
GPPA_ECO57      MTLAGGALREGLVYGMLHLAVE
GPPA_ECO55      MTLAGGALREGLVYGMLHLAVE
GPPA_ECO24      MTLAGGALREGLVYGMLHLAVE
GPPA_VIBF1      MTLAGGALREGLCYGMIDE---
GPPA_ECOUT      MTLAGGALREGLV---------
GPPA_ECOSM      MTLAGGALREGLV---------
GPPA_ECOL6      MTLAGGALREGLV---------
GPPA_ECOK1      MTLAGGALREGLV---------
GPPA_ECO81      MTLAGGALREGLV---------
GPPA_ECO45      MTLAGGALREGLV---------
GPPA_ECO27      MTLAGGALREGLV---------
GPPA_VIBPA      MTLAGGALREGLVYEMVDE---
GPPA_AERHH      MTLAGGALREGLI---------
GPPA_SHIFL      MTLAGGALREGLVYGMLHLAVE
GPPA_VIBHB      MTLAGGALREGLVYEMVDE---
GPPA_VIBFM      MTLAGGALREGLCYGMIDE---
GPPA_PECCP      MTLAGGALREGLV---------
GPPA_PROMH      MILAGGALREGLV---------
PPX_VIBCH       MHFSDGALREGLLYEMEDR---
GPPA_PSEHT      MGLAGGALREGVLYSML-----
GPPA_SHIF8      MTLAGGALREGLVYGMLHLAVE
GPPA_SERP5      MMLAGGALREGLV---------
GPPA_PHOPR      MTLAGGALREGMVYEMMSK---
GPPA_KLEP3      MTLAGGALREGLVYGMLHLSVE
GPPA_ENTS8      MTLAGGALREGLV---------
PPX_ECOLI       LRLSDGALREGVL---------
PPX_ECOL6       LRLSDGALREGVL---------
PPX_ECO57       LRLSDGALREGVL---------
PPX_SALTY       LRLSDGALREGVL---------
PPX_SALTI       LRLSDGALREGVL---------
GPPA_KLEP7      MTLAGGALREGLVYGMLHLSVE
GPPA_CITK8      MTLAGGALREGLV---------
GPPA_ERWT9      MTLAGGALREGLL---------
GPPA_VIBVY      MTLAGGALREGL----------
GPPA_VIBVU      MTLAGGALREGL----------
GPPA_VIBCM      MTLAGGALREGLV---------
GPPA_VIBCH      MTLAGGALREGLV---------
GPPA_VIBC3      MTLAGGALREGLV---------
GPPA_SALG2      MTLAGGALREGLV---------
GPPA_ENT38      MTLAGGALREGLVYGMLHLAVE
GPPA_SALTY      MTLAGGALREGLV---------
GPPA_SALTI      MTLAGGALREGLV---------
GPPA_SALSV      MTLAGGALREGLV---------
GPPA_SALPB      MTLAGGALREGLV---------
GPPA_SALNS      MTLAGGALREGLV---------
GPPA_SALHS      MTLAGGALREGLV---------
GPPA_SALEP      MTLAGGALREGLV---------
GPPA_SALDC      MTLAGGALREGLV---------
GPPA_SALCH      MTLAGGALREGLV---------
GPPA_SALA4      MTLAGGALREGLV---------
GPPA_PHOLL      MILAGGALREGLVYGMLDLPIE
GPPA_SALPK      MTLAGGALREGLV---------
GPPA_SALPA      MTLAGGALREGLV---------
GPPA_SALAR      MTLAGGALREGLV---------
GPPA_VIBSL      MTLAGGALREGLAYEMVDE---
GPPA_SALPC      MTLAGGALREGLV---------
GPPA_PSEA6      MQISGGALREGLI---------
AROB_FUSNN      ----------------------
GPPA_SODGM      MTLAGGALREGMM---------
RTG2_YEAST      ----------------------
SUCC_RHOSK      ----------------------
SUCC_RHOS4      ----------------------
SUCC_RHOS1      ----------------------