[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF53610.1

[Show Plain Result]


## Summary of Sequence Search
    1::211
    1::211     2e-89 100%  211 aa  RS5_CORGL RecName: Full=30S ribosomal protein S5;
    1::211     2e-89 100%  211 aa  RS5_CORGB RecName: Full=30S ribosomal protein S5;
    1::211     1e-87  98%  211 aa  RS5_COREF RecName: Full=30S ribosomal protein S5;
    1::208     2e-82  94%  208 aa  RS5_CORDI RecName: Full=30S ribosomal protein S5;
    1::212     2e-78  91%  212 aa  RS5_CORK4 RecName: Full=30S ribosomal protein S5;
    1::208     7e-74  88%  208 aa  RS5_CORA7 RecName: Full=30S ribosomal protein S5;
   43::198     8e-70  93%  213 aa  RS5_CORJK RecName: Full=30S ribosomal protein S5;
   44::198     9e-69  93%  213 aa  RS5_CORU7 RecName: Full=30S ribosomal protein S5;
    1::216     3e-68  86%  223 aa  RS5_RHOE4 RecName: Full=30S ribosomal protein S5;
    1::212     2e-67  82%  218 aa  RS5_RHOSR RecName: Full=30S ribosomal protein S5;
    1::212     2e-67  82%  218 aa  RS5_RHOOB RecName: Full=30S ribosomal protein S5;
   40::209     6e-65  82%  220 aa  RS5_MYCTU RecName: Full=30S ribosomal protein S5;
   40::209     6e-65  82%  220 aa  RS5_MYCTA RecName: Full=30S ribosomal protein S5;
   40::209     6e-65  82%  220 aa  RS5_MYCBT RecName: Full=30S ribosomal protein S5;
   40::209     6e-65  82%  220 aa  RS5_MYCBP RecName: Full=30S ribosomal protein S5;
   40::209     6e-65  82%  220 aa  RS5_MYCBO RecName: Full=30S ribosomal protein S5;
   34::196     9e-64  84%  214 aa  RS5_MYCS2 RecName: Full=30S ribosomal protein S5;
   42::203     9e-64  83%  222 aa  RS5_MYCGI RecName: Full=30S ribosomal protein S5;
   43::204     1e-63  84%  221 aa  RS5_MYCA9 RecName: Full=30S ribosomal protein S5;
   39::201     3e-63  83%  224 aa  RS5_MYCMM RecName: Full=30S ribosomal protein S5;
   42::204     4e-63  83%  224 aa  RS5_MYCPA RecName: Full=30S ribosomal protein S5;
   38::203     6e-63  80%  203 aa  RS5_SACEN RecName: Full=30S ribosomal protein S5;
   48::213     7e-63  77%  218 aa  RS5_KINRD RecName: Full=30S ribosomal protein S5;
    1::201     3e-62  82%  218 aa  RS5_NOCFA RecName: Full=30S ribosomal protein S5;
   30::192     7e-61  79%  205 aa  RS5_NOCSJ RecName: Full=30S ribosomal protein S5;
   34::197     2e-59  76%  202 aa  RS5_FRASN RecName: Full=30S ribosomal protein S5;
   34::197     2e-59  76%  202 aa  RS5_FRASC RecName: Full=30S ribosomal protein S5;
   34::197     2e-59  76%  202 aa  RS5_FRAAA RecName: Full=30S ribosomal protein S5;
   31::198     2e-59  77%  200 aa  RS5_THEFY RecName: Full=30S ribosomal protein S5;
   34::189     2e-59  78%  201 aa  RS5_STRCO RecName: Full=30S ribosomal protein S5;
   65::234     2e-58  75%  236 aa  RS5_ARTS2 RecName: Full=30S ribosomal protein S5;
   38::185     2e-58  84%  217 aa  RS5_MYCLE RecName: Full=30S ribosomal protein S5;
   38::185     2e-58  84%  217 aa  RS5_MYCLB RecName: Full=30S ribosomal protein S5;
   34::189     3e-58  78%  201 aa  RS5_STRGG RecName: Full=30S ribosomal protein S5;
   34::189     4e-58  78%  201 aa  RS5_STRAW RecName: Full=30S ribosomal protein S5;
   52::221     4e-58  75%  223 aa  RS5_ARTAT RecName: Full=30S ribosomal protein S5;
   48::210     1e-56  75%  232 aa  RS5_LEIXX RecName: Full=30S ribosomal protein S5;
   37::200     4e-55  74%  204 aa  RS5_SALTO RecName: Full=30S ribosomal protein S5;
   37::200     4e-55  74%  204 aa  RS5_SALAI RecName: Full=30S ribosomal protein S5;
   46::207     4e-55  73%  226 aa  RS5_BEUC1 RecName: Full=30S ribosomal protein S5;
   39::201     1e-54  75%  224 aa  RS5_MYCUA RecName: Full=30S ribosomal protein S5;
   30::195     3e-54  72%  199 aa  RS5_ACIC1 RecName: Full=30S ribosomal protein S5;
   52::214     9e-53  71%  225 aa  RS5_TROWT RecName: Full=30S ribosomal protein S5;
   52::214     9e-53  71%  225 aa  RS5_TROW8 RecName: Full=30S ribosomal protein S5;
   10::175     3e-52  70%  183 aa  RS5_MICLU RecName: Full=30S ribosomal protein S5;
   46::204     5e-51  71%  233 aa  RS5_BIFLO RecName: Full=30S ribosomal protein S5;
   56::214     5e-51  71%  243 aa  RS5_BIFLI RecName: Full=30S ribosomal protein S5;
   56::214     5e-51  71%  243 aa  RS5_BIFLD RecName: Full=30S ribosomal protein S5;
   53::210     3e-50  70%  241 aa  RS5_BIFAA RecName: Full=30S ribosomal protein S5;
   58::216     4e-50  70%  243 aa  RS5_BIFA0 RecName: Full=30S ribosomal protein S5;
   34::193     1e-49  69%  215 aa  RS5_PROAC RecName: Full=30S ribosomal protein S5;
   13::164     1e-44  59%  166 aa  RS5_PELTS RecName: Full=30S ribosomal protein S5;
   14::165     3e-44  60%  167 aa  RS5_LYSSC RecName: Full=30S ribosomal protein S5;
   13::164     6e-44  60%  166 aa  RS5_HELMI RecName: Full=30S ribosomal protein S5;
   13::164     1e-43  58%  166 aa  RS5_CLOTH RecName: Full=30S ribosomal protein S5;
   13::164     1e-43  59%  166 aa  RS5_BACHK RecName: Full=30S ribosomal protein S5;
   13::164     1e-43  59%  166 aa  RS5_BACCZ RecName: Full=30S ribosomal protein S5;
   14::165     1e-43  59%  167 aa  RS5_BACCR RecName: Full=30S ribosomal protein S5;
   13::164     1e-43  59%  166 aa  RS5_BACC1 RecName: Full=30S ribosomal protein S5;
   13::164     1e-43  59%  166 aa  RS5_BACAN RecName: Full=30S ribosomal protein S5;
   14::165     1e-43  59%  167 aa  RS5_BACAH RecName: Full=30S ribosomal protein S5;
   13::164     3e-43  59%  166 aa  RS5_GEOTN RecName: Full=30S ribosomal protein S5;
   13::164     3e-43  59%  166 aa  RS5_BACCN RecName: Full=30S ribosomal protein S5;
   13::164     4e-43  59%  166 aa  RS5_BACSK RecName: Full=30S ribosomal protein S5;
   13::166     5e-43  58%  167 aa  RS5_CARHZ RecName: Full=30S ribosomal protein S5;
   15::166     1e-42  56%  168 aa  RS5_BACLD RecName: Full=30S ribosomal protein S5;
   13::164     1e-42  57%  166 aa  RS5_BACHD RecName: Full=30S ribosomal protein S5;
   15::166     2e-42  56%  168 aa  RS5_BACA2 RecName: Full=30S ribosomal protein S5;
   13::164     4e-42  55%  166 aa  RS5_BACSU RecName: Full=30S ribosomal protein S5;       
   13::164     6e-42  53%  167 aa  RS5_SHIDS RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_SHISS RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_SHIFL RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_SHIF8 RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_SHIBS RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_SALTY RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_SALTI RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_SALPB RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_SALPA RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_SALCH RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_SALAR RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  166 aa  RS5_ERWCT RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_ECOUT RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_ECOLI RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_ECOLC RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_ECOL6 RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_ECOL5 RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_ECOK1 RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_ECOHS RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_ECO57 RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_ECO24 RecName: Full=30S ribosomal protein S5;
   13::164     7e-42  53%  167 aa  RS5_CITK8 RecName: Full=30S ribosomal protein S5;
   13::164     9e-42  57%  166 aa  RS5_DESHD RecName: Full=30S ribosomal protein S5;
   13::164     9e-42  55%  166 aa  RS5_BACP2 RecName: Full=30S ribosomal protein S5;
   14::165     1e-41  56%  167 aa  RS5_LISW6 RecName: Full=30S ribosomal protein S5;
   14::165     1e-41  56%  167 aa  RS5_LISMO RecName: Full=30S ribosomal protein S5;
   14::165     1e-41  56%  167 aa  RS5_LISMF RecName: Full=30S ribosomal protein S5;
   14::165     2e-41  56%  167 aa  RS5_LISIN RecName: Full=30S ribosomal protein S5;
   13::164     2e-41  57%  166 aa  RS5_ENTFA RecName: Full=30S ribosomal protein S5;
   13::164     2e-41  57%  166 aa  RS5_DESHY RecName: Full=30S ribosomal protein S5;
   13::164     3e-41  51%  167 aa  RS5_KLEP7 RecName: Full=30S ribosomal protein S5;
   13::164     3e-41  52%  166 aa  RS5_ENTS8 RecName: Full=30S ribosomal protein S5;
   13::164     3e-41  52%  166 aa  RS5_ENT38 RecName: Full=30S ribosomal protein S5;
   15::166     3e-41  55%  168 aa  RS5_ANATD RecName: Full=30S ribosomal protein S5;
   15::166     4e-41  55%  168 aa  RS5_CALS8 RecName: Full=30S ribosomal protein S5;
   13::164     8e-41  52%  166 aa  RS5_ACTP2 RecName: Full=30S ribosomal protein S5;
   13::164     1e-40  52%  166 aa  RS5_HAEDU RecName: Full=30S ribosomal protein S5;
   13::164     1e-40  55%  166 aa  RS5_DESRM RecName: Full=30S ribosomal protein S5;
   13::164     2e-40  51%  166 aa  RS5_ACTSZ RecName: Full=30S ribosomal protein S5;
   15::180     2e-40  65%  180 aa  RS5_ROSS1 RecName: Full=30S ribosomal protein S5;
   10::165     2e-40  50%  167 aa  RS5_BUCAP RecName: Full=30S ribosomal protein S5;
   13::164     3e-40  51%  166 aa  RS5_SODGM RecName: Full=30S ribosomal protein S5;
   13::164     3e-40  51%  166 aa  RS5_PASMU RecName: Full=30S ribosomal protein S5;
   14::165     3e-40  53%  167 aa  RS5_HALHL RecName: Full=30S ribosomal protein S5;
   13::164     3e-40  51%  166 aa  RS5_HAES2 RecName: Full=30S ribosomal protein S5;
   13::164     3e-40  51%  166 aa  RS5_HAES1 RecName: Full=30S ribosomal protein S5;
   13::164     3e-40  51%  166 aa  RS5_HAEIN RecName: Full=30S ribosomal protein S5;
   13::164     3e-40  51%  166 aa  RS5_HAEIG RecName: Full=30S ribosomal protein S5;
   13::164     3e-40  51%  166 aa  RS5_HAEIE RecName: Full=30S ribosomal protein S5;
   13::164     3e-40  51%  166 aa  RS5_HAEI8 RecName: Full=30S ribosomal protein S5;
   13::164     4e-40  51%  166 aa  RS5_TOLAT RecName: Full=30S ribosomal protein S5;
   14::165     4e-40  61%  167 aa  RS5_SHELP RecName: Full=30S ribosomal protein S5;
   15::166     4e-40  55%  168 aa  RS5_NATTJ RecName: Full=30S ribosomal protein S5;
   13::164     4e-40  51%  166 aa  RS5_MANSM RecName: Full=30S ribosomal protein S5;
   15::166     7e-40  61%  168 aa  RS5_SHEAM RecName: Full=30S ribosomal protein S5;
   14::173     7e-40  65%  173 aa  RS5_MYXXD RecName: Full=30S ribosomal protein S5;
   14::165     7e-40  51%  167 aa  RS5_BUCAI RecName: Full=30S ribosomal protein S5;
   15::169     7e-40  65%  169 aa  RS5_ANADE RecName: Full=30S ribosomal protein S5;
   19::188     9e-40  46%  188 aa  RS5_PARDP RecName: Full=30S ribosomal protein S5;
   13::164     2e-39  51%  167 aa  RS5_YERPS RecName: Full=30S ribosomal protein S5;
   13::164     2e-39  51%  167 aa  RS5_YERPP RecName: Full=30S ribosomal protein S5;
   13::164     2e-39  51%  167 aa  RS5_YERPN RecName: Full=30S ribosomal protein S5;
   13::164     2e-39  51%  167 aa  RS5_YERPE RecName: Full=30S ribosomal protein S5;
   13::164     2e-39  51%  167 aa  RS5_YERPA RecName: Full=30S ribosomal protein S5;
   13::164     2e-39  51%  167 aa  RS5_YERP3 RecName: Full=30S ribosomal protein S5;
   13::164     2e-39  51%  167 aa  RS5_YERE8 RecName: Full=30S ribosomal protein S5;
   13::164     2e-39  51%  166 aa  RS5_PHOLL RecName: Full=30S ribosomal protein S5;
   10::164     2e-39  49%  166 aa  RS5_ALTMD RecName: Full=30S ribosomal protein S5;
   19::172     2e-39  52%  175 aa  RS5_SALRD RecName: Full=30S ribosomal protein S5;
   17::169     2e-39  59%  171 aa  RS5_PSYCK RecName: Full=30S ribosomal protein S5;
   17::169     2e-39  59%  171 aa  RS5_PSYA2 RecName: Full=30S ribosomal protein S5;
   15::166     2e-39  51%  168 aa  RS5_PSEHT RecName: Full=30S ribosomal protein S5;
   13::164     3e-39  62%  166 aa  RS5_SYMTH RecName: Full=30S ribosomal protein S5;
   13::159     3e-39  57%  162 aa  RS5_GEOMG RecName: Full=30S ribosomal protein S5;
   13::164     3e-39  61%  166 aa  RS5_AERS4 RecName: Full=30S ribosomal protein S5;
   13::164     3e-39  61%  166 aa  RS5_AERHH RecName: Full=30S ribosomal protein S5;
   12::165     3e-39  58%  166 aa  RS5_PSEMY RecName: Full=30S ribosomal protein S5;
   14::165     3e-39  50%  167 aa  RS5_HAHCH RecName: Full=30S ribosomal protein S5;
   12::165     4e-39  58%  166 aa  RS5_AZOVD RecName: Full=30S ribosomal protein S5;
   11::163     4e-39  59%  165 aa  RS5_ACIBY RecName: Full=30S ribosomal protein S5;
   12::164     4e-39  59%  166 aa  RS5_ACIBT RecName: Full=30S ribosomal protein S5;
   11::163     4e-39  59%  165 aa  RS5_ACIBS RecName: Full=30S ribosomal protein S5;
   11::163     4e-39  59%  165 aa  RS5_ACIBC RecName: Full=30S ribosomal protein S5;
   11::163     4e-39  59%  165 aa  RS5_ACIB5 RecName: Full=30S ribosomal protein S5;
   11::163     4e-39  59%  165 aa  RS5_ACIB3 RecName: Full=30S ribosomal protein S5;
   14::166     6e-39  50%  167 aa  RS5_VIBVY RecName: Full=30S ribosomal protein S5;
   14::166     6e-39  50%  167 aa  RS5_VIBVU RecName: Full=30S ribosomal protein S5;
   14::166     6e-39  50%  167 aa  RS5_VIBPA RecName: Full=30S ribosomal protein S5;
   14::166     6e-39  50%  167 aa  RS5_VIBHB RecName: Full=30S ribosomal protein S5;
   14::165     6e-39  57%  167 aa  RS5_SHEB9 RecName: Full=30S ribosomal protein S5;
   14::165     6e-39  57%  167 aa  RS5_SHEB8 RecName: Full=30S ribosomal protein S5;
   14::165     6e-39  57%  167 aa  RS5_SHEB5 RecName: Full=30S ribosomal protein S5;
   14::165     6e-39  57%  167 aa  RS5_SHEB2 RecName: Full=30S ribosomal protein S5;
   13::164     6e-39  50%  167 aa  RS5_SERP5 RecName: Full=30S ribosomal protein S5;
   13::165     6e-39  48%  167 aa  RS5_PSEA6 RecName: Full=30S ribosomal protein S5;
   15::166     7e-39  64%  178 aa  RS5_CHLSY RecName: Full=30S ribosomal protein S5;
   15::166     7e-39  64%  179 aa  RS5_CHLAD RecName: Full=30S ribosomal protein S5;
   15::166     7e-39  64%  178 aa  RS5_CHLAA RecName: Full=30S ribosomal protein S5;
   10::164     1e-38  52%  166 aa  RS5_SYNFM RecName: Full=30S ribosomal protein S5;
   13::163     1e-38  55%  163 aa  RS5_PELCD RecName: Full=30S ribosomal protein S5;
   27::164     1e-38  59%  166 aa  RS5_MOOTA RecName: Full=30S ribosomal protein S5;
   18::169     1e-38  60%  172 aa  RS5_CYTH3 RecName: Full=30S ribosomal protein S5;
   25::177     1e-38  50%  180 aa  RS5_XANOR RecName: Full=30S ribosomal protein S5;
   25::177     1e-38  50%  180 aa  RS5_XANOP RecName: Full=30S ribosomal protein S5;
   25::177     1e-38  50%  180 aa  RS5_XANOM RecName: Full=30S ribosomal protein S5;
   25::177     1e-38  50%  180 aa  RS5_XANCP RecName: Full=30S ribosomal protein S5;
   25::177     1e-38  50%  180 aa  RS5_XANCB RecName: Full=30S ribosomal protein S5;
   25::177     1e-38  50%  180 aa  RS5_XANC8 RecName: Full=30S ribosomal protein S5;
   25::177     1e-38  50%  180 aa  RS5_XANC5 RecName: Full=30S ribosomal protein S5;
   25::177     1e-38  50%  180 aa  RS5_XANAC RecName: Full=30S ribosomal protein S5;
   12::163     1e-38  51%  165 aa  RS5_CLOAB RecName: Full=30S ribosomal protein S5;
   23::174     2e-38  49%  179 aa  RS5_XYLFM RecName: Full=30S ribosomal protein S5;
   13::165     2e-38  51%  166 aa  RS5_VIBSL RecName: Full=30S ribosomal protein S5;
   10::164     2e-38  50%  164 aa  RS5_SYNAS RecName: Full=30S ribosomal protein S5;
   14::165     2e-38  49%  167 aa  RS5_PSYIN RecName: Full=30S ribosomal protein S5;
   12::165     2e-38  58%  166 aa  RS5_PSEAE RecName: Full=30S ribosomal protein S5;
   12::165     2e-38  58%  166 aa  RS5_PSEAB RecName: Full=30S ribosomal protein S5;
   12::165     2e-38  58%  166 aa  RS5_PSEA8 RecName: Full=30S ribosomal protein S5;
   12::165     2e-38  58%  166 aa  RS5_PSEA7 RecName: Full=30S ribosomal protein S5;
   14::165     2e-38  60%  167 aa  RS5_ALCBS RecName: Full=30S ribosomal protein S5;
   23::172     2e-38  50%  179 aa  RS5_XYLFA RecName: Full=30S ribosomal protein S5;
   14::166     2e-38  50%  167 aa  RS5_VIBCM RecName: Full=30S ribosomal protein S5;
   14::166     2e-38  50%  167 aa  RS5_VIBCH RecName: Full=30S ribosomal protein S5;
   14::166     2e-38  50%  167 aa  RS5_VIBC3 RecName: Full=30S ribosomal protein S5;
   14::165     2e-38  57%  167 aa  RS5_SHESW RecName: Full=30S ribosomal protein S5;
   14::165     2e-38  59%  167 aa  RS5_SHESR RecName: Full=30S ribosomal protein S5;
   14::165     2e-38  59%  167 aa  RS5_SHESM RecName: Full=30S ribosomal protein S5;
   14::165     2e-38  59%  167 aa  RS5_SHESA RecName: Full=30S ribosomal protein S5;
   14::165     2e-38  57%  167 aa  RS5_SHEPC RecName: Full=30S ribosomal protein S5;
   14::165     2e-38  59%  167 aa  RS5_SHEON RecName: Full=30S ribosomal protein S5;
   12::165     2e-38  58%  166 aa  RS5_PSEE4 RecName: Full=30S ribosomal protein S5;
   10::164     2e-38  57%  166 aa  RS5_IDILO RecName: Full=30S ribosomal protein S5;
   13::165     2e-38  57%  166 aa  RS5_CHRSD RecName: Full=30S ribosomal protein S5;
   19::170     2e-38  55%  172 aa  RS5_BURS3 RecName: Full=30S ribosomal protein S5;
   19::170     2e-38  57%  172 aa  RS5_BURPS RecName: Full=30S ribosomal protein S5;
   19::170     2e-38  57%  172 aa  RS5_BURP6 RecName: Full=30S ribosomal protein S5;
   19::170     2e-38  57%  172 aa  RS5_BURP1 RecName: Full=30S ribosomal protein S5;
   19::170     2e-38  57%  172 aa  RS5_BURP0 RecName: Full=30S ribosomal protein S5;
   19::170     2e-38  57%  172 aa  RS5_BURMS RecName: Full=30S ribosomal protein S5;
   19::170     2e-38  57%  172 aa  RS5_BURMA RecName: Full=30S ribosomal protein S5;
   19::170     2e-38  57%  172 aa  RS5_BURM9 RecName: Full=30S ribosomal protein S5;
   19::170     2e-38  57%  172 aa  RS5_BURM7 RecName: Full=30S ribosomal protein S5;
   19::170     2e-38  57%  172 aa  RS5_BURM1 RecName: Full=30S ribosomal protein S5;
   19::170     2e-38  55%  172 aa  RS5_BURCJ RecName: Full=30S ribosomal protein S5;
   20::171     2e-38  55%  173 aa  RS5_BORPD RecName: Full=30S ribosomal protein S5;
   13::165     3e-38  54%  167 aa  RS5_THETN RecName: Full=30S ribosomal protein S5;
   14::165     3e-38  57%  167 aa  RS5_SHEFN RecName: Full=30S ribosomal protein S5;
   14::165     3e-38  57%  167 aa  RS5_SHEDO RecName: Full=30S ribosomal protein S5;
   14::166     3e-38  52%  167 aa  RS5_LACBA RecName: Full=30S ribosomal protein S5;
   18::169     3e-38  51%  172 aa  RS5_CHLP8 RecName: Full=30S ribosomal protein S5;
   19::170     3e-38  57%  172 aa  RS5_BURTA RecName: Full=30S ribosomal protein S5;
   19::170     4e-38  56%  172 aa  RS5_BURPP RecName: Full=30S ribosomal protein S5;
   25::177     5e-38  50%  180 aa  RS5_STRMK RecName: Full=30S ribosomal protein S5;
   25::177     5e-38  50%  180 aa  RS5_STRM5 RecName: Full=30S ribosomal protein S5;
   12::167     5e-38  49%  169 aa  RS5_COLP3 RecName: Full=30S ribosomal protein S5;
   19::170     5e-38  55%  172 aa  RS5_BURVG RecName: Full=30S ribosomal protein S5;
   19::170     5e-38  56%  172 aa  RS5_BURP8 RecName: Full=30S ribosomal protein S5;
   19::170     5e-38  55%  172 aa  RS5_BURCM RecName: Full=30S ribosomal protein S5;
   19::170     5e-38  55%  172 aa  RS5_BURCH RecName: Full=30S ribosomal protein S5;
   19::170     5e-38  55%  172 aa  RS5_BURCC RecName: Full=30S ribosomal protein S5;
   19::170     5e-38  55%  172 aa  RS5_BURCA RecName: Full=30S ribosomal protein S5;
   19::170     5e-38  55%  172 aa  RS5_BURA4 RecName: Full=30S ribosomal protein S5;
   20::171     5e-38  55%  173 aa  RS5_BORA1 RecName: Full=30S ribosomal protein S5;
   13::165     5e-38  49%  166 aa  RS5_ALISL RecName: Full=30S ribosomal protein S5;
   23::174     6e-38  49%  179 aa  RS5_XYLFT RecName: Full=30S ribosomal protein S5;
   23::174     6e-38  49%  179 aa  RS5_XYLF2 RecName: Full=30S ribosomal protein S5;
    8::159     6e-38  48%  163 aa  RS5_LAWIP RecName: Full=30S ribosomal protein S5;
   19::170     6e-38  55%  172 aa  RS5_BURXL RecName: Full=30S ribosomal protein S5;
   11::163     6e-38  58%  165 aa  RS5_ACIAD RecName: Full=30S ribosomal protein S5;
   15::169     8e-38  50%  171 aa  RS5_DESPS RecName: Full=30S ribosomal protein S5;
   21::172     8e-38  55%  174 aa  RS5_BORPE RecName: Full=30S ribosomal protein S5;
   21::172     8e-38  55%  174 aa  RS5_BORPA RecName: Full=30S ribosomal protein S5;
   21::172     8e-38  55%  174 aa  RS5_BORBR RecName: Full=30S ribosomal protein S5;
   12::163     1e-37  50%  165 aa  RS5_CLONN RecName: Full=30S ribosomal protein S5;
   18::169     1e-37  50%  172 aa  RS5_CHLTE RecName: Full=30S ribosomal protein S5;
   16::167     1e-37  51%  169 aa  RS5_ALKMQ RecName: Full=30S ribosomal protein S5;
   11::163     1e-37  58%  165 aa  RS5_PSYWF RecName: Full=30S ribosomal protein S5;
   12::165     1e-37  57%  166 aa  RS5_PSEU2 RecName: Full=30S ribosomal protein S5;
   12::165     1e-37  57%  166 aa  RS5_PSESM RecName: Full=30S ribosomal protein S5;
   12::165     1e-37  56%  166 aa  RS5_PSEF5 RecName: Full=30S ribosomal protein S5;
   12::163     1e-37  49%  165 aa  RS5_PHOPR RecName: Full=30S ribosomal protein S5;
   13::165     2e-37  53%  167 aa  RS5_THEPX RecName: Full=30S ribosomal protein S5;
   13::165     2e-37  53%  167 aa  RS5_THEP3 RecName: Full=30S ribosomal protein S5;
   15::166     2e-37  51%  168 aa  RS5_ALKOO RecName: Full=30S ribosomal protein S5;
    9::159     2e-37  48%  163 aa  RS5_DESVV RecName: Full=30S ribosomal protein S5;
    9::159     2e-37  48%  163 aa  RS5_DESVH RecName: Full=30S ribosomal protein S5;
   18::169     2e-37  49%  172 aa  RS5_CHLT3 RecName: Full=30S ribosomal protein S5;
   18::169     3e-37  53%  171 aa  RS5_THIDA RecName: Full=30S ribosomal protein S5;
   19::178     3e-37  47%  187 aa  RS5_SILST RecName: Full=30S ribosomal protein S5;
   12::166     3e-37  55%  166 aa  RS5_PSEU5 RecName: Full=30S ribosomal protein S5;
   12::165     3e-37  56%  166 aa  RS5_PSEPW RecName: Full=30S ribosomal protein S5;
   12::165     3e-37  56%  166 aa  RS5_PSEPK RecName: Full=30S ribosomal protein S5;
   12::165     3e-37  56%  166 aa  RS5_PSEPG RecName: Full=30S ribosomal protein S5;
   12::165     3e-37  56%  166 aa  RS5_PSEP1 RecName: Full=30S ribosomal protein S5;
   12::165     3e-37  57%  166 aa  RS5_PSE14 RecName: Full=30S ribosomal protein S5;
   13::164     3e-37  57%  166 aa  RS5_MARAV RecName: Full=30S ribosomal protein S5;
   21::180     3e-37  46%  197 aa  RS5_JANSC RecName: Full=30S ribosomal protein S5;
   12::165     4e-37  56%  166 aa  RS5_PSEFS RecName: Full=30S ribosomal protein S5;
   19::173     4e-37  58%  173 aa  RS5_DIAST RecName: Full=30S ribosomal protein S5;
   19::173     4e-37  57%  173 aa  RS5_DELAS RecName: Full=30S ribosomal protein S5;
   18::161     4e-37  53%  164 aa  RS5_BUCCC RecName: Full=30S ribosomal protein S5;
   19::173     4e-37  58%  173 aa  RS5_ACISJ RecName: Full=30S ribosomal protein S5;
    9::158     5e-37  50%  163 aa  RS5_DESAD RecName: Full=30S ribosomal protein S5;
   13::164     7e-37  48%  166 aa  RS5_WIGBR RecName: Full=30S ribosomal protein S5;
   12::165     7e-37  56%  166 aa  RS5_PSEPF RecName: Full=30S ribosomal protein S5;
   20::179     9e-37  46%  190 aa  RS5_SILPO RecName: Full=30S ribosomal protein S5;
   21::176     9e-37  47%  187 aa  RS5_RHOS5 RecName: Full=30S ribosomal protein S5;
   18::169     9e-37  50%  172 aa  RS5_CHLPB RecName: Full=30S ribosomal protein S5;
   21::176     1e-36  47%  187 aa  RS5_RHOSK RecName: Full=30S ribosomal protein S5;
   21::176     1e-36  47%  187 aa  RS5_RHOS4 RecName: Full=30S ribosomal protein S5;
   21::176     1e-36  47%  187 aa  RS5_RHOS1 RecName: Full=30S ribosomal protein S5;
   24::175     1e-36  55%  180 aa  RS5_NITMU RecName: Full=30S ribosomal protein S5;
   19::174     1e-36  46%  191 aa  RS5_DINSH RecName: Full=30S ribosomal protein S5;
    9::159     1e-36  47%  163 aa  RS5_DESVM RecName: Full=30S ribosomal protein S5;
   16::168     1e-36  57%  176 aa  RS5_ACIF5 RecName: Full=30S ribosomal protein S5;
   16::168     1e-36  57%  176 aa  RS5_ACIF2 RecName: Full=30S ribosomal protein S5;
   18::169     2e-36  48%  172 aa  RS5_PROVI RecName: Full=30S ribosomal protein S5;
   17::168     2e-36  48%  171 aa  RS5_PELLD RecName: Full=30S ribosomal protein S5;
   13::164     2e-36  49%  166 aa  RS5_LACSS RecName: Full=30S ribosomal protein S5;
    9::159     2e-36  48%  163 aa  RS5_DESDG RecName: Full=30S ribosomal protein S5;
   18::169     2e-36  49%  172 aa  RS5_CHLL2 RecName: Full=30S ribosomal protein S5;
   14::165     2e-36  47%  171 aa  RS5_BUCBP RecName: Full=30S ribosomal protein S5;
   13::165     2e-36  48%  167 aa  RS5_BAUCH RecName: Full=30S ribosomal protein S5;
   19::170     2e-36  54%  172 aa  RS5_RALSO RecName: Full=30S ribosomal protein S5;
   19::170     2e-36  55%  172 aa  RS5_RALPJ RecName: Full=30S ribosomal protein S5;
   12::163     2e-36  48%  165 aa  RS5_CLOPS RecName: Full=30S ribosomal protein S5;
   12::163     2e-36  48%  165 aa  RS5_CLOPE RecName: Full=30S ribosomal protein S5;
   12::163     2e-36  48%  165 aa  RS5_CLOP1 RecName: Full=30S ribosomal protein S5;
   18::169     3e-36  50%  172 aa  RS5_PROA2 RecName: Full=30S ribosomal protein S5;
   18::169     3e-36  49%  172 aa  RS5_PELPB RecName: Full=30S ribosomal protein S5;
   18::169     3e-36  49%  172 aa  RS5_CHLPD RecName: Full=30S ribosomal protein S5;
   16::167     5e-36  55%  169 aa  RS5_METFK RecName: Full=30S ribosomal protein S5;
   20::180     6e-36  48%  195 aa  RS5_PHEZH RecName: Full=30S ribosomal protein S5;
   17::169     6e-36  52%  169 aa  RS5_ACIBL RecName: Full=30S ribosomal protein S5;
   14::168     1e-35  61%  168 aa  RS5_ANADF RecName: Full=30S ribosomal protein S5;
   19::170     1e-35  58%  172 aa  RS5_VARPS RecName: Full=30S ribosomal protein S5;
   20::189     1e-35  43%  189 aa  RS5_SINMW RecName: Full=30S ribosomal protein S5;
   21::172     1e-35  59%  174 aa  RS5_RHOFD RecName: Full=30S ribosomal protein S5;
   20::189     1e-35  43%  189 aa  RS5_RHIME RecName: Full=30S ribosomal protein S5;
   19::170     1e-35  57%  172 aa  RS5_POLNA RecName: Full=30S ribosomal protein S5;
   17::167     1e-35  47%  185 aa  RS5_MESSB RecName: Full=30S ribosomal protein S5;
   20::177     2e-35  45%  191 aa  RS5_ROSDO RecName: Full=30S ribosomal protein S5;
   13::164     2e-35  45%  174 aa  RS5_BLOPB RecName: Full=30S ribosomal protein S5;
   10::164     2e-35  51%  166 aa  RS5_STACT RecName: Full=30S ribosomal protein S5;
   15::164     2e-35  52%  166 aa  RS5_STAAW RecName: Full=30S ribosomal protein S5;
   15::164     2e-35  52%  166 aa  RS5_STAAT RecName: Full=30S ribosomal protein S5;
   15::164     2e-35  52%  166 aa  RS5_STAAS RecName: Full=30S ribosomal protein S5;
   15::164     2e-35  52%  166 aa  RS5_STAAR RecName: Full=30S ribosomal protein S5;
   15::164     2e-35  52%  166 aa  RS5_STAAN RecName: Full=30S ribosomal protein S5;
   15::164     2e-35  52%  166 aa  RS5_STAAM RecName: Full=30S ribosomal protein S5;
   15::164     2e-35  52%  166 aa  RS5_STAAC RecName: Full=30S ribosomal protein S5;
   15::164     2e-35  52%  166 aa  RS5_STAAB RecName: Full=30S ribosomal protein S5;
   15::164     2e-35  52%  166 aa  RS5_STAA9 RecName: Full=30S ribosomal protein S5;
   15::164     2e-35  52%  166 aa  RS5_STAA8 RecName: Full=30S ribosomal protein S5;
   15::164     2e-35  52%  166 aa  RS5_STAA3 RecName: Full=30S ribosomal protein S5;
   15::164     2e-35  52%  166 aa  RS5_STAA2 RecName: Full=30S ribosomal protein S5;
   15::164     2e-35  52%  166 aa  RS5_STAA1 RecName: Full=30S ribosomal protein S5;
   18::169     2e-35  49%  172 aa  RS5_CHLCH RecName: Full=30S ribosomal protein S5;
   31::164     2e-35  57%  166 aa  RS5_ANOFW RecName: Full=30S ribosomal protein S5;
   15::163     3e-35  52%  163 aa  RS5_STAAE RecName: Full=30S ribosomal protein S5;
   19::170     3e-35  52%  172 aa  RS5_RALEJ RecName: Full=30S ribosomal protein S5;
   19::170     3e-35  57%  172 aa  RS5_POLSJ RecName: Full=30S ribosomal protein S5;
   16::168     3e-35  57%  177 aa  RS5_BLOFL RecName: Full=30S ribosomal protein S5;
   19::170     4e-35  51%  172 aa  RS5_POLSQ RecName: Full=30S ribosomal protein S5;
   23::177     4e-35  54%  177 aa  RS5_NITEU RecName: Full=30S ribosomal protein S5;
   19::170     4e-35  52%  172 aa  RS5_HERAR RecName: Full=30S ribosomal protein S5;
   20::189     4e-35  43%  189 aa  RS5_AGRT5 RecName: Full=30S ribosomal protein S5;
   10::165     5e-35  59%  167 aa  RS5_SYNWW RecName: Full=30S ribosomal protein S5;
   20::189     5e-35  43%  189 aa  RS5_RHISN RecName: Full=30S ribosomal protein S5;
   19::170     5e-35  52%  172 aa  RS5_RALEH RecName: Full=30S ribosomal protein S5;
   23::177     5e-35  50%  177 aa  RS5_NITEC RecName: Full=30S ribosomal protein S5;
   19::170     5e-35  52%  172 aa  RS5_CUPTR RecName: Full=30S ribosomal protein S5;
   15::166     5e-35  55%  168 aa  RS5_COXBU RecName: Full=30S ribosomal protein S5;
   29::189     5e-35  47%  201 aa  RS5_CAUCR RecName: Full=30S ribosomal protein S5;
   29::189     5e-35  47%  201 aa  RS5_CAUCN RecName: Full=30S ribosomal protein S5;
   19::170     5e-35  57%  172 aa  RS5_ACIAC RecName: Full=30S ribosomal protein S5;
   29::189     7e-35  47%  201 aa  RS5_CAUSK RecName: Full=30S ribosomal protein S5;
   14::163     9e-35  51%  165 aa  RS5_STAS1 RecName: Full=30S ribosomal protein S5;
   19::170     9e-35  52%  172 aa  RS5_RALME RecName: Full=30S ribosomal protein S5;
   32::189     9e-35  46%  201 aa  RS5_MARMM RecName: Full=30S ribosomal protein S5;
   52::164     9e-35  64%  166 aa  RS5_GEOSW RecName: Full=30S ribosomal protein S5;
   19::170     1e-34  52%  172 aa  RS5_JANMA RecName: Full=30S ribosomal protein S5;
   12::164     1e-34  50%  164 aa  RS5_STRSY RecName: Full=30S ribosomal protein S5;
   12::164     1e-34  50%  164 aa  RS5_STRS2 RecName: Full=30S ribosomal protein S5;
   15::164     1e-34  51%  166 aa  RS5_STAES RecName: Full=30S ribosomal protein S5;
   15::164     1e-34  51%  166 aa  RS5_STAEQ RecName: Full=30S ribosomal protein S5;
   15::181     1e-34  46%  196 aa  RS5_DEIRA RecName: Full=30S ribosomal protein S5;
   20::189     1e-34  43%  189 aa  RS5_AGRVS RecName: Full=30S ribosomal protein S5;
   15::164     2e-34  51%  166 aa  RS5_STAHJ RecName: Full=30S ribosomal protein S5;
   52::164     2e-34  63%  166 aa  RS5_GEOKA RecName: Full=30S ribosomal protein S5;
   52::164     2e-34  63%  166 aa  RS5_BACST RecName: Full=30S ribosomal protein S5;       
   18::178     3e-34  46%  192 aa  RS5_METPB RecName: Full=30S ribosomal protein S5;
   18::178     3e-34  46%  192 aa  RS5_METEP RecName: Full=30S ribosomal protein S5;
   18::178     3e-34  46%  192 aa  RS5_METC4 RecName: Full=30S ribosomal protein S5;
   12::165     3e-34  55%  168 aa  RS5_LEGPL RecName: Full=30S ribosomal protein S5;
   12::165     3e-34  55%  168 aa  RS5_LEGPH RecName: Full=30S ribosomal protein S5;
   12::165     3e-34  55%  168 aa  RS5_LEGPC RecName: Full=30S ribosomal protein S5;
   12::165     3e-34  55%  168 aa  RS5_LEGPA RecName: Full=30S ribosomal protein S5;
   14::163     3e-34  49%  177 aa  RS5_DEIGD RecName: Full=30S ribosomal protein S5;
   12::163     4e-34  47%  165 aa  RS5_CLOBL RecName: Full=30S ribosomal protein S5;
   12::163     4e-34  47%  165 aa  RS5_CLOBH RecName: Full=30S ribosomal protein S5;
   12::163     4e-34  47%  165 aa  RS5_CLOB1 RecName: Full=30S ribosomal protein S5;
   21::172     4e-34  53%  174 aa  RS5_AZOSE RecName: Full=30S ribosomal protein S5;
   11::166     6e-34  51%  171 aa  RS5_DICNV RecName: Full=30S ribosomal protein S5;
   22::173     7e-34  51%  175 aa  RS5_DECAR RecName: Full=30S ribosomal protein S5;
   14::166     7e-34  50%  172 aa  RS5_CHRVO RecName: Full=30S ribosomal protein S5;
   16::170     1e-33  43%  172 aa  RS5_TREPS RecName: Full=30S ribosomal protein S5;
   16::170     1e-33  43%  172 aa  RS5_TREPA RecName: Full=30S ribosomal protein S5;
   22::189     1e-33  43%  189 aa  RS5_RHILW RecName: Full=30S ribosomal protein S5;
   22::189     1e-33  43%  189 aa  RS5_RHIL3 RecName: Full=30S ribosomal protein S5;
   22::189     1e-33  43%  189 aa  RS5_RHIEC RecName: Full=30S ribosomal protein S5;
   22::189     1e-33  43%  189 aa  RS5_RHIE6 RecName: Full=30S ribosomal protein S5;
   21::181     1e-33  46%  195 aa  RS5_METRJ RecName: Full=30S ribosomal protein S5;
   16::165     1e-33  47%  176 aa  RS5_DEIDV RecName: Full=30S ribosomal protein S5;
   28::165     4e-33  49%  167 aa  RS5_OCEIH RecName: Full=30S ribosomal protein S5;
   14::166     4e-33  52%  172 aa  RS5_NEIMF RecName: Full=30S ribosomal protein S5;
   14::166     4e-33  52%  172 aa  RS5_NEIMB RecName: Full=30S ribosomal protein S5;
   14::166     4e-33  52%  172 aa  RS5_NEIMA RecName: Full=30S ribosomal protein S5;
   14::166     4e-33  52%  172 aa  RS5_NEIM0 RecName: Full=30S ribosomal protein S5;
   14::166     4e-33  52%  172 aa  RS5_NEIG1 RecName: Full=30S ribosomal protein S5;
   29::186     4e-33  50%  200 aa  RS5_HYPNA RecName: Full=30S ribosomal protein S5;
   23::180     4e-33  46%  192 aa  RS5_GLUDA RecName: Full=30S ribosomal protein S5;
   18::169     5e-33  45%  172 aa  RS5_BACTN RecName: Full=30S ribosomal protein S5;
   12::164     6e-33  48%  164 aa  RS5_STRGC RecName: Full=30S ribosomal protein S5;
   12::164     6e-33  49%  164 aa  RS5_STRA5 RecName: Full=30S ribosomal protein S5;
   12::164     6e-33  49%  164 aa  RS5_STRA3 RecName: Full=30S ribosomal protein S5;
   12::164     6e-33  49%  164 aa  RS5_STRA1 RecName: Full=30S ribosomal protein S5;
   22::169     6e-33  47%  187 aa  RS5_RHILO RecName: Full=30S ribosomal protein S5;
    8::145     1e-32  51%  147 aa  RS5_NITSB RecName: Full=30S ribosomal protein S5;
   12::164     1e-32  48%  164 aa  RS5_STRSV RecName: Full=30S ribosomal protein S5;
   15::169     1e-32  49%  170 aa  RS5_LARHH RecName: Full=30S ribosomal protein S5;
   26::189     1e-32  43%  189 aa  RS5_HYDS0 RecName: Full=30S ribosomal protein S5;
    8::145     1e-32  51%  147 aa  RS5_CAMJR RecName: Full=30S ribosomal protein S5;
    8::145     1e-32  51%  147 aa  RS5_CAMJJ RecName: Full=30S ribosomal protein S5;
    8::145     1e-32  51%  147 aa  RS5_CAMJE RecName: Full=30S ribosomal protein S5;
    8::145     1e-32  51%  147 aa  RS5_CAMJD RecName: Full=30S ribosomal protein S5;
    8::145     1e-32  51%  147 aa  RS5_CAMJ8 RecName: Full=30S ribosomal protein S5;
    7::144     2e-32  61%  146 aa  RS5_WOLSU RecName: Full=30S ribosomal protein S5;
   11::161     2e-32  47%  165 aa  RS5_BORBU RecName: Full=30S ribosomal protein S5;
   18::169     2e-32  45%  172 aa  RS5_BACFR RecName: Full=30S ribosomal protein S5;
   18::169     2e-32  45%  172 aa  RS5_BACFN RecName: Full=30S ribosomal protein S5;
    8::145     3e-32  50%  147 aa  RS5_CAMFF RecName: Full=30S ribosomal protein S5;
   12::164     5e-32  48%  164 aa  RS5_STRPM RecName: Full=30S ribosomal protein S5;
   12::164     5e-32  48%  164 aa  RS5_STRPG RecName: Full=30S ribosomal protein S5;
   12::164     5e-32  48%  164 aa  RS5_STRPF RecName: Full=30S ribosomal protein S5;
   12::164     5e-32  48%  164 aa  RS5_STRPD RecName: Full=30S ribosomal protein S5;
   12::164     5e-32  48%  164 aa  RS5_STRPC RecName: Full=30S ribosomal protein S5;
   12::164     5e-32  48%  164 aa  RS5_STRPB RecName: Full=30S ribosomal protein S5;
   12::164     5e-32  48%  164 aa  RS5_STRP8 RecName: Full=30S ribosomal protein S5;
   12::164     5e-32  48%  164 aa  RS5_STRP6 RecName: Full=30S ribosomal protein S5;
   12::164     5e-32  48%  164 aa  RS5_STRP3 RecName: Full=30S ribosomal protein S5;
   12::164     5e-32  48%  164 aa  RS5_STRP1 RecName: Full=30S ribosomal protein S5;
    7::144     5e-32  49%  146 aa  RS5_CAMHC RecName: Full=30S ribosomal protein S5;
   13::164     5e-32  44%  166 aa  RS5_BUCAK RecName: Full=30S ribosomal protein S5;
   17::168     7e-32  55%  176 aa  RS5_THEM4 RecName: Full=30S ribosomal protein S5;
   17::168     7e-32  55%  176 aa  RS5_THEAB RecName: Full=30S ribosomal protein S5;
   10::144     7e-32  51%  146 aa  RS5_SULDN RecName: Full=30S ribosomal protein S5;
   17::169     7e-32  48%  169 aa  RS5_SOLUE RecName: Full=30S ribosomal protein S5;
   30::185     7e-32  42%  199 aa  RS5_RHORT RecName: Full=30S ribosomal protein S5;
   16::167     7e-32  47%  170 aa  RS5_PARD8 RecName: Full=30S ribosomal protein S5;
   24::178     7e-32  46%  192 aa  RS5_METS4 RecName: Full=30S ribosomal protein S5;
    7::144     7e-32  60%  146 aa  RS5_HELHP RecName: Full=30S ribosomal protein S5;
   13::161     7e-32  49%  162 aa  RS5_GEOSL RecName: Full=30S ribosomal protein S5;
    8::145     7e-32  59%  147 aa  RS5_CAMC5 RecName: Full=30S ribosomal protein S5;
   23::150     9e-32  52%  152 aa  RS5_SULNB RecName: Full=30S ribosomal protein S5;
   17::166     9e-32  48%  167 aa  RS5_PARUW RecName: Full=30S ribosomal protein S5;
   24::168     9e-32  49%  191 aa  RS5_METNO RecName: Full=30S ribosomal protein S5;
   13::165     2e-31  43%  166 aa  RS5_VIBFM RecName: Full=30S ribosomal protein S5;
   13::165     2e-31  43%  166 aa  RS5_VIBF1 RecName: Full=30S ribosomal protein S5;
   11::158     2e-31  47%  166 aa  RS5_BORGA RecName: Full=30S ribosomal protein S5;
   11::161     2e-31  46%  165 aa  RS5_BORAP RecName: Full=30S ribosomal protein S5;
    4::152     2e-31  44%  162 aa  RS5_THETH RecName: Full=30S ribosomal protein S5;
    4::152     2e-31  44%  162 aa  RS5_THET8 RecName: Full=30S ribosomal protein S5;
    4::152     2e-31  44%  162 aa  RS5_THET2 RecName: Full=30S ribosomal protein S5;
    8::145     2e-31  59%  147 aa  RS5_CAMC1 RecName: Full=30S ribosomal protein S5;
   18::164     3e-31  46%  168 aa  RS5_LEPBL RecName: Full=30S ribosomal protein S5;
   18::164     3e-31  46%  168 aa  RS5_LEPBJ RecName: Full=30S ribosomal protein S5;
   12::169     3e-31  44%  170 aa  RS5_PELUB RecName: Full=30S ribosomal protein S5;
   37::183     3e-31  46%  187 aa  RS5_LEPIN RecName: Full=30S ribosomal protein S5;
   37::183     3e-31  46%  187 aa  RS5_LEPIC RecName: Full=30S ribosomal protein S5;
   10::144     3e-31  49%  146 aa  RS5_ARCB4 RecName: Full=30S ribosomal protein S5;
    8::145     4e-31  59%  147 aa  RS5_HELPY RecName: Full=30S ribosomal protein S5;
   14::151     4e-31  59%  153 aa  RS5_HELPS RecName: Full=30S ribosomal protein S5;
    8::145     4e-31  59%  147 aa  RS5_HELPJ RecName: Full=30S ribosomal protein S5;
   14::151     4e-31  59%  153 aa  RS5_HELPH RecName: Full=30S ribosomal protein S5;
   14::151     4e-31  59%  153 aa  RS5_HELP2 RecName: Full=30S ribosomal protein S5;
   20::171     6e-31  44%  174 aa  RS5_FLAPJ RecName: Full=30S ribosomal protein S5;
   13::164     7e-31  53%  166 aa  RS5_ALHEH RecName: Full=30S ribosomal protein S5;
   32::166     3e-30  56%  170 aa  RS5_NITOC RecName: Full=30S ribosomal protein S5;
   13::161     5e-30  57%  162 aa  RS5_PELPD RecName: Full=30S ribosomal protein S5;
   14::166     5e-30  44%  167 aa  RS5_PEDPA RecName: Full=30S ribosomal protein S5;
   12::164     6e-30  46%  164 aa  RS5_STRMU RecName: Full=30S ribosomal protein S5;
   13::159     6e-30  47%  162 aa  RS5_GEOLS RecName: Full=30S ribosomal protein S5;
   34::167     6e-30  48%  169 aa  RS5_CLOD6 RecName: Full=30S ribosomal protein S5;
   73::229     1e-29  51%  231 aa  RS5_MYCAP RecName: Full=30S ribosomal protein S5;
   13::148     1e-29  53%  152 aa  RS5_BDEBA RecName: Full=30S ribosomal protein S5;
   17::171     2e-29  42%  173 aa  RS5_TREDE RecName: Full=30S ribosomal protein S5;
   23::176     2e-29  44%  189 aa  RS5_ACICJ RecName: Full=30S ribosomal protein S5;
   33::167     2e-29  46%  169 aa  RS5_METCA RecName: Full=30S ribosomal protein S5;
   13::165     2e-29  44%  166 aa  RS5_LACPL RecName: Full=30S ribosomal protein S5;
   12::164     4e-29  45%  164 aa  RS5_STRTD RecName: Full=30S ribosomal protein S5;
   12::164     4e-29  45%  164 aa  RS5_STRT2 RecName: Full=30S ribosomal protein S5;
   12::164     4e-29  45%  164 aa  RS5_STRT1 RecName: Full=30S ribosomal protein S5;
   21::186     4e-29  44%  186 aa  RS5_PARL1 RecName: Full=30S ribosomal protein S5;
   71::227     4e-29  51%  229 aa  RS5_MYCPU RecName: Full=30S ribosomal protein S5;
   27::170     7e-29  52%  176 aa  RS5_FERNB RecName: Full=30S ribosomal protein S5;
   19::170     9e-29  51%  172 aa  RS5_VEREI RecName: Full=30S ribosomal protein S5;
   58::213     1e-28  41%  233 aa  RS5_ZYMMO RecName: Full=30S ribosomal protein S5;
   20::181     1e-28  40%  190 aa  RS5_RHOPB RecName: Full=30S ribosomal protein S5;
   14::159     1e-28  46%  167 aa  RS5_LACC3 RecName: Full=30S ribosomal protein S5;
   19::163     1e-28  44%  168 aa  RS5_LACAC RecName: Full=30S ribosomal protein S5;
   20::184     1e-28  43%  190 aa  RS5_GRABC RecName: Full=30S ribosomal protein S5;
   20::181     2e-28  40%  190 aa  RS5_RHOP5 RecName: Full=30S ribosomal protein S5;
   22::171     2e-28  42%  189 aa  RS5_BARBK RecName: Full=30S ribosomal protein S5;
   20::168     2e-28  42%  186 aa  RS5_OCHA4 RecName: Full=30S ribosomal protein S5;
   13::165     2e-28  42%  166 aa  RS5_LACS1 RecName: Full=30S ribosomal protein S5;
   20::168     2e-28  42%  186 aa  RS5_BRUSU RecName: Full=30S ribosomal protein S5;
   20::168     2e-28  42%  186 aa  RS5_BRUSI RecName: Full=30S ribosomal protein S5;
   20::168     2e-28  42%  186 aa  RS5_BRUO2 RecName: Full=30S ribosomal protein S5;
   20::168     2e-28  42%  186 aa  RS5_BRUME RecName: Full=30S ribosomal protein S5;
   20::168     2e-28  42%  186 aa  RS5_BRUMB RecName: Full=30S ribosomal protein S5;
   20::168     2e-28  42%  186 aa  RS5_BRUC2 RecName: Full=30S ribosomal protein S5;
   20::168     2e-28  42%  186 aa  RS5_BRUAB RecName: Full=30S ribosomal protein S5;
   20::168     2e-28  42%  186 aa  RS5_BRUA2 RecName: Full=30S ribosomal protein S5;
   20::168     2e-28  42%  186 aa  RS5_BRUA1 RecName: Full=30S ribosomal protein S5;
   14::164     2e-28  40%  182 aa  RS5_BART1 RecName: Full=30S ribosomal protein S5;
   16::168     3e-28  42%  169 aa  RS5_LACRD RecName: Full=30S ribosomal protein S5;
   19::159     3e-28  45%  168 aa  RS5_LACH4 RecName: Full=30S ribosomal protein S5;
   46::195     3e-28  55%  200 aa  RS5_RUBXD RecName: Full=30S ribosomal protein S5;
   19::170     3e-28  49%  172 aa  RS5_METPP RecName: Full=30S ribosomal protein S5;
   12::163     3e-28  44%  165 aa  RS5_CHLFF RecName: Full=30S ribosomal protein S5;
   31::166     5e-28  47%  171 aa  RS5_PHYAS RecName: Full=30S ribosomal protein S5;
   92::247     5e-28  42%  248 aa  RS5_MYCS5 RecName: Full=30S ribosomal protein S5;
   39::199     5e-28  39%  210 aa  RS5_MAGSA RecName: Full=30S ribosomal protein S5;
   12::163     5e-28  43%  165 aa  RS5_CHLAB RecName: Full=30S ribosomal protein S5;
   16::164     5e-28  41%  182 aa  RS5_BARHE RecName: Full=30S ribosomal protein S5;
   21::172     8e-28  48%  174 aa  RS5_AZOSB RecName: Full=30S ribosomal protein S5;
   15::167     1e-27  43%  168 aa  RS5_LEUMM RecName: Full=30S ribosomal protein S5;
   12::165     1e-27  43%  165 aa  RS5_CHLPN RecName: Full=30S ribosomal protein S5;
   15::168     1e-27  40%  172 aa  RS5_RUTMC RecName: Full=30S ribosomal protein S5;
   18::169     1e-27  42%  172 aa  RS5_PORGI RecName: Full=30S ribosomal protein S5;
   88::243     1e-27  51%  243 aa  RS5_MYCMO RecName: Full=30S ribosomal protein S5;
   22::174     1e-27  42%  174 aa  RS5_LACJO RecName: Full=30S ribosomal protein S5;
   22::174     1e-27  42%  174 aa  RS5_LACGA RecName: Full=30S ribosomal protein S5;
   27::188     1e-27  40%  197 aa  RS5_BRAJA RecName: Full=30S ribosomal protein S5;
   17::176     1e-27  42%  177 aa  RS5_ACAM1 RecName: Full=30S ribosomal protein S5;
   18::176     2e-27  41%  185 aa  RS5_XANP2 RecName: Full=30S ribosomal protein S5;
   28::189     2e-27  42%  194 aa  RS5_SULSY RecName: Full=30S ribosomal protein S5;
   52::208     2e-27  40%  210 aa  RS5_PROM3 RecName: Full=30S ribosomal protein S5;
   36::181     2e-27  42%  208 aa  RS5_AQUAE RecName: Full=30S ribosomal protein S5;
   24::168     2e-27  43%  178 aa  RS5_THENN RecName: Full=30S ribosomal protein S5;
   57::213     2e-27  40%  215 aa  RS5_SYNPW RecName: Full=30S ribosomal protein S5;
   23::182     2e-27  40%  191 aa  RS5_RHOPS RecName: Full=30S ribosomal protein S5;
   23::182     2e-27  40%  191 aa  RS5_NITWN RecName: Full=30S ribosomal protein S5;
   16::164     2e-27  40%  182 aa  RS5_BARQU RecName: Full=30S ribosomal protein S5;
   51::207     3e-27  40%  209 aa  RS5_PROMM RecName: Full=30S ribosomal protein S5;
   15::165     3e-27  42%  165 aa  RS5_OENOB RecName: Full=30S ribosomal protein S5;
   19::170     3e-27  48%  172 aa  RS5_LEPCP RecName: Full=30S ribosomal protein S5;
   23::182     4e-27  40%  191 aa  RS5_RHOP2 RecName: Full=30S ribosomal protein S5;
   22::183     4e-27  39%  192 aa  RS5_OLICO RecName: Full=30S ribosomal protein S5;
   12::163     4e-27  42%  165 aa  RS5_CHLCV RecName: Full=30S ribosomal protein S5;
   18::176     4e-27  40%  185 aa  RS5_AZOC5 RecName: Full=30S ribosomal protein S5;
   20::181     5e-27  39%  190 aa  RS5_NITHX RecName: Full=30S ribosomal protein S5;
   54::166     7e-27  46%  169 aa  RS5_THICR RecName: Full=30S ribosomal protein S5;
   23::182     9e-27  40%  191 aa  RS5_RHOPT RecName: Full=30S ribosomal protein S5;
   23::182     9e-27  40%  191 aa  RS5_RHOPA RecName: Full=30S ribosomal protein S5;AltName:
   18::162     9e-27  43%  170 aa  RS5_LACDB RecName: Full=30S ribosomal protein S5;
   18::162     9e-27  43%  170 aa  RS5_LACDA RecName: Full=30S ribosomal protein S5;
   12::167     1e-26  38%  171 aa  RS5_VESOH RecName: Full=30S ribosomal protein S5;
   12::160     1e-26  42%  165 aa  RS5_CHLTR RecName: Full=30S ribosomal protein S5;
   12::160     1e-26  42%  165 aa  RS5_CHLTA RecName: Full=30S ribosomal protein S5;
   12::160     1e-26  42%  165 aa  RS5_CHLMU RecName: Full=30S ribosomal protein S5;
   18::179     1e-26  39%  189 aa  RS5_BEII9 RecName: Full=30S ribosomal protein S5;
   13::166     1e-26  41%  175 aa  RS5_RICTY RecName: Full=30S ribosomal protein S5;
   46::180     2e-26  45%  194 aa  RS5_PERMH RecName: Full=30S ribosomal protein S5;
   18::167     2e-26  42%  189 aa  RS5_METSB RecName: Full=30S ribosomal protein S5;
   12::168     2e-26  42%  168 aa  RS5_LACLS RecName: Full=30S ribosomal protein S5;
   10::164     2e-26  46%  166 aa  RS5_FRATW RecName: Full=30S ribosomal protein S5;
   10::164     2e-26  46%  166 aa  RS5_FRATT RecName: Full=30S ribosomal protein S5;
   10::164     2e-26  46%  166 aa  RS5_FRATO RecName: Full=30S ribosomal protein S5;
   10::164     2e-26  46%  166 aa  RS5_FRATN RecName: Full=30S ribosomal protein S5;
   10::164     2e-26  46%  166 aa  RS5_FRATF RecName: Full=30S ribosomal protein S5;
   10::164     2e-26  46%  166 aa  RS5_FRAT1 RecName: Full=30S ribosomal protein S5;
   12::168     3e-26  42%  168 aa  RS5_LACLA RecName: Full=30S ribosomal protein S5;
   22::175     3e-26  40%  191 aa  RS5_GLUOX RecName: Full=30S ribosomal protein S5;
   24::168     4e-26  42%  178 aa  RS5_THEMA RecName: Full=30S ribosomal protein S5;
   12::168     4e-26  42%  168 aa  RS5_LACLM RecName: Full=30S ribosomal protein S5;
   10::164     4e-26  46%  166 aa  RS5_FRATH RecName: Full=30S ribosomal protein S5;
   17::168     4e-26  41%  171 aa  RS5_BACV8 RecName: Full=30S ribosomal protein S5;
   13::165     6e-26  41%  176 aa  RS5_RICBR RecName: Full=30S ribosomal protein S5;
   17::173     6e-26  38%  177 aa  RS5_MAGSM RecName: Full=30S ribosomal protein S5;
   20::171     7e-26  40%  174 aa  RS5_GRAFK RecName: Full=30S ribosomal protein S5;
   24::168     9e-26  41%  178 aa  RS5_THESQ RecName: Full=30S ribosomal protein S5;
   24::168     9e-26  41%  178 aa  RS5_THEP1 RecName: Full=30S ribosomal protein S5;
   13::166     9e-26  40%  175 aa  RS5_RICPR RecName: Full=30S ribosomal protein S5;
   13::166     9e-26  40%  176 aa  RS5_RICFE RecName: Full=30S ribosomal protein S5;
   13::166     9e-26  40%  176 aa  RS5_RICAH RecName: Full=30S ribosomal protein S5;
   22::181     9e-26  38%  190 aa  RS5_BRASO RecName: Full=30S ribosomal protein S5;
   22::181     9e-26  38%  190 aa  RS5_BRASB RecName: Full=30S ribosomal protein S5;
   24::173     1e-25  38%  179 aa  RR5_THAPS RecName: Full=30S ribosomal protein S5, chloroplastic;
   13::165     2e-25  39%  176 aa  RS5_RICM5 RecName: Full=30S ribosomal protein S5;
   80::232     2e-25  38%  234 aa  RS5_MYCPE RecName: Full=30S ribosomal protein S5;
   19::171     2e-25  39%  173 aa  RS5_SYNY3 RecName: Full=30S ribosomal protein S5;
   48::204     2e-25  49%  206 aa  RS5_PROMS RecName: Full=30S ribosomal protein S5;
   13::166     3e-25  39%  172 aa  RS5_RICCK RecName: Full=30S ribosomal protein S5;
   49::205     3e-25  49%  207 aa  RS5_PROM9 RecName: Full=30S ribosomal protein S5;
   48::204     3e-25  49%  206 aa  RS5_PROM2 RecName: Full=30S ribosomal protein S5;
   19::171     3e-25  51%  173 aa  RS5_MICAN RecName: Full=30S ribosomal protein S5;
   13::166     5e-25  39%  176 aa  RS5_RICRS RecName: Full=30S ribosomal protein S5;
   13::166     5e-25  39%  176 aa  RS5_RICRO RecName: Full=30S ribosomal protein S5;
   13::166     5e-25  39%  176 aa  RS5_RICPU RecName: Full=30S ribosomal protein S5;
  111::264     5e-25  39%  284 aa  RS5_ERYLH RecName: Full=30S ribosomal protein S5;
   13::166     6e-25  39%  176 aa  RS5_RICCN RecName: Full=30S ribosomal protein S5;
   13::166     6e-25  39%  176 aa  RS5_RICAE RecName: Full=30S ribosomal protein S5;
   48::204     6e-25  48%  206 aa  RS5_PROMP RecName: Full=30S ribosomal protein S5;
   48::204     6e-25  49%  206 aa  RS5_PROM0 RecName: Full=30S ribosomal protein S5;
   47::203     8e-25  40%  203 aa  RS5_UREU1 RecName: Full=30S ribosomal protein S5;
   47::203     8e-25  40%  203 aa  RS5_UREPA RecName: Full=30S ribosomal protein S5;
   47::203     8e-25  40%  203 aa  RS5_UREP2 RecName: Full=30S ribosomal protein S5;
   22::177     8e-25  37%  177 aa  RS5_RHOBA RecName: Full=30S ribosomal protein S5;
   17::166     8e-25  43%  171 aa  RS5_ONYPE RecName: Full=30S ribosomal protein S5;
   31::177     8e-25  44%  185 aa  RS5_AYWBP RecName: Full=30S ribosomal protein S5;
   57::151     1e-24  54%  153 aa  RS5_HELAH RecName: Full=30S ribosomal protein S5;
   19::171     1e-24  39%  173 aa  RS5_CYAP7 RecName: Full=30S ribosomal protein S5;
   28::171     2e-24  49%  178 aa  RS5_THELT RecName: Full=30S ribosomal protein S5;
   57::213     2e-24  47%  215 aa  RS5_SYNS9 RecName: Full=30S ribosomal protein S5;
   54::206     2e-24  49%  208 aa  RS5_PROMT RecName: Full=30S ribosomal protein S5;
   57::209     2e-24  49%  211 aa  RS5_PROMA RecName: Full=30S ribosomal protein S5;
   54::206     2e-24  49%  208 aa  RS5_PROM1 RecName: Full=30S ribosomal protein S5;
   56::212     3e-24  47%  214 aa  RS5_SYNSC RecName: Full=30S ribosomal protein S5;
   57::213     3e-24  47%  215 aa  RS5_SYNPX RecName: Full=30S ribosomal protein S5;
   48::204     3e-24  47%  206 aa  RS5_PROM5 RecName: Full=30S ribosomal protein S5;
   70::226     3e-24  36%  226 aa  RS5_MYCGA RecName: Full=30S ribosomal protein S5;
   19::171     5e-24  45%  173 aa  RS5_SYNP2 RecName: Full=30S ribosomal protein S5;
   24::173     5e-24  46%  185 aa  RR5_ODOSI RecName: Full=30S ribosomal protein S5, chloroplastic;
   58::171     9e-24  46%  174 aa  RR5_PORYE RecName: Full=30S ribosomal protein S5, chloroplastic;
   58::171     9e-24  46%  174 aa  RR5_PORPU RecName: Full=30S ribosomal protein S5, chloroplastic;
   19::171     1e-23  49%  173 aa  RS5_CYAP8 RecName: Full=30S ribosomal protein S5;
    7::162     3e-23  45%  164 aa  RS5_FUSNN RecName: Full=30S ribosomal protein S5;
   26::164     3e-23  42%  164 aa  RS5_STRR6 RecName: Full=30S ribosomal protein S5;
   26::164     3e-23  42%  164 aa  RS5_STRPN RecName: Full=30S ribosomal protein S5;
   26::164     3e-23  42%  164 aa  RS5_STRP2 RecName: Full=30S ribosomal protein S5;
   64::220     4e-23  48%  223 aa  RS5_GLOVI RecName: Full=30S ribosomal protein S5;
   17::169     4e-23  36%  172 aa  RS5_DEHE1 RecName: Full=30S ribosomal protein S5;
   17::169     6e-23  35%  172 aa  RS5_DEHSC RecName: Full=30S ribosomal protein S5;
   19::169     6e-23  39%  169 aa  RR5_CYAPA RecName: Full=30S ribosomal protein S5, cyanelle;
    8::162     1e-22  38%  172 aa  RS5_ORITB RecName: Full=30S ribosomal protein S5;
   56::211     1e-22  42%  211 aa  RS5_MYCGE RecName: Full=30S ribosomal protein S5;
   64::200     1e-22  51%  254 aa  RS5_MYCMS RecName: Full=30S ribosomal protein S5;
   67::222     2e-22  36%  242 aa  RS5_SPHAL RecName: Full=30S ribosomal protein S5;
   61::198     2e-22  50%  250 aa  RS5_MYCCT RecName: Full=30S ribosomal protein S5;
   27::173     2e-22  42%  176 aa  RR5_PHATR RecName: Full=30S ribosomal protein S5, chloroplastic;
   19::167     4e-22  44%  168 aa  RR5_RHDSA RecName: Full=30S ribosomal protein S5, chloroplastic;
   64::219     6e-22  35%  239 aa  RS5_SPHWW RecName: Full=30S ribosomal protein S5;
   19::171     8e-22  38%  174 aa  RS5_THEEB RecName: Full=30S ribosomal protein S5;
   59::185     8e-22  51%  206 aa  RS5_MESFL RecName: Full=30S ribosomal protein S5;
  199::306     8e-22  48%  308 aa  RR5_SPIOL RecName: Full=30S ribosomal protein S5,
   20::172     1e-21  38%  174 aa  RS5_ANAVT RecName: Full=30S ribosomal protein S5;
   20::172     1e-21  38%  174 aa  RS5_ANASP RecName: Full=30S ribosomal protein S5;
   23::179     2e-21  36%  180 aa  RS5_SYNP6 RecName: Full=30S ribosomal protein S5;
   23::179     2e-21  36%  180 aa  RS5_SYNE7 RecName: Full=30S ribosomal protein S5;
   60::216     2e-21  44%  218 aa  RS5_SYNR3 RecName: Full=30S ribosomal protein S5;
   19::171     7e-21  46%  173 aa  RS5_CYAA5 RecName: Full=30S ribosomal protein S5;
   21::173     1e-20  36%  175 aa  RS5_NOSP7 RecName: Full=30S ribosomal protein S5;
   33::154     6e-20  52%  159 aa  RR5_EMIHU RecName: Full=30S ribosomal protein S5, chloroplastic;
   13::160     1e-19  37%  172 aa  RS5_NEOSM RecName: Full=30S ribosomal protein S5;
   19::149     1e-19  48%  168 aa  RR5_CYACA RecName: Full=30S ribosomal protein S5, chloroplastic;
   64::217     3e-19  42%  237 aa  RS5_NOVAD RecName: Full=30S ribosomal protein S5;
   36::174     7e-19  36%  174 aa  RS5_EHRCR RecName: Full=30S ribosomal protein S5;
   19::137     3e-18  39%  169 aa  RR5_GUITH RecName: Full=30S ribosomal protein S5, chloroplastic;
   19::168     7e-18  37%  171 aa  RS5_SULMW RecName: Full=30S ribosomal protein S5;
   36::174     7e-18  34%  174 aa  RS5_ANAMM RecName: Full=30S ribosomal protein S5;
   36::174     7e-18  34%  174 aa  RS5_ANAMF RecName: Full=30S ribosomal protein S5;
   64::219     6e-17  29%  219 aa  RS5_MYCPN RecName: Full=30S ribosomal protein S5;
  202::301     1e-16  43%  303 aa  RR5_ARATH RecName: Full=30S ribosomal protein S5,
   86::174     1e-16  39%  174 aa  RS5_EHRRW RecName: Full=30S ribosomal protein S5;
   86::174     1e-16  39%  174 aa  RS5_EHRRG RecName: Full=30S ribosomal protein S5;
   56::216     2e-16  29%  216 aa  RS5_MYCHJ RecName: Full=30S ribosomal protein S5;
   56::216     2e-16  29%  216 aa  RS5_MYCH7 RecName: Full=30S ribosomal protein S5;
   56::216     2e-16  29%  216 aa  RS5_MYCH2 RecName: Full=30S ribosomal protein S5;
   86::174     4e-16  40%  174 aa  RS5_EHRCJ RecName: Full=30S ribosomal protein S5;
   86::170     7e-16  41%  173 aa  RS5_ANAPZ RecName: Full=30S ribosomal protein S5;
    3::134     3e-15  35%  139 aa  RS5_CARRP RecName: Full=30S ribosomal protein S5;
   51::196     8e-15  33%  213 aa  RS5_METS3 RecName: Full=30S ribosomal protein S5P;
   56::169     3e-14  35%  172 aa  RR5_GRATL RecName: Full=30S ribosomal protein S5, chloroplastic;
   53::198     2e-13  32%  216 aa  RS5_METTH RecName: Full=30S ribosomal protein S5P;
   59::200     6e-12  34%  213 aa  RS5_HYPBU RecName: Full=30S ribosomal protein S5P;
   50::195     1e-11  33%  209 aa  RS5_METMA RecName: Full=30S ribosomal protein S5P;
   50::195     1e-11  33%  209 aa  RS5_METAC RecName: Full=30S ribosomal protein S5P;
   65::210     2e-11  30%  227 aa  RS5_METST RecName: Full=30S ribosomal protein S5P;
   50::195     4e-11  32%  208 aa  RS5_METBF RecName: Full=30S ribosomal protein S5P;
   32::170     5e-11  29%  170 aa  RS5_WOLTR RecName: Full=30S ribosomal protein S5;
   32::170     5e-11  28%  170 aa  RS5_WOLPM RecName: Full=30S ribosomal protein S5;
   53::195     5e-11  31%  203 aa  RS5_METTP RecName: Full=30S ribosomal protein S5P;
   50::192     5e-11  31%  198 aa  RS5_ARCFU RecName: Full=30S ribosomal protein S5P;
   56::201     9e-11  44%  221 aa  RS5_META3 RecName: Full=30S ribosomal protein S5P;
   55::197     1e-10  33%  211 aa  RS5_IGNH4 RecName: Full=30S ribosomal protein S5P;
   50::194     2e-10  31%  205 aa  RS5_METHJ RecName: Full=30S ribosomal protein S5P;
   63::208     3e-10  31%  229 aa  RS5_METM5 RecName: Full=30S ribosomal protein S5P;
   51::196     4e-10  41%  217 aa  RS5_METJA RecName: Full=30S ribosomal protein S5P;
   50::208     4e-10  30%  212 aa  RS5_HALMA RecName: Full=30S ribosomal protein S5P;AltName:
   68::211     6e-10  30%  218 aa  RS5_PYRAE RecName: Full=30S ribosomal protein S5P;
   96::200     7e-10  36%  214 aa  RS5_STAMF RecName: Full=30S ribosomal protein S5P;
   58::214     7e-10  30%  214 aa  RS5_METS5 RecName: Full=30S ribosomal protein S5P;
   51::195     1e-09  33%  205 aa  RS5_METB6 RecName: Full=30S ribosomal protein S5P;
   54::212     1e-09  28%  219 aa  RS5_HALWD RecName: Full=30S ribosomal protein S5P;
   63::208     2e-09  42%  229 aa  RS5_METM7 RecName: Full=30S ribosomal protein S5P;
   63::208     2e-09  42%  229 aa  RS5_METM6 RecName: Full=30S ribosomal protein S5P;
   59::204     2e-09  30%  218 aa  RS5_AERPE RecName: Full=30S ribosomal protein S5P;
   48::192     2e-09  28%  221 aa  RS5_THEAC RecName: Full=30S ribosomal protein S5P;
   52::195     2e-09  29%  202 aa  RS5_PYRIL RecName: Full=30S ribosomal protein S5P;
   59::204     2e-09  41%  225 aa  RS5_METMP RecName: Full=30S ribosomal protein S5P;
   50::195     2e-09  27%  205 aa  RS5_METLZ RecName: Full=30S ribosomal protein S5P;
   50::194     5e-09  30%  212 aa  RS5_HALSA RecName: Full=30S ribosomal protein S5P;
   52::195     6e-09  29%  202 aa  RS5_PYRCJ RecName: Full=30S ribosomal protein S5P;
   52::195     8e-09  28%  202 aa  RS5_PYRAR RecName: Full=30S ribosomal protein S5P;
   92::217     8e-09  38%  226 aa  RS5_METKA RecName: Full=30S ribosomal protein S5P;
  266::379     1e-08  28%  387 aa  RT05_SCHPO RecName: Full=Probable 40S ribosomal protein S5,
   48::195     1e-08  26%  221 aa  RS5_THEVO RecName: Full=30S ribosomal protein S5P;
   62::217     1e-08  26%  235 aa  RS5_PYRKO RecName: Full=30S ribosomal protein S5P;
  139::300     2e-08  30%  307 aa  RT05_YEAST RecName: Full=37S ribosomal protein S5,
   63::231     2e-08  27%  236 aa  RS5_PYRAB RecName: Full=30S ribosomal protein S5P;
   14::130     2e-08  40%  153 aa  RR5_CYAME RecName: Full=30S ribosomal protein S5, chloroplastic;
   72::202     2e-08  27%  219 aa  RS5_CENSY RecName: Full=30S ribosomal protein S5P;
   56::195     4e-08  42%  205 aa  RS5_METMJ RecName: Full=30S ribosomal protein S5P;
   90::232     9e-08  30%  265 aa  RS2_LEIAM RecName: Full=40S ribosomal protein S2;
   63::230     1e-07  25%  236 aa  RS5_PYRHO RecName: Full=30S ribosomal protein S5P;
   89::231     1e-07  31%  276 aa  RS24_ARATH RecName: Full=40S ribosomal protein S2-4;
   98::240     1e-07  31%  285 aa  RS23_ARATH RecName: Full=40S ribosomal protein S2-3;
   97::239     1e-07  31%  284 aa  RS22_ARATH RecName: Full=40S ribosomal protein S2-2;
   97::239     1e-07  31%  284 aa  RS21_ARATH RecName: Full=40S ribosomal protein S2-1;
   87::192     2e-07  34%  202 aa  RS5_THEPD RecName: Full=30S ribosomal protein S5P;
   63::205     3e-07  26%  236 aa  RS5_PYRFU RecName: Full=30S ribosomal protein S5P;AltName:
  102::208     3e-07  31%  231 aa  RS5_NANEQ RecName: Full=30S ribosomal protein S5P;
   59::204     3e-07  40%  225 aa  RS5_METVS RecName: Full=30S ribosomal protein S5P;
   59::204     3e-07  40%  225 aa  RS5_METVA RecName: Full=30S ribosomal protein S5P;
   58::183     3e-07  31%  214 aa  RS5_SULTO RecName: Full=30S ribosomal protein S5P;
   58::207     6e-07  27%  214 aa  RS5_SULAC RecName: Full=30S ribosomal protein S5P;
   48::191     1e-06  26%  211 aa  RS5_NATPD RecName: Full=30S ribosomal protein S5P;
   91::227     1e-06  30%  265 aa  RS2_DICDI RecName: Full=40S ribosomal protein S2;AltName:
   58::214     2e-06  27%  214 aa  RS5_SULIN RecName: Full=30S ribosomal protein S5P;
  100::242     2e-06  32%  272 aa  RS2_CAEEL RecName: Full=40S ribosomal protein S2;
   58::182     4e-06  30%  214 aa  RS5_SULSO RecName: Full=30S ribosomal protein S5P;
   48::194     6e-06  35%  221 aa  RS5_PICTO RecName: Full=30S ribosomal protein S5P;
  104::246     2e-05  28%  293 aa  RS2_RAT RecName: Full=40S ribosomal protein S2;
  104::246     2e-05  28%  293 aa  RS2_MOUSE RecName: Full=40S ribosomal protein S2;AltName:
  104::246     2e-05  28%  293 aa  RS2_HUMAN RecName: Full=40S ribosomal protein S2;AltName:
   44::186     2e-05  28%  202 aa  RS2_CRIGR RecName: Full=40S ribosomal protein S2;Flags: Fragment;
  104::246     2e-05  28%  293 aa  RS2_BOVIN RecName: Full=40S ribosomal protein S2;
   89::231     3e-05  27%  277 aa  RS2_ICTPU RecName: Full=40S ribosomal protein S2;
   77::206     5e-05  28%  253 aa  RS2_SCHPO RecName: Full=40S ribosomal protein S2;
   87::216     5e-05  28%  267 aa  RS2_DROME RecName: Full=40S ribosomal protein S2;AltName:
  185::296     7e-05  30%  418 aa  RT05_CAEEL RecName: Full=Putative 28S ribosomal protein S5,
   78::207     1e-04  24%  254 aa  RS2_YEAST RecName: Full=40S ribosomal protein S2;AltName:
   90::214     1e-04  29%  278 aa  RS2_URECA RecName: Full=40S ribosomal protein S2;
    1::211

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPGRERRDGGRSADDNKXXXXXXXXXXXXXXXXXXXXXXXXSQYIERVVTINRVSKVVKGGRRFSFTALX
RS5_CORGL       MPGRERRDGGRSADDNKXXXXXXXXXXXXXXXXXXXXXXXXSQYIERVVTINRVSKVVKGGRRFSFTALX
RS5_CORGB       MPGRERRDGGRSADDNKXXXXXXXXXXXXXXXXXXXXXXXXSQYIERVVTINRVSKVVKGGRRFSFTALX
RS5_COREF       MPGRERRDGGRSADENKSXXXXXXXXXXXXXXXXXXXXXXXSQYIERVVTINRVSKVVKGGRRFSFTALX
RS5_CORDI       MPGRERRDGGRSADDNXXXXXXXXXXXXXXXXXXXXER---SQYIERVVTINRVSKVVKGGRRFSFTALX
RS5_CORK4       MPGRERRDGGRSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQYIERVVTINRVSKVVKGGRRFSFTALX
RS5_CORA7       MSDREQRDGGRSAEXXXXXXXXXXXXXXXXXXXXXXXXX---KYIERVVTINRVAKTVKGGRNMSFTALX
RS5_CORJK       -----------------------------------------SQFIERVVTINRVSKVVKGGRRFSFTALX
RS5_CORU7       ------------------------------------------QYIERVVTINRVSKVVKGGRRFSFTALX
RS5_RHOE4       MPGRQRRDGGNSXXXXXXXXXXXXXXXXXXXXXXXXXXXEKSQFIERVVTINRVSKVVKGGRRFSFTALX
RS5_RHOSR       MPGRQRRDGGQNGPNTXXXXXXXXXXXXXXXXXXXXQSAEKSNHIERVVTINRVSKVVKGGRRFSFTALX
RS5_RHOOB       MPGRQRRDGGQNGPNTXXXXXXXXXXXXXXXXXXXXQSAEKSNHIERVVTINRVSKVVKGGRRFSFTALX
RS5_MYCTU       -----------------------------------------SNYLERVVAINRVSKVVKGGRRFSFTALX
RS5_MYCTA       -----------------------------------------SNYLERVVAINRVSKVVKGGRRFSFTALX
RS5_MYCBT       -----------------------------------------SNYLERVVAINRVSKVVKGGRRFSFTALX
RS5_MYCBP       -----------------------------------------SNYLERVVAINRVSKVVKGGRRFSFTALX
RS5_MYCBO       -----------------------------------------SNYLERVVAINRVSKVVKGGRRFSFTALX
RS5_MYCS2       -----------------------------------------SNYIERVVSINRVSKVVKGGRRFSFTALX
RS5_MYCGI       -----------------------------------------SNYLERVVTINRVSKVVKGGRRFSFTALX
RS5_MYCA9       -----------------------------------------SNYLERVVTINRVSKVVKGGRRFSFTALX
RS5_MYCMM       -----------------------------------------SNYLERVVAINRVSKVVKGGRRFSFTALX
RS5_MYCPA       -----------------------------------------SNYLERVVAINRVSKVVKGGRRFSFTALX
RS5_SACEN       ---------------------------------------------ERVVTINRVAKVVKGGRRFSFTALX
RS5_KINRD       -----------------------------------------SNFVERVVTINRVAKVVKGGRRFSFTALX
RS5_NOCFA       MPGRQRRDGGNGPSNGPEXXXXXXXXXXXXXXXXXXXXAAEKNQLERVVAINRVSKVVKGGRRFSFTALX
RS5_NOCSJ       -------------------------------------------YIERVVAINRVAKVVKGGRRFSFTALX
RS5_FRASN       -------------------------------------------YVERVVAINRVAKVVKGGRRFSFTALX
RS5_FRASC       -------------------------------------------YVERVVAINRVAKVVKGGRRFSFTALX
RS5_FRAAA       -------------------------------------------YVERVVAINRVAKVVKGGRRFSFTALX
RS5_THEFY       -------------------------------------------YIERVVKINRVAKVVKGGRRFSFTALX
RS5_STRCO       -------------------------------------------YVERVVAINRVAKVVKGGRRFSFTALX
RS5_ARTS2       -----------------------------------------SQFVERVVTINRVSKVVKGGRRFSFTALX
RS5_MYCLE       -------------------------------------------YLERVVAINRVSKVVKGGRRFSFTALX
RS5_MYCLB       -------------------------------------------YLERVVAINRVSKVVKGGRRFSFTALX
RS5_STRGG       -------------------------------------------YVERVVAINRVAKVVKGGRRFSFTALX
RS5_STRAW       -------------------------------------------YVERVVAINRVAKVVKGGRRFSFTALX
RS5_ARTAT       -----------------------------------------SQFVERVVTINRVAKVVKGGRRFSFTALX
RS5_LEIXX       -----------------------------------------SQFLERVVTINRVSKVVKGGRRFSFTALX
RS5_SALTO       -------------------------------------------HLERVVAINRVAKVVKGGRRFSFTALX
RS5_SALAI       -------------------------------------------HLERVVAINRVAKVVKGGRRFSFTALX
RS5_BEUC1       -----------------------------------------NQFVERVVTINRVAKVVKGGRRFSFTALX
RS5_MYCUA       -----------------------------------------SNYLERVVAINRVSKVVKGGRRFSFTALX
RS5_ACIC1       -----------------------------------------SNFLERVVTINRVAKVVKGGRRFSFTALX
RS5_TROWT       ------------------------------------------QFLERVVRINRVAKVVKGGRKFSFSALX
RS5_TROW8       ------------------------------------------QFLERVVRINRVAKVVKGGRKFSFSALX
RS5_MICLU       ------------------------------------------QFLERVVGINRVSKV---GRRFSFTALX
RS5_BIFLO       --------------------------------------------LDRVVTINRVSKTHKGGRTFSFAALX
RS5_BIFLI       --------------------------------------------LDRVVTINRVSKTHKGGRTFSFAALX
RS5_BIFLD       --------------------------------------------LDRVVTINRVSKTHKGGRTFSFAALX
RS5_BIFAA       -----------------------------------------NEMLDRVVTINRVSKTHKGGRTFSFAALX
RS5_BIFA0       --------------------------------------------LDRVVTINRVSKTHKGGRTFSFAALX
RS5_PROAC       -------------------------------------------YLERVVAINRVAKVVQGGRRFSFTALX
RS5_PELTS       ---------------------------------------------EKVVFINRVAKVVKGGRRFSFSALM
RS5_LYSSC       ---------------------------------------------ERVVTINRVAKVVKGGRRFRFTALV
RS5_HELMI       ---------------------------------------------EKVVYINRVAKVVKGGRRFSFSALV
RS5_CLOTH       ---------------------------------------------EKVVNIGRVTKVVKGGRNFRFSALV
RS5_BACHK       ---------------------------------------------ERVVTINRVAKVVKGGRRFRFAALV
RS5_BACCZ       ---------------------------------------------ERVVTINRVAKVVKGGRRFRFAALV
RS5_BACCR       ---------------------------------------------ERVVTINRVAKVVKGGRRFRFAALV
RS5_BACC1       ---------------------------------------------ERVVTINRVAKVVKGGRRFRFAALV
RS5_BACAN       ---------------------------------------------ERVVTINRVAKVVKGGRRFRFAALV
RS5_BACAH       ---------------------------------------------ERVVTINRVAKVVKGGRRFRFAALV
RS5_GEOTN       ---------------------------------------------ERVVAINRVAKVVKGGRRLRFSALV
RS5_BACCN       ---------------------------------------------ERVVTINRVAKVVKGGRRFRFAALV
RS5_BACSK       ---------------------------------------------EKVVTINRVAKVVKGGRRFRFAALV
RS5_CARHZ       ---------------------------------------------EKVIAINRTAKVVKGGRRFSFSALV
RS5_BACLD       ---------------------------------------------ERLVTVNRVAKVVKGGRRFRFAALV
RS5_BACHD       ---------------------------------------------EKVVAINRVAKVVKGGRRFRFAALV
RS5_BACA2       ---------------------------------------------ERLVTVNRVAKVVKGGRRFRFAALV
RS5_BACSU       ---------------------------------------------ERLVTVNRVAKVVKGGRRFRFAALV
RS5_SHIDS       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_SHISS       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_SHIFL       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_SHIF8       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_SHIBS       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_SALTY       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_SALTI       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_SALPB       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_SALPA       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_SALCH       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_SALAR       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_ERWCT       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_ECOUT       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_ECOLI       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_ECOLC       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_ECOL6       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_ECOL5       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_ECOK1       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_ECOHS       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_ECO57       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_ECO24       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_CITK8       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_DESHD       ---------------------------------------------EKVVHIARVAKVVKGGRRFSFSALV
RS5_BACP2       ---------------------------------------------ERLVTVNRVAKVVKGGRRFRFAALV
RS5_LISW6       ---------------------------------------------ERVVTINRVAKVVKGGRRFRFTALV
RS5_LISMO       ---------------------------------------------ERVVTINRVAKVVKGGRRFRFTALV
RS5_LISMF       ---------------------------------------------ERVVTINRVAKVVKGGRRFRFTALV
RS5_LISIN       ---------------------------------------------ERVVTINRVAKVVKGGRRFRFTALV
RS5_ENTFA       ---------------------------------------------DRVVAINRVTKVVKGGRRLRFAALV
RS5_DESHY       ---------------------------------------------EKVVHIARVAKVVKGGRRFSFSALV
RS5_KLEP7       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_ENTS8       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_ENT38       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_ANATD       ---------------------------------------------ERVVNINRVAKVVKGGKRLKFSAIV
RS5_CALS8       ---------------------------------------------ERVVNINRVAKVVKGGKRLKFSAIV
RS5_ACTP2       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_HAEDU       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_DESRM       ---------------------------------------------EKVVYINRVAKVVKGGRRFSFSALV
RS5_ACTSZ       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_ROSS1       ---------------------------------------------ERVVQINRVSKVVKGGRRFSFSTXX
RS5_BUCAP       -----------------------------------------SELQEKLITVNRVSKTVKGGRIFSFTALT
RS5_SODGM       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_PASMU       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_HALHL       ---------------------------------------------EKLITINRVAKVVQGGRQFGFTALT
RS5_HAES2       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_HAES1       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_HAEIN       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_HAEIG       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_HAEIE       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_HAEI8       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_TOLAT       ---------------------------------------------EKLVAVNRVSKVVKGGRIFSFTALT
RS5_SHELP       ---------------------------------------------EKLVAVNRVSKVVKGGRIFSFTALT
RS5_NATTJ       ---------------------------------------------EKVVEINRVTKVVKGGRRFSFSALV
RS5_MANSM       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_SHEAM       ---------------------------------------------EKLIAVNRVSKVVKGGRIFSFTALT
RS5_MYXXD       ---------------------------------------------DRVVNINRVAKVVKGGRRFSFXXXX
RS5_BUCAI       ---------------------------------------------EKLITVNRVSKTVKGGRIFSFTALT
RS5_ANADE       ---------------------------------------------DRVVHINRVAKVVKGGRRFSFSALX
RS5_PARDP       ------------------------------------------EFADRLVAINRVSKTVKGGKRFGFAALV
RS5_YERPS       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_YERPP       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_YERPN       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_YERPE       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_YERPA       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_YERP3       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_YERE8       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_PHOLL       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_ALTMD       ------------------------------------------EFLEKLIAVNRVSKVVKGGRIFSFTALT
RS5_SALRD       -------------------------------------------WVDRLVSVNRVSKVVKGGRRFSFNTVV
RS5_PSYCK       --------------------------------------------VERLVTVDRVAKVVKGGRIFSFTALT
RS5_PSYA2       --------------------------------------------VERLVTVDRVAKVVKGGRIFSFTALT
RS5_PSEHT       ---------------------------------------------EKLIAVNRVSKVVKGGRIFSFTALT
RS5_SYMTH       ---------------------------------------------EKMVDLRRVAKTVKGGRRMSFSAXX
RS5_GEOMG       ---------------------------------------------DKVVHISRVAKVVKGGRRFSFSALV
RS5_AERS4       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_AERHH       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_PSEMY       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFTFTALT
RS5_HAHCH       ---------------------------------------------EKLVQVNRVAKVVKGGRIFGFTALT
RS5_AZOVD       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFTFTALT
RS5_ACIBY       --------------------------------------------VEKLVAVDRVAKVVKGGRIFSFTALT
RS5_ACIBT       --------------------------------------------VEKLVAVDRVAKVVKGGRIFSFTALT
RS5_ACIBS       --------------------------------------------VEKLVAVDRVAKVVKGGRIFSFTALT
RS5_ACIBC       --------------------------------------------VEKLVAVDRVAKVVKGGRIFSFTALT
RS5_ACIB5       --------------------------------------------VEKLVAVDRVAKVVKGGRIFSFTALT
RS5_ACIB3       --------------------------------------------VEKLVAVDRVAKVVKGGRIFSFTALT
RS5_VIBVY       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_VIBVU       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_VIBPA       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_VIBHB       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_SHEB9       ---------------------------------------------EKLIAVNRVSKVVKGGRIFSFTALT
RS5_SHEB8       ---------------------------------------------EKLIAVNRVSKVVKGGRIFSFTALT
RS5_SHEB5       ---------------------------------------------EKLIAVNRVSKVVKGGRIFSFTALT
RS5_SHEB2       ---------------------------------------------EKLIAVNRVSKVVKGGRIFSFTALT
RS5_SERP5       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_PSEA6       --------------------------------------------LEKLIAVNRVSKVVKGGRIFSFTALT
RS5_CHLSY       ---------------------------------------------ERVVQINRVSKVVKGGRRFSFSTXX
RS5_CHLAD       ---------------------------------------------ERVVLINRVSKVVKGGRRFSFSTXX
RS5_CHLAA       ---------------------------------------------ERVVQINRVSKVVKGGRRFSFSTXX
RS5_SYNFM       ------------------------------------------QLIDKVVHISRVAKVVKGGRRFSFSAIV
RS5_PELCD       ---------------------------------------------DRVVHINRCAKVVKGGRRFSFSALV
RS5_MOOTA       -----------------------------------------------------------GGRRFSFAALV
RS5_CYTH3       ---------------------------------------------EHVVAINRVAKVVKGGRRFSFSAIX
RS5_XANOR       --------------------------------------------IEKLVAVNRVSKTVKGGRQFTFTALT
RS5_XANOP       --------------------------------------------IEKLVAVNRVSKTVKGGRQFTFTALT
RS5_XANOM       --------------------------------------------IEKLVAVNRVSKTVKGGRQFTFTALT
RS5_XANCP       --------------------------------------------IEKLVAVNRVSKTVKGGRQFTFTALT
RS5_XANCB       --------------------------------------------IEKLVAVNRVSKTVKGGRQFTFTALT
RS5_XANC8       --------------------------------------------IEKLVAVNRVSKTVKGGRQFTFTALT
RS5_XANC5       --------------------------------------------IEKLVAVNRVSKTVKGGRQFTFTALT
RS5_XANAC       --------------------------------------------IEKLVAVNRVSKTVKGGRQFTFTALT
RS5_CLOAB       ---------------------------------------------EKVVFINRVAKVVKGGRNFRFTALV
RS5_XYLFM       --------------------------------------------IEKLVAVNRVSKTVKGGRQFTFTALT
RS5_VIBSL       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_SYNAS       ------------------------------------------EYLDRVIAINRTAKVVKGGRRFRFSAIV
RS5_PSYIN       ---------------------------------------------EKLIAVNRVAKVVKGGRIFSFTALT
RS5_PSEAE       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFAFTALT
RS5_PSEAB       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFAFTALT
RS5_PSEA8       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFAFTALT
RS5_PSEA7       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFAFTALT
RS5_ALCBS       ---------------------------------------------EKLVQVNRVAKVVKGGRIFGFTALT
RS5_XYLFA       --------------------------------------------IEKLVAVNRVSKTVKGGRQFTFTALT
RS5_VIBCM       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_VIBCH       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_VIBC3       ---------------------------------------------EKLIAVNRVSKTVKGGRIMSFTALT
RS5_SHESW       ---------------------------------------------EKLIAVNRVSKVVKGGRIFSFTALT
RS5_SHESR       ---------------------------------------------EKLIAVNRVSKVVKGGRIFSFTALT
RS5_SHESM       ---------------------------------------------EKLIAVNRVSKVVKGGRIFSFTALT
RS5_SHESA       ---------------------------------------------EKLIAVNRVSKVVKGGRIFSFTALT
RS5_SHEPC       ---------------------------------------------EKLIAVNRVSKVVKGGRIFSFTALT
RS5_SHEON       ---------------------------------------------EKLIAVNRVSKVVKGGRIFSFTALT
RS5_PSEE4       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFTFTALT
RS5_IDILO       ------------------------------------------ELIEKLITVNRVAKVVKGGRIFSFTALT
RS5_CHRSD       ---------------------------------------------EKLVQVNRVAKVVKGGRIFGFTALT
RS5_BURS3       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BURPS       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BURP6       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BURP1       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BURP0       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BURMS       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BURMA       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BURM9       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BURM7       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BURM1       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BURCJ       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BORPD       ---------------------------------------------EKMIAVNRVSKVVKGGRTMSFAALT
RS5_THETN       ---------------------------------------------ERVVSINRVSKVVKGGKNFRFSVVV
RS5_SHEFN       ---------------------------------------------EKLIAVNRVSKVVKGGRIFSFTALT
RS5_SHEDO       ---------------------------------------------EKLIAVNRVSKVVKGGRIFSFTALT
RS5_LACBA       ---------------------------------------------DNVVAINRITKVVKGGRRLRFAALV
RS5_CHLP8       ---------------------------------------------EKLVHINRTAKVVKGGKRFGFNAIV
RS5_BURTA       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BURPP       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_STRMK       --------------------------------------------IEKLVAVNRVSKTVKGGRQFTFTALT
RS5_STRM5       --------------------------------------------IEKLVAVNRVSKTVKGGRQFTFTALT
RS5_COLP3       -----------------------------------------SDMAEKLIAVNRVSKVVKGGRIFSFTALT
RS5_BURVG       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BURP8       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BURCM       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BURCH       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BURCC       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BURCA       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BURA4       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_BORA1       ---------------------------------------------EKMIAVNRVSKVVKGGRTMSFAALT
RS5_ALISL       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_XYLFT       --------------------------------------------IEKLVAVNRVSKTVKGGRQFTFTALT
RS5_XYLF2       --------------------------------------------IEKLVAVNRVSKTVKGGRQFTFTALT
RS5_LAWIP       -------------------------------------------FIEKVVSLNRVAKVVKGGRRFSFSALV
RS5_BURXL       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_ACIAD       --------------------------------------------VEKLVAVDRVAKVVKGGRIFSFTALT
RS5_DESPS       ------------------------------------------ELIEKIVFINRVAKVVKGGRRFSFSAIV
RS5_BORPE       ---------------------------------------------EKMIAVNRVSKVVKGGRTMSFAALS
RS5_BORPA       ---------------------------------------------EKMIAVNRVSKVVKGGRTMSFAALS
RS5_BORBR       ---------------------------------------------EKMIAVNRVSKVVKGGRTMSFAALS
RS5_CLONN       ---------------------------------------------EKVVFINRVAKVVKGGRNFRFSALV
RS5_CHLTE       ---------------------------------------------EKLVHINRTAKVVKGGKRFGFNAIV
RS5_ALKMQ       ---------------------------------------------EQVVDIRRVTKVVKGGRNFRFAALV
RS5_PSYWF       --------------------------------------------VEKLVSVDRVSKVVKGGRIFSFTALT
RS5_PSEU2       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFTFTALT
RS5_PSESM       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFTFTALT
RS5_PSEF5       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFTFTALT
RS5_PHOPR       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_THEPX       ---------------------------------------------ERVVSINRVSKVVKGGKNFRFSVVV
RS5_THEP3       ---------------------------------------------ERVVSINRVSKVVKGGKNFRFSVVV
RS5_ALKOO       ---------------------------------------------EQVVDIKRVTKVVKGGRNFRFSALV
RS5_DESVV       --------------------------------------------IEKIVYLNRVAKVVKGGRRFSFSALV
RS5_DESVH       --------------------------------------------IEKIVYLNRVAKVVKGGRRFSFSALV
RS5_CHLT3       ---------------------------------------------EKLVHINRTAKVVKGGKRFGFNAIV
RS5_THIDA       ---------------------------------------------EKMISVNRVTKVVKGGRIMGFAALT
RS5_SILST       ------------------------------------------EFADRLVAINRVSKTVKGGKRFGFAALV
RS5_PSEU5       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFTFTALT
RS5_PSEPW       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFTFTALT
RS5_PSEPK       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFTFTALT
RS5_PSEPG       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFTFTALT
RS5_PSEP1       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFTFTALT
RS5_PSE14       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFTFTALT
RS5_MARAV       ---------------------------------------------EKLVQVNRVAKVVKGGRIFAFTALT
RS5_JANSC       ------------------------------------------EFADRLVAINRVSKTVKGGKRFGFAALV
RS5_PSEFS       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFTFTALT
RS5_DIAST       ---------------------------------------------EKMIAVNRVTKVVKGGRILGFAALT
RS5_DELAS       ---------------------------------------------EKMIAVNRVTKVVKGGRILGFAALT
RS5_BUCCC       --------------------------------------------------VNRVSKTVKGGRIFSFTALT
RS5_ACISJ       ---------------------------------------------EKMIAVNRVTKVVKGGRILGFAALT
RS5_DESAD       --------------------------------------------IEKIVYLNRVAKVVKGGRRFSFSALV
RS5_WIGBR       ---------------------------------------------EKLISVNRVSKTVKGGRIFSFTALT
RS5_PSEPF       -------------------------------------------YIEKLVQVNRVAKTVKGGRIFTFTALT
RS5_SILPO       ------------------------------------------EFADRLVAINRVSKTVKGGKRFGFAALV
RS5_RHOS5       ------------------------------------------EFADRLVAINRVSKTVKGGKRFGFAALV
RS5_CHLPB       ---------------------------------------------EKLVHINRTAKVVKGGKRFGFNAIV
RS5_RHOSK       ------------------------------------------EFADRLVAINRVSKTVKGGKRFGFAALV
RS5_RHOS4       ------------------------------------------EFADRLVAINRVSKTVKGGKRFGFAALV
RS5_RHOS1       ------------------------------------------EFADRLVAINRVSKTVKGGKRFGFAALV
RS5_NITMU       ---------------------------------------------EKMVAINRVTKVVKGGRILGFAALT
RS5_DINSH       ------------------------------------------EFADRLVAINRVSKTVKGGKRFGFAALV
RS5_DESVM       --------------------------------------------VEKIVYLNRVAKVVKGGRRFSFSALV
RS5_ACIF5       ---------------------------------------------EKLIHINRVSKVVKGGRQFGFAALM
RS5_ACIF2       ---------------------------------------------EKLIHINRVSKVVKGGRQFGFAALM
RS5_PROVI       ---------------------------------------------EKLVHINRTAKVVKGGKRFGFNAIV
RS5_PELLD       ---------------------------------------------EKLVHINRTAKVVKGGKRFGFNAIV
RS5_LACSS       ---------------------------------------------DRVVSINRVTKVVKGGRRLRFAAIV
RS5_DESDG       --------------------------------------------IEKIVDLNRVAKVVKGGRRFSFSALV
RS5_CHLL2       ---------------------------------------------EKLVHINRTAKVVKGGKRFGFNAIV
RS5_BUCBP       ---------------------------------------------EKLISVNRVSKTVKGGRIFSFSALT
RS5_BAUCH       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_RALSO       ---------------------------------------------EKMIAVNRVTKVVKGGRILGFAALT
RS5_RALPJ       ---------------------------------------------EKMIAVNRVTKVVKGGRILGFAALT
RS5_CLOPS       ---------------------------------------------EKVVSISRVTKVVKGGRNFRFSALV
RS5_CLOPE       ---------------------------------------------EKVVSISRVTKVVKGGRNFRFSALV
RS5_CLOP1       ---------------------------------------------EKVVSISRVTKVVKGGRNFRFSALV
RS5_PROA2       ---------------------------------------------EKLVHINRTAKVVKGGKRFGFNAIV
RS5_PELPB       ---------------------------------------------EKLVHINRTAKVVKGGKRFGFNAIV
RS5_CHLPD       ---------------------------------------------EKLVHINRTAKVVKGGKRFGFNAII
RS5_METFK       ---------------------------------------------EKMIGVNRVTKVVKGGRIMSFAALS
RS5_PHEZH       -----------------------------------------SEIVEKLVHINRVAATVKGGRRFSFAALM
RS5_ACIBL       ---------------------------------------------DQVVAINRVTKVVKGGKNLSFAALV
RS5_ANADF       ---------------------------------------------DKVVHINRVAKVVKGGRRFSFSALX
RS5_VARPS       ---------------------------------------------EKMIAINRVTKVVKGGRILGFAALT
RS5_SINMW       -----------------------------------------SEFVDKLVAINRVAKVVKGGRRFGFAALV
RS5_RHOFD       ---------------------------------------------EKMIAINRVTKVVKGGRILGFAALT
RS5_RHIME       -----------------------------------------SEFVDKLVAINRVAKVVKGGRRFGFAALV
RS5_POLNA       ---------------------------------------------EKMIAINRVTKVVKGGRILGFAALT
RS5_MESSB       -----------------------------------------SEFVDKLVHINRVAKVVKGGRRFGFAALV
RS5_ROSDO       ------------------------------------------EFADRLVAINRVSKTVKGGKRFGFAALV
RS5_BLOPB       ---------------------------------------------EKLITVNRVSKTVKGGRVFSFTALT
RS5_STACT       ------------------------------------------EFEERVVTINRVAKVVKGGRRFRFTALV
RS5_STAAW       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_STAAT       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_STAAS       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_STAAR       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_STAAN       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_STAAM       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_STAAC       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_STAAB       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_STAA9       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_STAA8       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_STAA3       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_STAA2       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_STAA1       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_CHLCH       ---------------------------------------------EKLVHINRTAKVVKGGKRFGFNAIV
RS5_ANOFW       ---------------------------------------------------------------FRFAALV
RS5_STAAE       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_RALEJ       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_POLSJ       ---------------------------------------------EKMIAVNRVTKVVKGGRILGFAALT
RS5_BLOFL       ---------------------------------------------EKLITVNRVSKTVKGGRVFSFAALT
RS5_POLSQ       ---------------------------------------------EKMIAVNRVTKVVKGGRILGFAALT
RS5_NITEU       ---------------------------------------------EKMVSVNRVTKVVKGGRILGFAALT
RS5_HERAR       ---------------------------------------------EKMIAVNRVTKVVKGGRIMGFAALA
RS5_AGRT5       -----------------------------------------SEFVDKLVAINRVAKVVKGGRRFGFAALV
RS5_SYNWW       ------------------------------------------EMIEKVVTIXXXXXXXXXXXXFSFSALX
RS5_RHISN       -----------------------------------------SEFVDKLVAINRVAKVVKGGRRFGFAALV
RS5_RALEH       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_NITEC       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_CUPTR       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_COXBU       ---------------------------------------------EKLVAVRRTAKVVKGGRVFGFSXXX
RS5_CAUCR       -----------------------------------------SDIVEKLVHINRVAATVKGGRRFSFAALM
RS5_CAUCN       -----------------------------------------SDIVEKLVHINRVAATVKGGRRFSFAALM
RS5_ACIAC       ---------------------------------------------EKMIAVNRVTKVVKGGRILGFAALT
RS5_CAUSK       -----------------------------------------SDIVEKLVHINRVAATVKGGRRFSFAALM
RS5_STAS1       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_RALME       ---------------------------------------------EKMISVNRVTKVVKGGRILGFAALT
RS5_MARMM       --------------------------------------------VDKLVHINRVAKTVKGGRNFQFAALV
RS5_GEOSW       ----------------------------------------------------------------------
RS5_JANMA       ---------------------------------------------EKMIAVNRVTKVVKGGRIMGFAALA
RS5_STRSY       ---------------------------------------------ERVVAINRVTKVVKGGRRLRFAALV
RS5_STRS2       ---------------------------------------------ERVVAINRVTKVVKGGRRLRFAALV
RS5_STAES       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_STAEQ       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_DEIRA       -----------------------------------------SEFEEKMLFVNRTSKTYQGGRRFRFAALV
RS5_AGRVS       -----------------------------------------SEFVDKLVAINRVAKVVKGGRRFGFAALV
RS5_STAHJ       -----------------------------------------------VVTINRVAKVVKGGRRFRFTALV
RS5_GEOKA       ----------------------------------------------------------------------
RS5_BACST       ----------------------------------------------------------------------
RS5_METPB       -----------------------------------------SEFVDKLVHINRVAKVVKGGRRFGFAALV
RS5_METEP       -----------------------------------------SEFVDKLVHINRVAKVVKGGRRFGFAALV
RS5_METC4       -----------------------------------------SEFVDKLVHINRVAKVVKGGRRFGFAALV
RS5_LEGPL       -------------------------------------------YQEKLVSVTRTAKVVKGGRVFGFAXXX
RS5_LEGPH       -------------------------------------------YQEKLVSVTRTAKVVKGGRVFGFAXXX
RS5_LEGPC       -------------------------------------------YQEKLVSVTRTAKVVKGGRVFGFAXXX
RS5_LEGPA       -------------------------------------------YQEKLVSVTRTAKVVKGGRVFGFAXXX
RS5_DEIGD       -----------------------------------------SEFEEKMLFVNRTSKTYQGGRRFRFAALV
RS5_CLOBL       ---------------------------------------------EKVVHINRVAKVVKGGRNFRFSVLV
RS5_CLOBH       ---------------------------------------------EKVVHINRVAKVVKGGRNFRFSVLV
RS5_CLOB1       ---------------------------------------------EKVVHINRVAKVVKGGRNFRFSVLV
RS5_AZOSE       ---------------------------------------------EKMVAINRVTKVVKGGRILGFAALT
RS5_DICNV       -----------------------------------------SEFLERLVAVNRVTKVVKGGRQFAFAALX
RS5_DECAR       ---------------------------------------------EKMVAVNRVTKVVKGGRILGFAALT
RS5_CHRVO       --------------------------------------------VEKMISVNRVTKVVKGGRIMAFSALT
RS5_TREPS       ------------------------------------------EFTEKLIKLNRTAKVVKGGRRFSFSALT
RS5_TREPA       ------------------------------------------EFTEKLIKLNRTAKVVKGGRRFSFSALT
RS5_RHILW       -------------------------------------------FVDKLVAINRVAKVVKGGRRFGFAALV
RS5_RHIL3       -------------------------------------------FVDKLVAINRVAKVVKGGRRFGFAALV
RS5_RHIEC       -------------------------------------------FVDKLVAINRVAKVVKGGRRFGFAALV
RS5_RHIE6       -------------------------------------------FVDKLVAINRVAKVVKGGRRFGFAALV
RS5_METRJ       -----------------------------------------SEFVDKLVHINRVAKVVKGGRRFGFAALV
RS5_DEIDV       -----------------------------------------SEFEEKMLFVNRTSKTYQGGRRFRFAALV
RS5_OCEIH       -----------------------------------------------------------GGRRFRFAALV
RS5_NEIMF       --------------------------------------------IEKMVAVNRVTKVVKGGRIMAFSALT
RS5_NEIMB       --------------------------------------------IEKMVAVNRVTKVVKGGRIMAFSALT
RS5_NEIMA       --------------------------------------------IEKMVAVNRVTKVVKGGRIMAFSALT
RS5_NEIM0       --------------------------------------------IEKMVAVNRVTKVVKGGRIMAFSALT
RS5_NEIG1       --------------------------------------------IEKMVAVNRVTKVVKGGRIMAFSALT
RS5_HYPNA       --------------------------------------------VDKLVGINRVAKTVKGGKNFGFAALV
RS5_GLUDA       --------------------------------------------VDKLVTINRVAKVVKGGRRFAFAALV
RS5_BACTN       ---------------------------------------------DRLVAINRVTKVTKGGRTFSFSAIV
RS5_STRGC       ---------------------------------------------ERVVAINRVTKVVKGGRRLRFAALV
RS5_STRA5       ---------------------------------------------ERVVAINRVTKVVKGGRRLRFAALV
RS5_STRA3       ---------------------------------------------ERVVAINRVTKVVKGGRRLRFAALV
RS5_STRA1       ---------------------------------------------ERVVAINRVTKVVKGGRRLRFAALV
RS5_RHILO       --------------------------------------------VDKLVHINRVAKVVKGGRRFGFAALV
RS5_NITSB       ------------------------------------------EFEEVVVNISRVTKVVKGGRRFRFSALV
RS5_STRSV       ---------------------------------------------ERLVAINRVTKVVKGGRRLRFAALV
RS5_LARHH       ---------------------------------------------EKLIGVNRVTKVVKGGRIMAFSALT
RS5_HYDS0       ------------------------------------------QFEERLLEAARTTRVTKGGKRFSFSALV
RS5_CAMJR       ------------------------------------------EFEEVIVDIGRVTKVVKGGRRFRFTALV
RS5_CAMJJ       ------------------------------------------EFEEVIVDIGRVTKVVKGGRRFRFTALV
RS5_CAMJE       ------------------------------------------EFEEVIVDIGRVTKVVKGGRRFRFTALV
RS5_CAMJD       ------------------------------------------EFEEVIVDIGRVTKVVKGGRRFRFTALV
RS5_CAMJ8       ------------------------------------------EFEEVIVDIGRVTKVVKGGRRFRFTALV
RS5_WOLSU       ------------------------------------------EFKEVVVNIGRVTKVVKGGRRFRFNAXX
RS5_BORBU       --------------------------------------------IEKLISLNRVTKVVKGGRRFSFAAFM
RS5_BACFR       ---------------------------------------------DRLVAINRVTKVTKGGRTFSFSAIV
RS5_BACFN       ---------------------------------------------DRLVAINRVTKVTKGGRTFSFSAIV
RS5_CAMFF       ------------------------------------------EFEEVIVDIGRVTKVVKGGRRFRFTALV
RS5_STRPM       ---------------------------------------------ERVVAINRVTKVVKGGRRLRFAALV
RS5_STRPG       ---------------------------------------------ERVVAINRVTKVVKGGRRLRFAALV
RS5_STRPF       ---------------------------------------------ERVVAINRVTKVVKGGRRLRFAALV
RS5_STRPD       ---------------------------------------------ERVVAINRVTKVVKGGRRLRFAALV
RS5_STRPC       ---------------------------------------------ERVVAINRVTKVVKGGRRLRFAALV
RS5_STRPB       ---------------------------------------------ERVVAINRVTKVVKGGRRLRFAALV
RS5_STRP8       ---------------------------------------------ERVVAINRVTKVVKGGRRLRFAALV
RS5_STRP6       ---------------------------------------------ERVVAINRVTKVVKGGRRLRFAALV
RS5_STRP3       ---------------------------------------------ERVVAINRVTKVVKGGRRLRFAALV
RS5_STRP1       ---------------------------------------------ERVVAINRVTKVVKGGRRLRFAALV
RS5_CAMHC       ------------------------------------------EFEEVIVNIGRVTKVVKGGRKFRFTALV
RS5_BUCAK       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_THEM4       ---------------------------------------------ERIVEIRRTTKVTKGGKNLSFRVLX
RS5_THEAB       ---------------------------------------------ERIVEIRRTTKVTKGGKNLSFRVLX
RS5_SULDN       ---------------------------------------------ESIVNIGRVTKVVKGGRRFRFTALV
RS5_SOLUE       ---------------------------------------------EQVVAINRVTKVVKGGKNLSFSALV
RS5_RHORT       ------------------------------------------EFLDKLVHINRVAKVVKGGRRFAFAALV
RS5_PARD8       ---------------------------------------------DRLVAINRVTKVTKGGRTFSFAAIV
RS5_METS4       -----------------------------------------------LVHINRVAKVVKGGRRFGFAALV
RS5_HELHP       ------------------------------------------EFSEVVVNIGRVTKVVKGGRRFRFNAXX
RS5_GEOSL       ---------------------------------------------DKVVHISRVAKVVKGGRRFSFSALV
RS5_CAMC5       ------------------------------------------EFEEVIVDIGRVTKVVKGGRRFRFTAXX
RS5_SULNB       ----------------------------------------------------RVTKVVKGGRRFRFTALV
RS5_PARUW       -----------------------------------------SDLTEKVLHINRCSKVVKGGRKFSFSALI
RS5_METNO       -----------------------------------------------LVHINRVAKVVKGGRRFGFAALV
RS5_VIBFM       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_VIBF1       ---------------------------------------------EKLIAVNRVSKTVKGGRIFSFTALT
RS5_BORGA       --------------------------------------------IEKLISLNRVTKVVKGGRRFSFAAFM
RS5_BORAP       --------------------------------------------IEKLISLNRVTKVVKGGRRFSFAAFM
RS5_THETH       -----------------------------------------TDFEEKMILIRRTARMQAGGRRFRFGALV
RS5_THET8       -----------------------------------------TDFEEKMILIRRTARMQAGGRRFRFGALV
RS5_THET2       -----------------------------------------TDFEEKMILIRRTARMQAGGRRFRFGALV
RS5_CAMC1       ------------------------------------------EFEEVIVDIGRVTKVVKGGRRFRFTAXX
RS5_LEPBL       --------------------------------------------------IDRVAKVVKGGRRFSFNALS
RS5_LEPBJ       --------------------------------------------------IDRVAKVVKGGRRFSFNALS
RS5_PELUB       --------------------------------------------LEKLVHINRITKVVKGGRRFGFSALV
RS5_LEPIN       --------------------------------------------------IDRVAKVVKGGRRFSFNALS
RS5_LEPIC       --------------------------------------------------IDRVAKVVKGGRRFSFNALS
RS5_ARCB4       ---------------------------------------------EAIVKIGRVTKVVKGGRRFRFTALV
RS5_HELPY       ------------------------------------------EFQEVVVNIGRVTKVVKGGRRFRFNAXX
RS5_HELPS       ------------------------------------------EFQEVVVNIGRVTKVVKGGRRFRFNAXX
RS5_HELPJ       ------------------------------------------EFQEVVVNIGRVTKVVKGGRRFRFNAXX
RS5_HELPH       ------------------------------------------EFQEVVVNIGRVTKVVKGGRRFRFNAXX
RS5_HELP2       ------------------------------------------EFQEVVVNIGRVTKVVKGGRRFRFNAXX
RS5_FLAPJ       ---------------------------------------------DRLVSVNRVTKVTKGGRAFGFSAIV
RS5_ALHEH       ---------------------------------------------EKLVAINRVAKVVKGGRQFGFTALA
RS5_NITOC       --------------------------------------------------------------QFGFSALT
RS5_PELPD       ---------------------------------------------DRVVHISRVAKVVKGGRRFSFSALI
RS5_PEDPA       ---------------------------------------------DRVVAINRVTKVVKGGRRLRFAALV
RS5_STRMU       ---------------------------------------------ERVVAINRVTKVVKGGRRLRFAALV
RS5_GEOLS       ---------------------------------------------DRVVHISRVAKVVKGGRRFSFSALV
RS5_CLOD6       ---------------------------------------------------------------FRFAALV
RS5_MYCAP       -----------------------------------------NEFSEKVVNISRVTKVVKGGRRFSFSAFX
RS5_BDEBA       ---------------------------------------------ERVVAINRVTKVVKGGRRFSFAALV
RS5_TREDE       ------------------------------------------EYVEKLVKLNRTAKVVKGGRRFSFSALT
RS5_ACICJ       --------------------------------------------IDKLVTINRVAKVVKGGRRFAFAALV
RS5_METCA       --------------------------------------------------------------QFGFTALT
RS5_LACPL       ---------------------------------------------DNVVAINRITKVVKGGRRLRFAALV
RS5_STRTD       ---------------------------------------------ERVVAINRVTKVVKGGRNMRFAALV
RS5_STRT2       ---------------------------------------------ERVVAINRVTKVVKGGRNMRFAALV
RS5_STRT1       ---------------------------------------------ERVVAINRVTKVVKGGRNMRFAALV
RS5_PARL1       ----------------------------------------------KLVHINRVAKVVKGGRRFGFAALV
RS5_MYCPU       -----------------------------------------TEFSEKIVDIARVTKVVKGGRRFSFSAFX
RS5_FERNB       -------------------------------------------------------KVTKGGKNLSFRVLX
RS5_VEREI       ---------------------------------------------EKMIAVNRVTKVVKGGRILGFAALT
RS5_ZYMMO       ------------------------------------------ELIEKLVHINRVSKTVKGGKRFGFAALV
RS5_RHOPB       -----------------------------------------SEFVDKLVHINRVAKVVKGGKRFGFAALV
RS5_LACC3       ---------------------------------------------DQVVSINRVTKVVKGGRRLRFAAIA
RS5_LACAC       ---------------------------------------------DQLVAVNRITKVVKGGRRMRFAALV
RS5_GRABC       --------------------------------------------IDKLVTINRVAKVVKGGRRFAFAALV
RS5_RHOP5       -----------------------------------------SEFVDKLVHINRVAKVVKGGKRFGFAALV
RS5_BARBK       ------------------------------------------EFIDKLVHINRVAKVVKGGRRFGFAALV
RS5_OCHA4       -------------------------------------------FVDKLVHINRVAKVVKGGRRFGFAALV
RS5_LACS1       ---------------------------------------------DRVVAINRITKVVKGGRRLRFAALV
RS5_BRUSU       -------------------------------------------FVDKLVHINRVAKVVKGGRRFGFAALV
RS5_BRUSI       -------------------------------------------FVDKLVHINRVAKVVKGGRRFGFAALV
RS5_BRUO2       -------------------------------------------FVDKLVHINRVAKVVKGGRRFGFAALI
RS5_BRUME       -------------------------------------------FVDKLVHINRVAKVVKGGRRFGFAALV
RS5_BRUMB       -------------------------------------------FVDKLVHINRVAKVVKGGRRFGFAALV
RS5_BRUC2       -------------------------------------------FVDKLVHINRVAKVVKGGRRFGFAALV
RS5_BRUAB       -------------------------------------------FVDKLVHINRVAKVVKGGRRFGFAALV
RS5_BRUA2       -------------------------------------------FVDKLVHINRVAKVVKGGRRFGFAALV
RS5_BRUA1       -------------------------------------------FVDKLVHINRVAKVVKGGRRFGFAALV
RS5_BART1       -----------------------------------------NEFVDRLVHINRVAKVVKGGRRFGFAALV
RS5_LACRD       ---------------------------------------------DQVVAINRITKVVKGGRRMRFAALV
RS5_LACH4       ---------------------------------------------DQLVAVNRITKVVKGGRRMRFAALV
RS5_RUBXD       -----------------------------------------SEIQDRVVQIXXXXXXXXXXXXLNFSALX
RS5_METPP       ---------------------------------------------EKMIQVNRVTKVVKGGRTMSFAALT
RS5_CHLFF       ------------------------------------------QLEEKVLVVNRCSKVVKGGRKFSFSALI
RS5_PHYAS       -----------------------------------------------------------GGRRFRFSALV
RS5_MYCS5       -----------------------------------------SEYEEKIVDIARVTKVVKGGRRFSFSAFV
RS5_MAGSA       -----------------------------------------SEFVDKLVHINRVAKVVKGGRRFAFAALV
RS5_CHLAB       ------------------------------------------QLEEKVLVVNRCSKVVKGGRKFSFSALI
RS5_BARHE       -------------------------------------------FVDRLVHINRVAKVVKGGRRFGFAALV
RS5_AZOSB       ---------------------------------------------EKMVAINRVTKVVKGGRILGFAALT
RS5_LEUMM       ---------------------------------------------ENVVAINRVTKVVKGGRRLRFAALV
RS5_CHLPN       ------------------------------------------QLEEKVLVVNRCSKVVKGGRKFSFSALI
RS5_RUTMC       -------------------------------------------YIEKLVNXXXXXXXXXXXXXXXXSALV
RS5_PORGI       ---------------------------------------------DRLVAINRVTKVTKGGRTFTFAAIV
RS5_MYCMO       ------------------------------------------EFEEKIVNIARVTNVVKGGRRFSFAAXX
RS5_LACJO       ---------------------------------------------DQLVAINRITKVVKGGRRMRFAAVV
RS5_LACGA       ---------------------------------------------DQLVAINRITKVVKGGRRMRFAAVV
RS5_BRAJA       -----------------------------------------SEFVDKLVHINRVAKVVKGGKRFGFAALV
RS5_ACAM1       -----------------------------------------STWQERVVQIRRVSXXXXXXXXLSFRAIV
RS5_XANP2       -------------------------------------------FVDKLVHINRVAKVVKGGRRFGFAALV
RS5_SULSY       ---------------------------------------------EKVVEIRRTTRVMEGGRRFSFSTLA
RS5_PROM3       -----------------------------------------SEWQERVVQIRRVSKTVKGGKKMSFRAIV
RS5_AQUAE       ---------------------------------------------------NRTARVTKGGRRFSFSTLV
RS5_THENN       ----------------------------------------------------RTSKVTKGGKNLSFRVVA
RS5_SYNPW       -----------------------------------------SEWQERVVQIRRVSKTVKGGKKMSFRAIV
RS5_RHOPS       -------------------------------------------FVDKLVHINRVAKVVKGGKRFGFAALV
RS5_NITWN       -------------------------------------------FVDKLVHINRVAKVVKGGKRFGFAALV
RS5_BARQU       -------------------------------------------FVDRLVHINRVAKVVKGGRRFGFAALV
RS5_PROMM       -----------------------------------------SEWQERVVQIRRVSKTVKGGKKMSFRAIV
RS5_OENOB       ---------------------------------------------ENVVSINRVTKVVKGGRRLRFSALV
RS5_LEPCP       ---------------------------------------------EKMIQVNRVTKVVKGGRIMAFATLT
RS5_RHOP2       -------------------------------------------FVDKLVHINRVAKVVKGGKRFGFAALV
RS5_OLICO       -----------------------------------------SEFVDKLVHINRVAKVVKGGKRFGFAALV
RS5_CHLCV       ------------------------------------------QLEEKVLVVNRCSKVVKGGRKFSFSALI
RS5_AZOC5       -------------------------------------------FVDKLVHINRVAKVVKGGRRFGFAALV
RS5_NITHX       -----------------------------------------SEFVDKLVHINRVAKVVKGGKRFGFAALV
RS5_THICR       ----------------------------------------------------------------------
RS5_RHOPT       -------------------------------------------FVDKLVHINRVAKVVKGGKRFGFAALV
RS5_RHOPA       -------------------------------------------FVDKLVHINRVAKVVKGGKRFGFAALV
RS5_LACDB       ---------------------------------------------DQLVAINRITKVVKGGRRQRFAALV
RS5_LACDA       ---------------------------------------------DQLVAINRITKVVKGGRRQRFAALV
RS5_VESOH       -----------------------------------------NNYIEKLVNXXXXXXXXXXXXXXXXSALV
RS5_CHLTR       ------------------------------------------QLEEKVLVVNRCCKVVKGGRKFSFSALI
RS5_CHLTA       ------------------------------------------QLEEKVLVVNRCCKVVKGGRKFSFSALI
RS5_CHLMU       ------------------------------------------QLEEKVLVVNRCCKVVKGGRKFSFSALI
RS5_BEII9       -----------------------------------------SEFVDRLVHINRVAKVVKGGRRFGFAALV
RS5_RICTY       ---------------------------------------------EVLVDVNRVTKVVKGGRRFAFSAYV
RS5_PERMH       ---------------------------------------------------------------FSFSTLA
RS5_METSB       -----------------------------------------SEFMDRLVHINRVAKVVKGGRRFGFAALV
RS5_LACLS       -----------------------------------------SEFEERVVSINRVTKVVKGGRRLRFAALV
RS5_FRATW       ------------------------------------------ELIEKLVSVKRHSKTVKGGRIMSFAALT
RS5_FRATT       ------------------------------------------ELIEKLVSVKRHSKTVKGGRIMSFAALT
RS5_FRATO       ------------------------------------------ELIEKLVSVKRHSKTVKGGRIMSFAALT
RS5_FRATN       ------------------------------------------ELIEKLVSVKRHSKTVKGGRIMSFAALT
RS5_FRATF       ------------------------------------------ELIEKLVSVKRHSKTVKGGRIMSFAALT
RS5_FRAT1       ------------------------------------------ELIEKLVSVKRHSKTVKGGRIMSFAALT
RS5_LACLA       -----------------------------------------SEFEERVVSINRVTKVVKGGRRLRFAALV
RS5_GLUOX       --------------------------------------------VDKLVTINRVAKVVKGGRRFAFAALV
RS5_THEMA       ----------------------------------------------------RTSKVTKGGKNLSFRVVA
RS5_LACLM       -----------------------------------------SEFEERVVSINRVTKVVKGGRRLRFAALV
RS5_FRATH       ------------------------------------------ELIEKLVSVKRHSKTVKGGRIMSFAALT
RS5_BACV8       ---------------------------------------------DRLVAINRVTKVTKGGRTFSFSAIV
RS5_RICBR       ---------------------------------------------EVLVDVNRVTKVVKGGRRFAFSAYV
RS5_MAGSM       -----------------------------------------SEFIEKLVAIKRTAKVVKGGSRFNFSAIV
RS5_GRAFK       ---------------------------------------------DRLVGVQRVTKVTKGGRAFGFSAIV
RS5_THESQ       ----------------------------------------------------RTSKVTKGGKNLSFRVVA
RS5_THEP1       ----------------------------------------------------RTSKVTKGGKNLSFRVVA
RS5_RICPR       ---------------------------------------------EVLVDVNRVTKVVKGGRRFAFSAYV
RS5_RICFE       ---------------------------------------------EVLVDVNRVTKVVKGGRRFAFSAYV
RS5_RICAH       ---------------------------------------------EVLVDVNRVTKVVKGGRRFAFSAYV
RS5_BRASO       -------------------------------------------FVDKLVHINRVAKVVKGGKRFGFAALV
RS5_BRASB       -------------------------------------------FVDKLVHINRVAKVVKGGKRFGFAALV
RR5_THAPS       -----------------------------------------AKFVERLIKISRVTKVTKGGKKLSFRAVV
RS5_RICM5       ---------------------------------------------EVLVDVNRVTKVVKGGRRFAFSAYV
RS5_MYCPE       ---------------------------------------------EKIVGVKKISKTTKGGRNMRFSALA
RS5_SYNY3       ---------------------------------------------ERVIQIRRVSXXXXXXXXLSFRAIV
RS5_PROMS       -----------------------------------------SDWQERVVQIRRVSKTVKGGKKMSFRAIX
RS5_RICCK       ---------------------------------------------EVLVDVNRITKVVKGGRRFAFSACM
RS5_PROM9       -----------------------------------------SDWQERVVQIRRVSKTVKGGKKMSFRAIX
RS5_PROM2       -----------------------------------------SDWQERVVQIRRVSKTVKGGKKMSFRAIX
RS5_MICAN       ---------------------------------------------ERVIQIRRVSXXXXXXXXLSFRAIX
RS5_RICRS       ---------------------------------------------EVLVDVNRVTKVVKGGRSFAFSAYV
RS5_RICRO       ---------------------------------------------EVLVDVNRVTKVVKGGRSFAFSAYV
RS5_RICPU       ---------------------------------------------EVLVDVNRVTKVVKGGRSFAFSAYV
RS5_ERYLH       --------------------------------------------IEKLVHINRVSKTVKGGKRFGFAALV
RS5_RICCN       ---------------------------------------------EVLVDVNRVTKVVKGGRSFAFSAYV
RS5_RICAE       ---------------------------------------------EVLVDVNRVTKVVKGGRSFAFSAYV
RS5_PROMP       -----------------------------------------SEWQERVVQIRRVSKTVKGGKKMSFRAIX
RS5_PROM0       -----------------------------------------SDWQERVVQIRRVSKTVKGGKKMSFRAIX
RS5_UREU1       -----------------------------------------SNFEERVVKIKRISKTTKGGRMMRFSALV
RS5_UREPA       -----------------------------------------SNFEERVVKIKRISKTTKGGRMMRFSALV
RS5_UREP2       -----------------------------------------SNFEERVVKIKRISKTTKGGRMMRFSALV
RS5_RHOBA       --------------------------------------------LDRVVKIKRCAAVVKGGRRFSFAAMV
RS5_ONYPE       ---------------------------------------------EKVVKINRITKVVKGGARFRFSALV
RS5_AYWBP       ---------------------------------------------EKVVKINRITKVVKGGARFRFSALV
RS5_HELAH       ----------------------------------------------------------------------
RS5_CYAP7       ---------------------------------------------ERVIQIRRVSXXXXXXXXLSFRAIV
RS5_THELT       ------------------------------------------------------AKVTKGGKTLSFRVLA
RS5_SYNS9       -----------------------------------------SEWQERVVQIRRVSKTVKGGKKMSFRAIX
RS5_PROMT       ---------------------------------------------ERVVQIRRVSKTVKGGKKMSFRAIX
RS5_PROMA       ---------------------------------------------ERVIQIRRVSKTVKGGKKMSFRAIX
RS5_PROM1       ---------------------------------------------ERVVQIRRVSKTVKGGKKMSFRAIX
RS5_SYNSC       -----------------------------------------SEWQERVVQIRRVSKTVKGGKKMSFRAIX
RS5_SYNPX       -----------------------------------------SEWQERVVQIRRVSKTVKGGKKMSFRAIX
RS5_PROM5       -----------------------------------------SEWQERVVQIRRVFKTVKGGKKMSFRAIX
RS5_MYCGA       -----------------------------------------SEFEEKIVKISRISKTTKGGRTMRFSALV
RS5_SYNP2       ---------------------------------------------ERVIQIRRVSXXXXXXXXLSFRAIV
RR5_ODOSI       -----------------------------------------SKFVERLIKISRVSKVTKGGKKLSFRAIX
RR5_PORYE       ----------------------------------------------------------------------
RR5_PORPU       ----------------------------------------------------------------------
RS5_CYAP8       ---------------------------------------------ERVIQIRRVSXXXXXXXXLSFRAIX
RS5_FUSNN       -----------------------------------------NQYQEKLLKISRVSKTTKGGRTISFSVLA
RS5_STRR6       -----------------------------------------------------------GGRRLRFAALV
RS5_STRPN       -----------------------------------------------------------GGRRLRFAALV
RS5_STRP2       -----------------------------------------------------------GGRRLRFAALV
RS5_GLOVI       -----------------------------------------TEFQERVVQIRRVTXXXXXXXXLSFRAXX
RS5_DEHE1       ---------------------------------------------DKLIFINRVTKVVKGGKRMGFAALV
RS5_DEHSC       ---------------------------------------------DKLIFINRVTKVVKGGKRMGFAALV
RR5_CYAPA       ---------------------------------------------ERVVQIRRVSXXXXXXXXLSFRAIV
RS5_ORITB       --------------------------------------------VEHLVNVNRVTKVVKGGRRFSFSACV
RS5_MYCGE       -----------------------------------------SEFEERIVKLKRISKTTKGGRNMRFSXXX
RS5_MYCMS       -----------------------------------------------------------GGRHFRFAAXX
RS5_SPHAL       ------------------------------------------ELIEKLVHINRVSKTVKGGKRFGFAALV
RS5_MYCCT       -----------------------------------------------------------GGRHFRFAAXX
RR5_PHATR       --------------------------------------------VERLIKISRVSKVTKGGKKLSFRAIV
RR5_RHDSA       ---------------------------------------------ERVVQIRRVTXXXXXXXXLSFRAIL
RS5_SPHWW       ------------------------------------------ELIEKLVHINRVSKTVKGGKRFGFAALV
RS5_THEEB       ---------------------------------------------ERVVQIRRVSXXXXXXXXLSFRAIV
RS5_MESFL       -----------------------------------------------------------GGRHFRFAAXX
RR5_SPIOL       ----------------------------------------------------------------------
RS5_ANAVT       ---------------------------------------------ERVIQIRRVSXXXXXXXXLSFRAIV
RS5_ANASP       ---------------------------------------------ERVIQIRRVSXXXXXXXXLSFRAIV
RS5_SYNP6       -----------------------------------------SEWQERVVQIRRVTXXXXXXXXLSFRAIV
RS5_SYNE7       -----------------------------------------SEWQERVVQIRRVTXXXXXXXXLSFRAIV
RS5_SYNR3       -----------------------------------------SEWQERVIQIRRVSKTVKGGKKMSFRAIX
RS5_CYAA5       ---------------------------------------------ERVIQIRRVSXXXXXXXXLSFRAIX
RS5_NOSP7       ---------------------------------------------ERVIQIRRVSXXXXXXXXLSFRAIV
RR5_EMIHU       -----------------------------------------------------------GGKKLSFRXXX
RS5_NEOSM       ---------------------------------------------ESVVDIARVSKVTKGGRQFSFRVAA
RR5_CYACA       ---------------------------------------------ERVIQITRVTXXXXXXXXLSFRAXX
RS5_NOVAD       --------------------------------------------IEKLVHINRVSKTVKGGKRFGFAALV
RS5_EHRCR       ---------------------------------------------------------------FSFSVLV
RR5_GUITH       ---------------------------------------------ERVIQXXXXXXXXXXXXXLSFRAII
RS5_SULMW       ------------------------------------------------VMVNRVCKVTKGRRYFSFTALV
RS5_ANAMM       ---------------------------------------------------------------FSFSVLV
RS5_ANAMF       ---------------------------------------------------------------FSFSVLV
RS5_MYCPN       -----------------------------------------SEFEERIVKLKRISKTTKGGRNMRFSVLV
RR5_ARATH       ----------------------------------------------------------------------
RS5_EHRRW       ----------------------------------------------------------------------
RS5_EHRRG       ----------------------------------------------------------------------
RS5_MYCHJ       ------------------------------------------EFEERVIAIHXXXXXXXXXXXFSFSAFA
RS5_MYCH7       ------------------------------------------EFEERVIAIHXXXXXXXXXXXFSFSAFA
RS5_MYCH2       ------------------------------------------EFEERVIAIHXXXXXXXXXXXFSFSAFA
RS5_EHRCJ       ----------------------------------------------------------------------
RS5_ANAPZ       ----------------------------------------------------------------------
RS5_CARRP       ---------------------------------------------KKLIKIHRVTKVVKGGRIFSYTATS
RS5_METS3       ---------------------------------------------EEVMDVNLVQRMHKSGRKVNFRVIV
RR5_GRATL       ----------------------------------------------------------------------
RS5_METTH       ---------------------------------------------EEVIDVNLVQRMHKSGRKVNFRVIV
RS5_HYPBU       ------------------------------------------------VDVRLVQKMTDAGRINRFRVVV
RS5_METMA       ---------------------------------------------DEVLDINMVQRMTDSGRRVKFRATV
RS5_METAC       ---------------------------------------------DEVLDINMVQRMTDSGRRVKFRATV
RS5_METST       ---------------------------------------------EEVMDVNLVQRMHKSGRKVNFRVIV
RS5_METBF       ---------------------------------------------DEVLDINMVQRMTDSGRRVKFRATV
RS5_WOLTR       ---------------------------------------------------------------FSFSILV
RS5_WOLPM       ---------------------------------------------------------------FSFSILV
RS5_METTP       ---------------------------------------------DEVLDITMVQRMTDSGRRVKFRTTV
RS5_ARCFU       -----------------------------------------------VLEISMVQRMTDSGRRTKFRVTA
RS5_META3       ---------------------------------------------EQVLDVSLVQRMHKSGRRARFRATA
RS5_IGNH4       -----------------------------------------------VLDVSLVQKVTDAGRVTRLRVLV
RS5_METHJ       --------------------------------------------VDEVLDINMVQRMTDSGRRVKFRAVV
RS5_METM5       ---------------------------------------------EQVLDVKLVQRMHKSGRRARYRATV
RS5_METJA       ---------------------------------------------EKVLDVKLVQRMHKSGRRARFRATX
RS5_HALMA       ---------------------------------------------DEVLDINMVQRMTDSGRRVKFRCVV
RS5_PYRAE       ---------------------------------------------QELLNVNLVQRQTHAGERNQFQAVV
RS5_STAMF       ----------------------------------------------------------------------
RS5_METS5       -----------------------------------------------VIDIGMVQKQTDAGELSRYKVLV
RS5_METB6       ---------------------------------------------DEVLDIAMMQRMTDSGRRVQFRAVV
RS5_HALWD       ---------------------------------------------DEVLDINMVQRMTDSGRRVKFRCVV
RS5_METM7       ---------------------------------------------EQVLDVKLVQRMHKSGRRARYRATX
RS5_METM6       ---------------------------------------------EQVLDVKLVQRMHKSGRRARYRATX
RS5_AERPE       -----------------------------------------------VIDVSIVQKMTDAGRITRFRAVV
RS5_THEAC       ---------------------------------------------DEVIDIKRAQRMTDSGRRMTYSITV
RS5_PYRIL       ---------------------------------------------QEILNINVVQRQTHAGERSQFQVVV
RS5_METMP       ---------------------------------------------EQVLDVKLVQRMHKSGRRARYRATX
RS5_METLZ       --------------------------------------------VDEVLCIDMMQRMTDSGRRIKFRAVV
RS5_HALSA       ---------------------------------------------DEVLDINMVQRMTDSGRRVKFRCVV
RS5_PYRCJ       ---------------------------------------------QELLNLNLVQRQTHAGERNQFQAVV
RS5_PYRAR       ---------------------------------------------QELLNVNIVQRQTHAGERSLFQAVV
RS5_METKA       ----------------------------------------------------------------------
RT05_SCHPO      ----------------------------------------------------------------------
RS5_THEVO       ---------------------------------------------DEVIDIKRAQRMTDSGRRMTYSITV
RS5_PYRKO       ---------------------------------------------QEVLDIALTVRMTDSGRRIRFRVLA
RT05_YEAST      -------------------------------------------YITRKLTMKRVSNQTGKGKIASFYALV
RS5_PYRAB       ---------------------------------------------QEILDIALTVRMTDSGRRVRFRVLA
RR5_CYAME       ----------------------------------------------RVIQIRRVAXXXXXXXXLSFRXXX
RS5_CENSY       -----------------------------------------------VVDVGIIQKMTSNGQSTRFKAIV
RS5_METMJ       --------------------------------------------------INMVQRMTDSGRRVKXXXXX
RS2_LEIAM       ---------------------------------------------DEMMKIYPVQKATSAGQRTRFKAFN
RS5_PYRHO       ---------------------------------------------QEIIDIALTVRMTDSGRRVRFRVLA
RS24_ARATH      ---------------------------------------------DEVMKIMPVQKQTRAGQRTRFKAFI
RS23_ARATH      ---------------------------------------------DEVMKIMPVQKQTRAGQRTRFKAFV
RS22_ARATH      ---------------------------------------------DEVMKIMPVQKQTRAGQRTRFKAFV
RS21_ARATH      ---------------------------------------------DEVMKIMPVQKQTRAGQRTRFKAFV
RS5_THEPD       ----------------------------------------------------------------------
RS5_PYRFU       ---------------------------------------------QEVLDIALTVRMTDSGRRVRFRVLA
RS5_NANEQ       ----------------------------------------------------------------------
RS5_METVS       ---------------------------------------------EQVLDVKLVQRMHKSGRRARYRATX
RS5_METVA       ---------------------------------------------EQVLDVKLVQRMHKSGRRARYRATX
RS5_SULTO       -----------------------------------------------VMDIKIVQKQTDAGEISKYKVLI
RS5_SULAC       -----------------------------------------------IVDIGIVQKQTDAGELSRYKVLI
RS5_NATPD       ---------------------------------------------DEVLDINMVQRMTDSGRRVKFRCVV
RS2_DICDI       ---------------------------------------------DEVMKIVPVQKQTRAGQRTRFKAFV
RS5_SULIN       -----------------------------------------------VVDIKVVQKQTDAGEISRYKVLV
RS2_CAEEL       ---------------------------------------------DEVLKISPVQKQTTAGQRTRFKAFV
RS5_SULSO       -----------------------------------------------VVDIKVVQKQTDAGEISRYKVLV
RS5_PICTO       ---------------------------------------------DEVINIERAQRMTDSGRRMNYSITA
RS2_RAT         ---------------------------------------------DEVLKIMPVQKQTRAGQRTRFKAFV
RS2_MOUSE       ---------------------------------------------DEVLKIMPVQKQTRAGQRTRFKAFV
RS2_HUMAN       ---------------------------------------------DEVLKIMPVQKQTRAGQRTRFKAFV
RS2_CRIGR       ---------------------------------------------DEVLKIMPVQKQTRAGQRTRFKAFV
RS2_BOVIN       ---------------------------------------------DEVLKIMPVQKQTRAGQRTRFKAFV
RS2_ICTPU       ---------------------------------------------DEVLKIMPVQKQTRAGQRTRFKAFV
RS2_SCHPO       ---------------------------------------------DEVMKVVPVQKQTRAGQRTRFKAFV
RS2_DROME       ---------------------------------------------DEVLKIMPVQKQTRAGQRTRFKAFV
RT05_CAEEL      ----------------------------------------------------------------------
RS2_YEAST       ---------------------------------------------DEVMNIKPVQKQTRAGQRTRFKAVV
RS2_URECA       ---------------------------------------------DEVLKIMPVQKQTRAGQRTRFKAFV


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXXKAKEVPAAIQKGAEEARKNFFRVPMVNGTITHPVQGEKAAGIVMLKPAAPGTGVIA
RS5_CORGL       XXXXXXXXXXXXXXKAKEVPAAIQKGAEEARKNFFRVPMVNGTITHPVQGEKAAGIVMLKPAAPGTGVIA
RS5_CORGB       XXXXXXXXXXXXXXKAKEVPAAIQKGAEEARKNFFRVPMVNGTITHPVQGEKAAGIVMLKPAAPGTGVIA
RS5_COREF       XXXXXXXXXXXXXXKAKEVPAAIQKGAEEARKNFFRVPMVGGTITHPVQGEAAAGIVMLKPAAPGTGVIA
RS5_CORDI       XXXXXXXXXXXXXXKAKEVPAAIQKGAEEARKNFFRVPMVAGTITHPVQGEAAAGIVMMRPAAPGTGVIA
RS5_CORK4       XXXXXXXXXXXXXXKAKEVPAAIQKGAEEARKNFFRVPMIAGTITHPVQGEAAAGIVMLRPAAPGTGVIA
RS5_CORA7       XXXXXXXXXXXXXXKAKEVPAAIQKGAEEARKNFFRVPMIAGTITHPVEGRDAAGIVMMKPAAPGTGVIA
RS5_CORJK       XXXXXXXXXXXXXXKAKEVPAAIQKGAEEARKNFFRVPMINGTITHPVQGEDAAGIVMMKPAAPGTGVIA
RS5_CORU7       XXXXXXXXXXXXXXKAKEVPAAIQKGAEEARKNFFRVPMINGTITHPVQGEAAAGVVMLRPAAPGTGVIA
RS5_RHOE4       XXXXXXXXXXXXXXKAKEVPAAIQKGVEEARKSFFRVPMIANTITHPVQGEAAAGIVMLRPASPGTGVIA
RS5_RHOSR       XXXXXXXXXXXXXXKAKEVPAAIQKGVEEARKSFFRVPMIGSTITHPVQGEAAAGVVMLRPASPGTGVIA
RS5_RHOOB       XXXXXXXXXXXXXXKAKEVPAAIQKGVEEARKSFFRVPMIGSTITHPVQGEAAAGVVMLRPASPGTGVIA
RS5_MYCTU       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEARKSFFRVPLIGGTITHPVQGEAAAGVVLLRPASPGTGVIA
RS5_MYCTA       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEARKSFFRVPLIGGTITHPVQGEAAAGVVLLRPASPGTGVIA
RS5_MYCBT       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEARKSFFRVPLIGGTITHPVQGEAAAGVVLLRPASPGTGVIA
RS5_MYCBP       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEARKSFFRVPLIGGTITHPVQGEAAAGVVLLRPASPGTGVIA
RS5_MYCBO       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEARKSFFRVPLIGGTITHPVQGEAAAGVVLLRPASPGTGVIA
RS5_MYCS2       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEARKNFFRVPLIGSTITHPVQGEAAAGVVMLRPASPGTGVIA
RS5_MYCGI       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEARKNFFRVPLIGGTVTHPVQGEAAAGVVMLRPASPGTGVIA
RS5_MYCA9       XXXXXXXXXXXXXXKAKEVPAAIAKGVDEARKNFFRVPLIGGTITHPVQGEDSAGVVMLRPASAGTGVIA
RS5_MYCMM       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEARKGFFRVPLIGGTITHPVQGEAAAGVVLLRPASPGTGVIA
RS5_MYCPA       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEARKGFFRVPLIRGTITHPVQGEAAAGVVLLRPASPGTGVIA
RS5_SACEN       XXXXXXXXXXXXYGKAKEVPAAIAKGVEEAKKNFFRVPRLGGTITHPVQGEDAAGVVLLRPASAGTGVIA
RS5_KINRD       XXXXXXXXXXXXYGKAKEVPAAIAKGVEEAKKNFFRVPRIQGTIPHPIQGEKAAGVVMLRPASPGTGVIA
RS5_NOCFA       XXXXXXXXXXXXXXKAKEVPAAIQKGVEEARKGFFRVPMIGSTITHPVQGEAAAGVVMLRPASPGTGVIA
RS5_NOCSJ       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEAKKHFFRVPRIQGTIPHPVQGEKAAGVVLLRPAAPGTGVIA
RS5_FRASN       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEAKKHFFKVPRIGSTIPHPVQGEEAAGVVLLKPASPGTGVIA
RS5_FRASC       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEAKKHFFKVPRIGSTIPHPVQGEEAAGVVLLKPASPGTGVIA
RS5_FRAAA       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEAKKHFFKVPRIGSTIPHPVQGEEAAGVVLLKPASPGTGVIA
RS5_THEFY       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEAKKNFFRVPRIGGTIVHQVQGEDAAGVVLLRPAAPGTGVIA
RS5_STRCO       XXXXXXXXXXXXYGKAKEVPAAIAKGVEEAKKHFFKVPRIQGTIPHPIQGEKAAGVVLLKPASPGTGVIA
RS5_ARTS2       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEAKKSFFRVPRIGSTIPHRVQGEAAAGVVMLRPASAGTGVIA
RS5_MYCLE       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEARKSFFRVPLIDGTITHPVQGEAAAGVVLLRPASPGTGVIA
RS5_MYCLB       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEARKSFFRVPLIDGTITHPVQGEAAAGVVLLRPASPGTGVIA
RS5_STRGG       XXXXXXXXXXXXYGKAKEVPAAIAKGVEEAKKNFFKVPRIQGTIPHPITGEKAAGVVLLKPASPGTGVIA
RS5_STRAW       XXXXXXXXXXXXYGKAKEVPAAIAKGVEEAKKHFFKVPRIQGTIPHPITGEKAAGVVLLKPASPGTGVIA
RS5_ARTAT       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEAKKSFFRVPRVGSTIPHRVQGEAAAGVVLLRPASAGTGVIA
RS5_LEIXX       XXXXXXXXXXXXXXKAREVPLAISKGVEEAKKNFFRVPRVANTIPHPVQGEAAAGVVLLRPAAAGTGVIA
RS5_SALTO       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEAKKHFFKVPRIGQSIPHPVQGEDAAGVVLLKPASAGTGVIA
RS5_SALAI       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEAKKHFFKVPRIGQSIPHPVQGEDAAGVVLLKPASAGTGVIA
RS5_BEUC1       XXXXXXXXXXXXYGKAKEVPTAIAKGVEEAKKNFFRVPRIQGTIPHSVRGEAAAGVVFLRPASPGTGVIA
RS5_MYCUA       XXXXXXXXXXXXXXKAKEVPAAIAKGVEEARKGFFRVPLIGGTITHPVQGEAAAGVVLLRPASPXXXXXX
RS5_ACIC1       XXXXXXXXXXXXXXKAREVPAAIAKGVEEAKKHFFTVPRVQGTIPHPVIGEAAAGVVLLRPASPGTGVIA
RS5_TROWT       XXXXXXXXXXXXYGKAREVPLAISKGIESARKNFFTVPRVASTIPHPVQGEAASGVVLLRPAAPGTGVIA
RS5_TROW8       XXXXXXXXXXXXYGKAREVPLAISKGIESARKNFFTVPRVASTIPHPVQGEAASGVVLLRPAAPGTGVIA
RS5_MICLU       XXXXXXXXXXXXYGKAKEVPAAIQKAVEEAKKSFFRVPRVGSTIPHLVQGEDAAGVVLLRPASPGTAVIA
RS5_BIFLO       XXXXXXXXXXXXXXKSREVPAAIAKGQLDAKKHMFSVPRVRGTITHPVQGHDAAGTVLLRPAAPGTGVIA
RS5_BIFLI       XXXXXXXXXXXXXXKSREVPAAIAKGQLDAKKHMFSVPRVRGTITHPVQGHDAAGTVLLRPAAPGTGVIA
RS5_BIFLD       XXXXXXXXXXXXXXKSREVPAAIAKGQLDAKKHMFSVPRVRGTITHPVQGHDAAGTVLLRPAAPGTGVIA
RS5_BIFAA       XXXXXXXXXXXXXXKSREVPAAIAKGQLDAKKHMFTVPRIKGTVTHPVIGHDAAGTVLLRPAAPGTGVIA
RS5_BIFA0       XXXXXXXXXXXXXXKSREVPAAIAKGQLDAKKHLFNVPRIRGTVTHPVTGHDHAGTVMLRPAAPGTGVIA
RS5_PROAC       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFFKVPLVGRTITHPVIGEKAAGVVMLRPASPGTGVIA
RS5_PELTS       VVGDGNGHVGAGLGKAGEVPEAIRKGIEDAKKNMIKVPLAGTTIPHEVIGEFGAGKVLLKPAAPGTGVIA
RS5_LYSSC       VVGDRNGHVGFGTGKAQEVPDAIRKAVEDAKKNLVEVPRVGGTTPHLVLGRFGAGEILIKPAAPGTGVIA
RS5_HELMI       VVGDGKGHVGFGLGKAGEVPEAIRKGVEDAKKNLIVVPVVGTTIPHPALGVFGAGRVLLKPASKGTGVIA
RS5_CLOTH       VVGDENGHVGSGMGKAAEIPDAIRKGIEDAKKNLIKVPIVNTTIPHEVIGEFGAGKVLLKPAQPGTGVIA
RS5_BACHK       VVGDKNGHVGFGTGKAQEVPDAIRKAIEDAKKNLIAVPLVGTTIPHTINGHFGAGEVFLKPAAEGTGVIA
RS5_BACCZ       VVGDKNGHVGFGTGKAQEVPDAIRKAIEDAKKNLIAVPLVGTTIPHTINGHFGAGEVFLKPAAEGTGVIA
RS5_BACCR       VVGDKNGHVGFGTGKAQEVPDAIRKAIEDAKKNLIAVPLVGTTIPHTINGHFGAGEVFLKPAAEGTGVIA
RS5_BACC1       VVGDKNGHVGFGTGKAQEVPDAIRKAIEDAKKNLIAVPLVGTTIPHTINGHFGAGEVFLKPAAEGTGVIA
RS5_BACAN       VVGDKNGHVGFGTGKAQEVPDAIRKAIEDAKKNLIAVPLVGTTIPHTINGHFGAGEVFLKPAAEGTGVIA
RS5_BACAH       VVGDKNGHVGFGTGKAQEVPDAIRKAIEDAKKNLIAVPLVGTTIPHTINGHFGAGEVFLKPAAEGTGVIA
RS5_GEOTN       VVGDKNGHVGFGTGKAQEVPEAIRKAIEDAKKNLMEVPIVGTTIPHEVIGHFGAGEIILKPASEGTGVIA
RS5_BACCN       VVGDKNGHVGFGTGKAQEVPDAIRKAIEDAKKNLIEVPLVGTSIPHEIIGHFGAGEVFLKPAAEGTGVIA
RS5_BACSK       VVGDKNGHVGFGMGKAQEVPEAIRKAVEDAKKNLIEVPIVNTTIPHQIVGRFGAGRVFLKPASEGTGVIA
RS5_CARHZ       VVGDQKGHVGVGLGKAPEVPDAIRKGIEDAKKNLIKVPIVNTTIPHEIIGEAGAGKVLLKPAAPGTGVIA
RS5_BACLD       VVGDKNGHVGFGTGKAQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNILLKPASEGTGVIA
RS5_BACHD       VVGDKNGRVGFGMGKAQEVPEAIRKAVEDAKKNLIEVPIVGTTIPHEIVGRFGAGRVLLKPASEGTGVIA
RS5_BACA2       VVGDKNGHVGFGTGKAQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNILLKPASEGTGVIA
RS5_BACSU       VVGDKNGHVGFGTGKAQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNILLKPASEGTGVIA
RS5_SHIDS       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGAHTGSRVFMQPASEGTGIIA
RS5_SHISS       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_SHIFL       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_SHIF8       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_SHIBS       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_SALTY       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_SALTI       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_SALPB       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_SALPA       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_SALCH       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_SALAR       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_ERWCT       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMMNVALNNGTLQHPVKGAHTGSRVFMQPASEGTGIIA
RS5_ECOUT       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_ECOLI       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_ECOLC       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_ECOL6       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_ECOL5       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_ECOK1       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_ECOHS       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_ECO57       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_ECO24       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_CITK8       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_DESHD       VVGDGHGNVGAGLGKAGEVPEAIRKGMEDAKKNMVSVPLIGTTIPHAILGNYGAGSVLLKPAAKGTGVIA
RS5_BACP2       VVGDKNGHVGFGTGKAQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNVLLKPASEGTGVIA
RS5_LISW6       VVGDKNGHVGFGTGKAQEVPDAIRKAVEDAKKNMVLVPTVDTTIPHTVVGHFGGGEILLKPASAGSGVTA
RS5_LISMO       VVGDKNGHVGFGTGKAQEVPDAIRKAVEDAKKNMVLVPTVDTTIPHTVVGHFGGGEILLKPASAGSGVTA
RS5_LISMF       VVGDKNGHVGFGTGKAQEVPDAIRKAVEDAKKNMVLVPTVDTTIPHTVVGHFGGGEILLKPASAGSGVTA
RS5_LISIN       VVGDKNGHVGFGTGKAQEVPDAIRKAVEDAKKNMVFVPTVDTTIPHTVVGHFGGGEILLKPASAGSGVTA
RS5_ENTFA       VVGDKNGHVGFGTGKAQEVPEAIRKAIEDAKKNLVEVPMVGSTIPHEVIGVFGGGRILMKPAVEGSGVAA
RS5_DESHY       VVGDGQGNVGAGLGKAGEVPEAIRKGMEDAKKNMVSVPLIGTTIPHAILGNYGAGSVLLKPATKGTGVIA
RS5_KLEP7       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNHGTLQHPVKGTHTGSRVFMQPASEGTGIIA
RS5_ENTS8       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNHGTLQHPVKGAHTGSRVFMQPASEGTGIIA
RS5_ENT38       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNHGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_ANATD       VVGDENGHVGAGHGKAAEIPDAIRKAIEDAKKHLIEVPIVGTTIPHEAIGDFGASKVLIKPAPEGTGVIA
RS5_CALS8       VVGDENGHVGAGHGKAAEIPDAIRKAIEDAKKHLIEVPIVGTTIPHEAIGDFGASKVLIKPAPEGTGVIA
RS5_ACTP2       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNEGTLQHPVKGSHTGSRVFMQPASEGTGIIA
RS5_HAEDU       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNEGTLQHPVKGSHTGSRVFMQPASEGTGIIA
RS5_DESRM       VVGDGNGHVGAGLGKAAEVPEAIRKGIEDAKKNMIKVPLNGTTITHQIQGRFGAGKVLMKPAAKGTGVIA
RS5_ACTSZ       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNDGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_ROSS1       XXXXXXXXXXXXXXKAAEVPEAIRKGVEAAKKNLIRVPLSGTTIPHEVQMEFAASKVRLLPAAPGTGVIA
RS5_BUCAP       VVGNGEGRVGFGYGKAREVPAAIQKAMEKARRNMVTIPLVNKTLQHSLKGSHTGSNIFMKPASDGTGIIA
RS5_SODGM       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMMNVALNSGTLQHPIKGVHTGSRVFMQPASEGTGIIA
RS5_PASMU       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNEGTLQHPIKGAHTGSRVFMQPASEGTGIIA
RS5_HALHL       VVGDGEGRVGFGYGKAREVPAAIQKAMERARGGMRTVPLDGPTLRYPVTHFHGSSKVFMKPASPGTGIIA
RS5_HAES2       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMITVALNEGTLQHPIKGSHTGSRVFMQPASEGTGIIA
RS5_HAES1       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMITVALNEGTLQHPIKGSHTGSRVFMQPASEGTGIIA
RS5_HAEIN       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNEGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_HAEIG       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNEGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_HAEIE       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNEGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_HAEI8       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALNEGTLQHPVKGVHTGSRVFMQPASEGTGIIA
RS5_TOLAT       VVGDGSGRVGFGYGKAREVPAAIQKAMEQARRNMVKVELIEGTLHHHVKGTHAGSTVFMQPASQGTGIIA
RS5_SHELP       XXXXXXXXXXXXXXXAREVPAAIQKAMEKARRNIVSVELVNGTLHHPVKGRHTGSRVYMQPASEGTGIIA
RS5_NATTJ       VVGDENGYVGAGNGKAVEVPEAIRKGIEDAKKNLIKVPMVGTTIPHEIVGRDGGGQVLLKPAYEGTGVIA
RS5_MANSM       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVALHEGTLQHPVKGIHTGSRVFMQPASEGTGIIA
RS5_SHEAM       XXXXXXXXXXXXXXKAREVPAAIQKAMEKARRNMVTVELNEGTLHHPVKGRHTGSRVYMQPASQGTGIIA
RS5_MYXXD       XXXXXXXXXXXXXXKANEVPEAIRKGGENAKKNLFRVPLVGHTIPHEVLGHFGAGWVLLKPATQGTGVIA
RS5_BUCAI       VVGNGDGKVGFGYGKAREVPAAIQKAMEQARRNMITIPLVNKTLQHSLKGSHTGSNVFMKPASDGTGIIA
RS5_ANADE       XXXXXXXXXXXXXXKANEVPEAIRKGGDQAKKNLFRVPLVGTTIPHEVLGHFGSGRVLLKPAGEGTGVIA
RS5_PARDP       VVGDQRGRVGFGKGKAKEVPEAIRKATEQAKRSLIRVPLRDGTLHHDIEGRHGAGKVIMRTAVPGTGIIA
RS5_YERPS       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRAMINVALNNGTLQHPVKGAHTGSRVFMQPASEGTGIIA
RS5_YERPP       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRAMINVALNNGTLQHPVKGAHTGSRVFMQPASEGTGIIA
RS5_YERPN       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRAMINVALNNGTLQHPVKGAHTGSRVFMQPASEGTGIIA
RS5_YERPE       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRAMINVALNNGTLQHPVKGAHTGSRVFMQPASEGTGIIA
RS5_YERPA       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRAMINVALNNGTLQHPVKGAHTGSRVFMQPASEGTGIIA
RS5_YERP3       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRAMINVALNNGTLQHPVKGAHTGSRVFMQPASEGTGIIA
RS5_YERE8       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRAMINVALDNGTLQHPVKGAHTGSRVFMQPASEGTGIIA
RS5_PHOLL       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMKTVALNSGTLYHPVKGAHTGSRVFMQPAHEGTGIIA
RS5_ALTMD       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMVDVDLNGHTLQHPIKGRHSGSKVYMQPASEGTGIIA
RS5_SALRD       VVGNEDGLVGTGLGKANEVSSAISKGADDAKKNVIRVPMRDGTIPHKVVGKQDAGKVLLKPASPGTGVIA
RS5_PSYCK       XXXXXXXXXXXXXXKAREVPAAIQKALEAAKRNMITVELNDATLYHPIKARHGASKVYMQPASEGTGVIA
RS5_PSYA2       XXXXXXXXXXXXXXKAREVPAAIQKALEAAKRNMITVELNDATLYHPIKARHGASKVYMQPASEGTGVIA
RS5_PSEHT       VVGDGAGKVGFGYGKAREVPAAIQKAMEKARRNMINVDLNGNTLQHPVKGRHAGSQVFMKPASEGTGIIA
RS5_SYMTH       XXXXXXXXXXXXXXKAAEIPEAVRKGTEDAKKHMIKIPLNGTTIPHEVIGRFGAGKVLLKPASPGTGVIA
RS5_GEOMG       VVGDGSGFVGYGLGKANEVPEAIRKGVEQAKKNLIKVPIVEGTIPYEVLGHFGAGRVLIKPASAGTGVIA
RS5_AERS4       XXXXXXXXXXXXXXKAREVPAAIQKAMEQAKRNLSKVELNNGTLHHPVRGVHSGSSVFMKPASQGTGIIA
RS5_AERHH       XXXXXXXXXXXXXXKAREVPAAIQKAMEQAKRNLNKVELNNGTLHHPVRGVHSGSTVFMKPASQGTGIIA
RS5_PSEMY       XXXXXXXXXXXXXXXSREVPAAIQKAMEAARRNMIQVDLNGTTLQYPIKSAHGASKVYMQPASEGTGIIA
RS5_HAHCH       VVGDGNGKVGFGRGKAREVPVAIQKAMDAARKNMITVTLNGNTLQYPVKARHGSAKVFMQPASEGTGIIA
RS5_AZOVD       XXXXXXXXXXXXXXXSREVPAAIQKAMEAARRNMIQVDLSGTTLQYPVKSAHGASRVYMQPASEGTGIIA
RS5_ACIBY       XXXXXXXXXXXXXXKAREVPAAISKALEAARRNMITVDLAGTTLQHPVNARHGASRVYMQPASEGTGVIA
RS5_ACIBT       XXXXXXXXXXXXXXKAREVPAAISKALEAARRNMITVDLAGTTLQHPVNARHGASRVYMQPASEGTGVIA
RS5_ACIBS       XXXXXXXXXXXXXXKAREVPAAISKALEAARRNMITVDLAGTTLQHPVNARHGASRVYMQPASEGTGVIA
RS5_ACIBC       XXXXXXXXXXXXXXKAREVPAAISKALEAARRNMITVDLAGTTLQHPVNARHGASRVYMQPASEGTGVIA
RS5_ACIB5       XXXXXXXXXXXXXXKAREVPAAISKALEAARRNMITVDLAGTTLQHPVNARHGASRVYMQPASEGTGVIA
RS5_ACIB3       XXXXXXXXXXXXXXKAREVPAAISKALEAARRNMITVDLAGTTLQHPVNARHGASRVYMQPASEGTGVIA
RS5_VIBVY       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMVTIALNEGTLHHPVKGRHSGSKVYMQPAAEGTGVIA
RS5_VIBVU       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMVTIALNEGTLHHPVKGRHSGSKVYMQPAAEGTGVIA
RS5_VIBPA       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMTTIALNEGTLHHPVKGRHSGSKVYMQPAAEGTGVIA
RS5_VIBHB       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMTTIALNEGTLHHPVKGRHSGSKVYMQPAAEGTGVIA
RS5_SHEB9       VVXXXXXXXXXXXXXAREVPAAIQKAMEKARRNIVTVELNAGTLHHPVKGRHTGSLVYMQPASQGTGIIA
RS5_SHEB8       VVXXXXXXXXXXXXXAREVPAAIQKAMEKARRNIVTVELNAGTLHHPVKGRHTGSLVYMQPASQGTGIIA
RS5_SHEB5       VVXXXXXXXXXXXXXAREVPAAIQKAMEKARRNIVTVELNAGTLHHPVKGRHTGSLVYMQPASQGTGIIA
RS5_SHEB2       VVXXXXXXXXXXXXXAREVPAAIQKAMEKARRNIVTVELNAGTLHHPVKGRHTGSLVYMQPASQGTGIIA
RS5_SERP5       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRAMINVALNSGTLQHPVKGAHTGSRVFMQPASEGTGIIA
RS5_PSEA6       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNLVDVDLNGNTLQHPIKGRHSGSKVYMQPASEGTGIIA
RS5_CHLSY       XXXXXXXXXXXXXXKAAEVPDAIRKGAEAAKRNLIRVPLVHATVPHEVVTKFAATKVMLRPAAPGTGVIA
RS5_CHLAD       XXXXXXXXXXXXXXKAAEVPDAIRKGAEAAKRNLIRVPLVHSTIPHEIVTKFAATKVMLRPAAPGTGVIA
RS5_CHLAA       XXXXXXXXXXXXXXKAAEVPDAIRKGAEAAKRNLIRVPLVHATVPHEVVTKFAATKVMLRPAAPGTGVIA
RS5_SYNFM       VVGDGNGRVGFSLGKANEVPEAIRKGMESAKRTMFEVPLVNATIPHEVLGRFGAASVVLKPASAGTGVIA
RS5_PELCD       VVGDGQGIVGYGHGKAKEVPEAIRKGVEQAKKNLIRVPLKDRSIPFDVIGKFGAGRVLLKPASAGTGVIA
RS5_MOOTA       VVGDGKGHVGAGLGKASEVPEAIRKGIEDAKKNLIKVPMVGTTIPHEIIGHFGAGKVLLKPAAPGTGVIA
RS5_CYTH3       XXXXXXXXXXXXLGKANEVTDAITKAIDDAKKNLIKVPVINGTLPHEMIGKYSGGFVFVKPAAPGTGVIA
RS5_XANOR       VVGDGLGKVGFGYGKAREVPVAIQKSMEQARKNLATVDLNNGTLWHAVKSGHGAARVYMQPASEGTGVIA
RS5_XANOP       VVGDGLGKVGFGYGKAREVPVAIQKSMEQARKNLATVDLNNGTLWHAVKSGHGAARVYMQPASEGTGVIA
RS5_XANOM       VVGDGLGKVGFGYGKAREVPVAIQKSMEQARKNLATVDLNNGTLWHAVKSGHGAARVYMQPASEGTGVIA
RS5_XANCP       VVGDGLGKVGFGYGKAREVPVAIQKSMEQARKNLATVDLNNGTLWHAVKSGHGAARVYMQPASEGTGVIA
RS5_XANCB       VVGDGLGKVGFGYGKAREVPVAIQKSMEQARKNLATVDLNNGTLWHAVKSGHGAARVYMQPASEGTGVIA
RS5_XANC8       VVGDGLGKVGFGYGKAREVPVAIQKSMEQARKNLATVDLNNGTLWHAVKSGHGAARVYMQPASEGTGVIA
RS5_XANC5       VVGDGLGKVGFGYGKAREVPVAIQKSMEQARKNLATVDLNNGTLWHAVKSGHGAARVYMQPASEGTGVIA
RS5_XANAC       VVGDGLGKVGFGYGKAREVPVAIQKSMEQARKNLATVDLNNGTLWHAVKSGHGAARVYMQPASEGTGVIA
RS5_CLOAB       VVGDENGHVGVGTGKSAEIPEAIRKGIEDAKKNLVEVAIVGTTVPHEIYGEFGTGRVLIMPASEGTGVIA
RS5_XYLFM       IVGNGEGSVGFGYGKAREVPVAIQKSMEYARKRMANVSLNNGTLWHPVKANHGAASVFMKPASEGTGVIA
RS5_VIBSL       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMVTVALNEGTLHHPVKGRHSGSKVYMQPAAEGTGVIA
RS5_SYNAS       VVGDGNGSVGAGLGKAHEVPEAIRKGMEQAKKSMTKIEIEKGTIPYEVIGKFGAGRVLLKPASEGTGLIA
RS5_PSYIN       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNIRDVQLKGNTLQHPIKGRHSGSKVYMQPASEGTGIIA
RS5_PSEAE       XXXXXXXXXXXXXXXAREVPAAIQKAMEAARRNMIQVDLNGTTLQYPTKSAHGASKVYMQPASEGTGIIA
RS5_PSEAB       XXXXXXXXXXXXXXXAREVPAAIQKAMEAARRNMIQVDLNGTTLQYPTKSAHGASKVYMQPASEGTGIIA
RS5_PSEA8       XXXXXXXXXXXXXXXAREVPAAIQKAMEAARRNMIQVDLNGTTLQYPTKSAHGASKVYMQPASEGTGIIA
RS5_PSEA7       XXXXXXXXXXXXXXXAREVPAAIQKAMEAARRNMIQVDLNGTTLQYPTKSAHGASKVYMQPASEGTGIIA
RS5_ALCBS       XXXXXXXXXXXXXXXAREVPAAIQKALEAARRNMIQVELNGTTIQHPMKARHGASKVYMQPADEGTGVIA
RS5_XYLFA       IVGNGEGSVGFGYGKAREVPVAIQKSMEYARKTMANVSLNNGTLWHPVKANHGAACVFMKPASEGTGVIA
RS5_VIBCM       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRSMVTIALNEGTLHHPVKGRHSGSKVYMQPAAEGTGVIA
RS5_VIBCH       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRSMVTIALNEGTLHHPVKGRHSGSKVYMQPAAEGTGVIA
RS5_VIBC3       VVGDGNGRVGFGYGKAREVPAAIQKAMEKARRSMVTIALNEGTLHHPVKGRHSGSKVYMQPAAEGTGVIA
RS5_SHESW       VVXXXXXXXXXXXXXAREVPAAIQKAMEKARRNMVTVELNAGTLHHPVKGRHTGSRVYMQPASQGTGIIA
RS5_SHESR       XXXXXXXXXXXXXXXAREVPAAIQKAMEKARRNMVTVELNAGTLHHPVKGRHTGSRVYMQPASQGTGIIA
RS5_SHESM       XXXXXXXXXXXXXXXAREVPAAIQKAMEKARRNMVTVELNAGTLHHPVKGRHTGSRVYMQPASQGTGIIA
RS5_SHESA       XXXXXXXXXXXXXXXAREVPAAIQKAMEKARRNMVTVELNAGTLHHPVKGRHTGSRVYMQPASQGTGIIA
RS5_SHEPC       VVXXXXXXXXXXXXXAREVPAAIQKAMEKARRNMVTVELNAGTLHHPVKGRHTGSRVYMQPASQGTGIIA
RS5_SHEON       XXXXXXXXXXXXXXXAREVPAAIQKAMEKARRNMVTVELNAGTLHHPVKGRHTGSRVYMQPASQGTGIIA
RS5_PSEE4       XXXXXXXXXXXXXXXSREVPAAIQKAMEAARRNMIQVDLKGTTLQYATKAAHGASKVYMQPASEGTGIIA
RS5_IDILO       XXXXXXXXXXXXXXXAREVPAAIQKAMEKARRNMVTVQLKGDTLQHPVKGRHSGSQVYMQPASEGTGIIA
RS5_CHRSD       XXXXXXXXXXXXXXKAREVPVAIQKAMDQARRNMVKVSLSGATLQYPVKARHGASKVFMQPASEGTGIIA
RS5_BURS3       VVXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASAVLLAPAKAGTGVIA
RS5_BURPS       XXXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASTVLLAPAKDGTGVIA
RS5_BURP6       XXXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASTVLLAPAKDGTGVIA
RS5_BURP1       XXXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASTVLLAPAKDGTGVIA
RS5_BURP0       XXXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASTVLLAPAKDGTGVIA
RS5_BURMS       XXXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASTVLLAPAKDGTGVIA
RS5_BURMA       XXXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASTVLLAPAKDGTGVIA
RS5_BURM9       XXXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASTVLLAPAKDGTGVIA
RS5_BURM7       XXXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASTVLLAPAKDGTGVIA
RS5_BURM1       XXXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASTVLLAPAKDGTGVIA
RS5_BURCJ       VVXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASAVLLAPAKAGTGVIA
RS5_BORPD       VVXXXXXXXXXXXXXAREVPVSVQKAMEQARRGMFKVALKNGTLHHTVVGKHGASTVLISPAAEGTGVIA
RS5_THETN       VGDPDKGYVGVGRGKAAEIPDAIRKAIEDAKKHLIKVPVVGTTIPHEVIGEFGAGKVLLKPAREGTGVIA
RS5_SHEFN       VVXXXXXXXXXXXXXAREVPAAIQKAMEKARRNMVTVELNAGTLHHPVKGRHTGSKVYMQPASQGTGIIA
RS5_SHEDO       VVXXXXXXXXXXXXXAREVPAAIQKAMEKARRNMVTVELNAGTLHHPVKGRHTGSKVYMQPASQGTGIIA
RS5_LACBA       IVGDKNGHVGFGTGKAQEVPEAIRKAVEAARKNLIEVPIVGTTIPHEVLGTFGGGKIMLKPAAEGSGVTA
RS5_CHLP8       VVGDKEGHVGYGLGKANEVQDAIAKGVEDGKKNVIKVPIVKGTIPHPIVAKYGSAKVLMKPATPGTGLIA
RS5_BURTA       XXXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASTVLLAPAKDGTGVIA
RS5_BURPP       XXXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASMVLLAPAKDGTGVIA
RS5_STRMK       VVGDGEGKVGFGYGKAREVPVAIQKSMEQARKNLVSVDLNNGTLWHTIKDGHGAARVFMQPASEGTGVIA
RS5_STRM5       VVGDGEGKVGFGYGKAREVPVAIQKSMEQARKNLVSVDLNNGTLWHTIKDGHGAARVFMQPASEGTGVIA
RS5_COLP3       VVGDGNGRVGFGYGKAREVPAAIQKAMEKAHRNIVTIDLKGTTLQHVITGKHSGSKVFMKPASEGTGIIA
RS5_BURVG       VVXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASAVLLAPAKAGTGVIA
RS5_BURP8       XXXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASTVLLAPAKDGTGVIA
RS5_BURCM       VVXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASAVLLAPAKAGTGVIA
RS5_BURCH       VVXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASAVLLAPAKAGTGVIA
RS5_BURCC       VVXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASAVLLAPAKAGTGVIA
RS5_BURCA       VVXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASAVLLAPAKAGTGVIA
RS5_BURA4       VVXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASAVLLAPAKAGTGVIA
RS5_BORA1       VVXXXXXXXXXXXXXAREVPVSVQKAMEQARRGMFKVALKNGTLYHTVVGKHGASTVLISPAAEGTGVIA
RS5_ALISL       VVGDGNGRIGFGYGKAREVPAAIQKSMEKARRNMFTIALNEGTLHHAVKGRHTGSKVYMQPASEGTGIIA
RS5_XYLFT       IVGNGEGSVGFGYGKAREVPVAIQKSMEYARKRMSNVSLNNGTLWHPVKANHGAASVFMKPASEGTGVIA
RS5_XYLF2       IVGNGEGSVGFGYGKAREVPVAIQKSMEYARKRMSNVSLNNGTLWHPVKANHGAASVFMKPASEGTGVIA
RS5_LAWIP       VVGDGKGSVGFGLGKAQEVPEALRKATEQARKAMMKIPLIEGTLPYEILGEFGAGSVMLKPASRGTGIIA
RS5_BURXL       VVXXXXXXXXXXXXXAKEVPVAVQKAMEQARRNMFKVPLKNGTLQHEVHGKHGASAVLLAPAKDGTGVIA
RS5_ACIAD       XXXXXXXXXXXXXXKAREVPAAISKALEAARRNMITVDLAGTTLQHPVNARHGASRVYMQPASEGTGVIA
RS5_DESPS       VVGDGNGKVGYGLGKANQVPEAIRKGVERARKDMALVSLTDVSIPHQVIGHYGAGRVFLRPASAGTGLIA
RS5_BORPE       VVXXXXXXXXXXXXXAREVPVSVQKAMEQARRGMFKVALKNGTLHHTVVGKHGASTVLISPAAEGTGVIA
RS5_BORPA       VVXXXXXXXXXXXXXAREVPVSVQKAMEQARRGMFKVALKNGTLHHTVVGKHGASTVLISPAAEGTGVIA
RS5_BORBR       VVXXXXXXXXXXXXXAREVPVSVQKAMEQARRGMFKVALKNGTLHHTVVGKHGASTVLISPAAEGTGVIA
RS5_CLONN       VVGDENGHVGVGMGKAVEIPEAIRKGIEDAKKHLVEVAMVDTTVPHAIQGEFGRGRVLIMPATEGTGVIA
RS5_CHLTE       VVGDKEGHVGYGLGKANEVQDAIAKGVEDGKKNVIKVPIVKGTIPHPIVAKYGSAKVLMKPATPGTGLIA
RS5_ALKMQ       VVGDENGHVGVGTGKAMEIPDAIRKGIQAAKKNLLLVPTVGTTVPHEVIGHFGAGNVLIMPAKEGTGIIA
RS5_PSYWF       XXXXXXXXXXXXXXKAREVPAAIQKALEAAKRNMITVDLDGATLQHPIIARHGASKVYMQPANEGTGVIA
RS5_PSEU2       XXXXXXXXXXXXXXXSREVPAAIQKAMEAARRNMIQVDLNGTTLQYAMKSAHGASKVYMQPASEGTGIIA
RS5_PSESM       XXXXXXXXXXXXXXXSREVPAAIQKAMEAARRNMIQVDLNGTTLQYAMKSAHGASKVYMQPASEGTGIIA
RS5_PSEF5       XXXXXXXXXXXXXXXSREVPAAIQKAMEAARRNMIQVDLNGTTLQYAMKSAHGASKVYMQPASEGTGIIA
RS5_PHOPR       VVGDGNGRIGFGYGKAREVPAAIQKSMEKARRNMVTVALNEGTLHHAVKGRHTGSKVYMQPASEGTGIIA
RS5_THEPX       VGDAERGYVGVGRGKAAEIPDAIRKAIEDAKKHLIKVPIVGTTIPHEVIGEFGAGKVLLKPAREGTGVIA
RS5_THEP3       VGDAERGYVGVGRGKAAEIPDAIRKAIEDAKKHLIKVPIVGTTIPHEVIGEFGAGKVLLKPAREGTGVIA
RS5_ALKOO       IVGDENGYVGVGSGKAMEIPDAIRKGIEDAKKNLIHVPIVGTTVPHETIGIFGAGNVLIMPAKEGTGIIA
RS5_DESVV       VVGDGKGSVGFGLGKAQEVPEALRKATERAKKSMIEVPLIDGTLPYEILGRFGAGHVLLKPASKGTGIIA
RS5_DESVH       VVGDGKGSVGFGLGKAQEVPEALRKATERAKKSMIEVPLIDGTLPYEILGRFGAGHVLLKPASKGTGIIA
RS5_CHLT3       VVGDGEGHVGYGLGKANEVQDAIAKGIEDAKKNVIEVPIIKGTIPHQIFAKFGAAKVLMKPATPGTGLIA
RS5_THIDA       VVXXXXXXXXXXXXXSREVPVAVQKAMEEARRKLVKISLKNGTFHHTVVGQHGASRVLIQPASEGTGIIA
RS5_SILST       VVGDQKGRVGFGKGKAKEVPEAIRKATEQAKRQMIRVPLKEGTLHHDMYGRHGAGKVVMRTAPEGTGIIA
RS5_PSEU5       XXXXXXXXXXXXXXXSREVPAAIQKAMEAARRNMIQVDLNGTTLQYATKAAHGASKIYMQPASEGTGVIA
RS5_PSEPW       XXXXXXXXXXXXXXXSREVPAAIQKAMEAARRNMIQVDLKGTTLQYATKAAHGASKVYMQPASEGTGIIA
RS5_PSEPK       XXXXXXXXXXXXXXXSREVPAAIQKAMEAARRNMIQVDLKGTTLQYATKAAHGASKVYMQPASEGTGIIA
RS5_PSEPG       XXXXXXXXXXXXXXXSREVPAAIQKAMEAARRNMIQVDLKGTTLQYATKAAHGASKVYMQPASEGTGIIA
RS5_PSEP1       XXXXXXXXXXXXXXXSREVPAAIQKAMEAARRNMIQVDLKGTTLQYATKAAHGASKVYMQPASEGTGIIA
RS5_PSE14       XXXXXXXXXXXXXXXSREVPAAIQKAMEAARRNMIQVDLNCTTLQYAMKSAHGASKVYMQPASEGTGIIA
RS5_MARAV