[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF53516.1

[Show Plain Result]


## Summary of Sequence Search
    1::150
   32::92      5e-10  44%  107 aa  Y4551_YERPS RecName: Full=Uncharacterized protein pYV0051;
   92::174     1e-08  40%  224 aa  T431_STAAW RecName: Full=Transposase for insertion sequence-like
   92::174     1e-08  40%  224 aa  T431_STAAN RecName: Full=Transposase for insertion sequence-like
   92::174     1e-08  40%  224 aa  T431_STAAM RecName: Full=Transposase for insertion sequence-like
   92::174     1e-08  40%  224 aa  T431_STAA8 RecName: Full=Transposase for insertion sequence-like
   92::174     1e-08  40%  224 aa  T257_STAAU RecName: Full=Transposase for insertion sequence element
    1::150

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxAITAGGQTLDFYLSPKRNVAAAKRFLAKTLRSNTITGSPRVINTDKAPSLTRAI
Y4551_YERPS     ----------------AINKHGTTLDFYFSPKRNKNTAYPFIKRVLKTYSVERQPKILNTDKHSSYGYAI
T431_STAAW      ----------------AIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQ---FGKPQKVITDQAPSTKVAM
T431_STAAN      ----------------AIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQ---FGKPQKVITDQAPSTKVAM
T431_STAAM      ----------------AIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQ---FGKPQKVITDQAPSTKVAM
T431_STAA8      ----------------AIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQ---FGKPQKVITDQAPSTKVAM
T257_STAAU      ----------------AIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQ---FGKPQKVITDQAPSTKVAM


                         .         .         *         .         .         .         .:140
query           AELKSEGICPQTVEHWQVKYLNNVIEGDHGRLKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y4551_YERPS     TRLMKEG---------------------------------------------------------------
T431_STAAW      AKIKAFKLKPDC--HCTSKYLNNLIEQDHRHIK-------------------------------------
T431_STAAN      AKIKAFKLKPDC--HCTSKYLNNLIEQDHRHIK-------------------------------------
T431_STAAM      AKIKAFKLKPDC--HCTSKYLNNLIEQDHRHIK-------------------------------------
T431_STAA8      AKIKAFKLKPDC--HCTSKYLNNLIEQDHRHIK-------------------------------------
T257_STAAU      AKIKAFKLKPDC--HCTSKYLNNLIEQDHRHIK-------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxx
Y4551_YERPS     ----------
T431_STAAW      ----------
T431_STAAN      ----------
T431_STAAM      ----------
T431_STAA8      ----------
T257_STAAU      ----------