[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF53649.1

[Show Plain Result]


## Summary of Sequence Search
    1::317
   90::390     4e-86  52%  420 aa  UXS1_RAT RecName: Full=UDP-glucuronic acid decarboxylase 1;        
   90::390     4e-86  52%  420 aa  UXS1_PONAB RecName: Full=UDP-glucuronic acid decarboxylase 1;      
   90::390     4e-86  52%  420 aa  UXS1_MOUSE RecName: Full=UDP-glucuronic acid decarboxylase 1;      
   90::390     4e-86  52%  420 aa  UXS1_HUMAN RecName: Full=UDP-glucuronic acid decarboxylase 1;      
   91::391     2e-84  51%  421 aa  UXS1_XENTR RecName: Full=UDP-glucuronic acid decarboxylase 1;      
   88::388     5e-79  50%  418 aa  UXS1_DANRE RecName: Full=UDP-glucuronic acid decarboxylase 1;      
    3::305     9e-33  33%  305 aa  GALE_METJA RecName: Full=Putative UDP-glucose 4-epimerase;       
    1::306     3e-27  32%  316 aa  YTCB_BACSU RecName: Full=Uncharacterized UDP-glucose epimerase
   19::330     2e-23  31%  355 aa  TGDS_MOUSE RecName: Full=dTDP-D-glucose 4,6-dehydratase;       
   19::333     2e-22  33%  355 aa  TGDS_BOVIN RecName: Full=dTDP-D-glucose 4,6-dehydratase;       
  319::653     2e-22  29%  663 aa  ARNA_AERS4 RecName: Full=Bifunctional polymyxin resistance protein
   19::333     3e-22  33%  350 aa  TGDS_HUMAN RecName: Full=dTDP-D-glucose 4,6-dehydratase;       
  317::652     6e-22  28%  660 aa  ARNA_SERP5 RecName: Full=Bifunctional polymyxin resistance protein
  317::648     2e-21  29%  660 aa  ARNA_PHOLL RecName: Full=Bifunctional polymyxin resistance protein
   30::352     3e-21  29%  378 aa  GME1_ORYSI RecName: Full=GDP-mannose 3,5-epimerase 1;       
    6::315     4e-21  27%  315 aa  SPSJ_BACSU RecName: Full=Spore coat polysaccharide biosynthesis
   30::352     4e-21  29%  378 aa  GME1_ORYSJ RecName: Full=GDP-mannose 3,5-epimerase 1;       
  316::648     5e-21  28%  660 aa  ARNA_SALTY RecName: Full=Bifunctional polymyxin resistance protein
  316::648     5e-21  28%  660 aa  ARNA_SALPC RecName: Full=Bifunctional polymyxin resistance protein
  316::648     5e-21  28%  660 aa  ARNA_SALPB RecName: Full=Bifunctional polymyxin resistance protein
  316::648     5e-21  28%  660 aa  ARNA_SALNS RecName: Full=Bifunctional polymyxin resistance protein
  316::648     5e-21  28%  660 aa  ARNA_SALHS RecName: Full=Bifunctional polymyxin resistance protein
  316::648     5e-21  28%  660 aa  ARNA_SALG2 RecName: Full=Bifunctional polymyxin resistance protein
  316::648     5e-21  28%  660 aa  ARNA_SALEP RecName: Full=Bifunctional polymyxin resistance protein
  316::648     5e-21  28%  660 aa  ARNA_SALDC RecName: Full=Bifunctional polymyxin resistance protein
  316::648     5e-21  28%  660 aa  ARNA_SALCH RecName: Full=Bifunctional polymyxin resistance protein
  316::648     5e-21  28%  660 aa  ARNA_SALA4 RecName: Full=Bifunctional polymyxin resistance protein
  317::652     1e-20  29%  660 aa  ARNA_SODGM RecName: Full=Bifunctional polymyxin resistance protein
    7::320     2e-20  29%  326 aa  Y1055_METJA RecName: Full=Uncharacterized protein MJ1055;
    1::335     2e-20  32%  339 aa  GALE_BACSU RecName: Full=UDP-glucose 4-epimerase;       
  319::654     2e-20  30%  660 aa  ARNA_SHESH RecName: Full=Bifunctional polymyxin resistance protein
  323::658     2e-20  28%  672 aa  ARNA_PECCP RecName: Full=Bifunctional polymyxin resistance protein
  324::659     2e-20  28%  673 aa  ARNA_ERWCT RecName: Full=Bifunctional polymyxin resistance protein
  317::652     2e-20  29%  660 aa  ARNA_ENT38 RecName: Full=Bifunctional polymyxin resistance protein
  317::652     2e-20  27%  660 aa  ARNA_ECOUT RecName: Full=Bifunctional polymyxin resistance protein
  317::652     2e-20  27%  660 aa  ARNA_ECOK1 RecName: Full=Bifunctional polymyxin resistance protein
  317::652     2e-20  27%  660 aa  ARNA_ECO45 RecName: Full=Bifunctional polymyxin resistance protein
  317::652     3e-20  27%  660 aa  ARNA_SHISS RecName: Full=Bifunctional polymyxin resistance protein
  316::648     3e-20  27%  660 aa  ARNA_SALSV RecName: Full=Bifunctional polymyxin resistance protein
  317::652     3e-20  27%  660 aa  ARNA_ECOSM RecName: Full=Bifunctional polymyxin resistance protein
  317::652     3e-20  27%  660 aa  ARNA_ECOLU RecName: Full=Bifunctional polymyxin resistance protein
  317::652     3e-20  27%  660 aa  ARNA_ECO81 RecName: Full=Bifunctional polymyxin resistance protein
  317::652     3e-20  27%  660 aa  ARNA_ECO7I RecName: Full=Bifunctional polymyxin resistance protein
  317::652     3e-20  27%  660 aa  ARNA_ECO27 RecName: Full=Bifunctional polymyxin resistance protein
  319::653     3e-20  27%  663 aa  ARNA_AERHH RecName: Full=Bifunctional polymyxin resistance protein
  317::652     4e-20  27%  660 aa  ARNA_ESCF3 RecName: Full=Bifunctional polymyxin resistance protein
  317::652     4e-20  27%  660 aa  ARNA_ECOL6 RecName: Full=Bifunctional polymyxin resistance protein
   12::330     7e-20  29%  667 aa  RHM2_ARATH RecName: Full=Probable rhamnose biosynthetic enzyme 2;  
    1::326     7e-20  30%  350 aa  RFBB_RHISN RecName: Full=Probable dTDP-glucose 4,6-dehydratase;    
  317::652     7e-20  27%  660 aa  ARNA_SHIDS RecName: Full=Bifunctional polymyxin resistance protein
  317::652     7e-20  27%  660 aa  ARNA_SHIBS RecName: Full=Bifunctional polymyxin resistance protein
  317::648     7e-20  27%  660 aa  ARNA_PROMH RecName: Full=Bifunctional polymyxin resistance protein
  317::652     7e-20  28%  660 aa  ARNA_ERWT9 RecName: Full=Bifunctional polymyxin resistance protein
  317::652     7e-20  27%  660 aa  ARNA_ECOSE RecName: Full=Bifunctional polymyxin resistance protein
  317::652     7e-20  27%  660 aa  ARNA_ECOLI RecName: Full=Bifunctional polymyxin resistance protein
  317::652     7e-20  27%  660 aa  ARNA_ECOLC RecName: Full=Bifunctional polymyxin resistance protein
  317::652     7e-20  27%  660 aa  ARNA_ECOL5 RecName: Full=Bifunctional polymyxin resistance protein
  317::652     7e-20  27%  660 aa  ARNA_ECOHS RecName: Full=Bifunctional polymyxin resistance protein
  317::652     7e-20  27%  660 aa  ARNA_ECODH RecName: Full=Bifunctional polymyxin resistance protein
  317::652     7e-20  27%  660 aa  ARNA_ECOBW RecName: Full=Bifunctional polymyxin resistance protein
  317::652     7e-20  27%  660 aa  ARNA_ECO8A RecName: Full=Bifunctional polymyxin resistance protein
  317::652     7e-20  27%  660 aa  ARNA_ECO5E RecName: Full=Bifunctional polymyxin resistance protein
  317::652     7e-20  27%  660 aa  ARNA_ECO57 RecName: Full=Bifunctional polymyxin resistance protein
  317::652     7e-20  27%  660 aa  ARNA_ECO55 RecName: Full=Bifunctional polymyxin resistance protein
  317::652     7e-20  27%  660 aa  ARNA_ECO24 RecName: Full=Bifunctional polymyxin resistance protein
   10::340     9e-20  30%  346 aa  RFBB_NEIGO RecName: Full=dTDP-glucose 4,6-dehydratase;       
  183::518     9e-20  27%  526 aa  ARNA_SHIB3 RecName: Full=Putative bifunctional polymyxin resistance
   23::345     1e-19  28%  371 aa  GME2_ORYSJ RecName: Full=GDP-mannose 3,5-epimerase 2;       
  316::648     1e-19  27%  660 aa  ARNA_SALTI RecName: Full=Bifunctional polymyxin resistance protein
  316::648     1e-19  27%  660 aa  ARNA_SALPK RecName: Full=Bifunctional polymyxin resistance protein
  316::648     1e-19  27%  660 aa  ARNA_SALPA RecName: Full=Bifunctional polymyxin resistance protein
   28::351     2e-19  28%  377 aa  GME_ARATH RecName: Full=GDP-mannose 3,5-epimerase;       
    3::335     2e-19  30%  341 aa  RFBB_NEIMA RecName: Full=dTDP-glucose 4,6-dehydratase;       
    1::330     3e-19  26%  330 aa  GALE_LACHE RecName: Full=UDP-glucose 4-epimerase;       
    1::327     3e-19  28%  334 aa  GALE_BACHD RecName: Full=UDP-glucose 4-epimerase;       
    2::332     6e-19  29%  338 aa  RFFG_HAEIN RecName: Full=dTDP-glucose 4,6-dehydratase;       
    3::335     6e-19  29%  355 aa  RFBB_NEIMB RecName: Full=dTDP-glucose 4,6-dehydratase;       
  317::648     6e-19  28%  667 aa  ARNA_YERPY RecName: Full=Bifunctional polymyxin resistance protein
  317::648     6e-19  28%  667 aa  ARNA_YERPS RecName: Full=Bifunctional polymyxin resistance protein
  317::648     6e-19  28%  667 aa  ARNA_YERPP RecName: Full=Bifunctional polymyxin resistance protein
  317::648     6e-19  28%  667 aa  ARNA_YERPN RecName: Full=Bifunctional polymyxin resistance protein
  317::648     6e-19  28%  667 aa  ARNA_YERPG RecName: Full=Bifunctional polymyxin resistance protein
  317::648     6e-19  28%  667 aa  ARNA_YERPE RecName: Full=Bifunctional polymyxin resistance protein
  317::648     6e-19  28%  667 aa  ARNA_YERPB RecName: Full=Bifunctional polymyxin resistance protein
  317::648     6e-19  28%  667 aa  ARNA_YERPA RecName: Full=Bifunctional polymyxin resistance protein
  317::648     6e-19  28%  667 aa  ARNA_YERP3 RecName: Full=Bifunctional polymyxin resistance protein
    1::335     8e-19  29%  361 aa  RFBB_SALTY RecName: Full=dTDP-glucose 4,6-dehydratase;       
  317::652     8e-19  26%  660 aa  ARNA_SHIF8 RecName: Full=Bifunctional polymyxin resistance protein
  319::643     8e-19  30%  662 aa  ARNA_PSEAB RecName: Full=Bifunctional polymyxin resistance protein
  317::652     1e-18  26%  660 aa  ARNA_SHIFL RecName: Full=Bifunctional polymyxin resistance protein
  319::643     1e-18  29%  662 aa  ARNA_PSEAE RecName: Full=Bifunctional polymyxin resistance protein
  319::643     1e-18  29%  662 aa  ARNA_PSEA8 RecName: Full=Bifunctional polymyxin resistance protein
  320::638     1e-18  29%  663 aa  ARNA_PSEFS RecName: Full=Bifunctional polymyxin resistance protein
    3::335     2e-18  28%  355 aa  RFFG_ECOLI RecName: Full=dTDP-glucose 4,6-dehydratase;       
   11::318     3e-18  27%  322 aa  YFNG_BACSU RecName: Full=Putative sugar dehydratase/epimerase yfnG;
  320::638     3e-18  30%  668 aa  ARNA_PSEPF RecName: Full=Bifunctional polymyxin resistance protein
  319::643     3e-18  29%  662 aa  ARNA_PSEA7 RecName: Full=Bifunctional polymyxin resistance protein
    1::336     5e-18  32%  338 aa  GALE_PASHA RecName: Full=UDP-glucose 4-epimerase;       
  320::638     5e-18  29%  668 aa  ARNA_PSEF5 RecName: Full=Bifunctional polymyxin resistance protein
    3::314     6e-18  29%  339 aa  GALE_NEIMC RecName: Full=UDP-glucose 4-epimerase;       
   17::343     8e-18  29%  348 aa  VIPB_SALTI RecName: Full=Vi polysaccharide biosynthesis protein
  317::659     8e-18  27%  661 aa  ARNA_KLEP7 RecName: Full=Bifunctional polymyxin resistance protein
    5::331     1e-17  28%  351 aa  RFBB_XANCB RecName: Full=dTDP-glucose 4,6-dehydratase;       
    1::338     2e-17  29%  338 aa  GALE_HAEIN RecName: Full=UDP-glucose 4-epimerase;       
  317::659     2e-17  27%  661 aa  ARNA_KLEP3 RecName: Full=Bifunctional polymyxin resistance protein
    5::331     3e-17  28%  351 aa  RFBB_XANCP RecName: Full=dTDP-glucose 4,6-dehydratase;       
  317::648     3e-17  27%  687 aa  ARNA_YERE8 RecName: Full=Bifunctional polymyxin resistance protein
    1::311     4e-17  28%  320 aa  ACBB_ACTS5 RecName: Full=dTDP-glucose 4,6-dehydratase;       
    1::335     5e-17  29%  361 aa  RFBB_ECOLX RecName: Full=dTDP-glucose 4,6-dehydratase;       
    1::335     7e-17  28%  361 aa  RFBB_SHIFL RecName: Full=dTDP-glucose 4,6-dehydratase;       
    1::338     7e-17  27%  338 aa  GALE_YERPE RecName: Full=UDP-glucose 4-epimerase;       
   10::328     9e-17  26%  669 aa  RHM1_ARATH RecName: Full=Probable rhamnose biosynthetic enzyme 1;  
    1::319     9e-17  30%  331 aa  GALE_LACCA RecName: Full=UDP-glucose 4-epimerase;       
    3::314     1e-16  29%  339 aa  GALE_NEIMB RecName: Full=UDP-glucose 4-epimerase;       
    1::338     1e-16  26%  338 aa  GALE_ECOLI RecName: Full=UDP-glucose 4-epimerase;       
    1::338     2e-16  27%  338 aa  GALE_SALTY RecName: Full=UDP-glucose 4-epimerase;       
  320::636     2e-16  29%  663 aa  ARNA_PSE14 RecName: Full=Bifunctional polymyxin resistance protein
    1::334     3e-16  26%  338 aa  RFBE_SALTI RecName: Full=CDP-paratose 2-epimerase;       
    1::338     3e-16  26%  338 aa  GALE_SALTI RecName: Full=UDP-glucose 4-epimerase;       
    7::350     3e-16  27%  350 aa  GALE_DROME RecName: Full=Probable UDP-glucose 4-epimerase;       
    7::343     3e-16  27%  344 aa  GALE_DICDI RecName: Full=UDP-glucose 4-epimerase;       
  321::637     3e-16  29%  664 aa  ARNA_PSEU2 RecName: Full=Bifunctional polymyxin resistance protein
    5::314     4e-16  29%  339 aa  GALE_NEIMA RecName: Full=UDP-glucose 4-epimerase;       
    1::339     6e-16  29%  361 aa  RFBB_ECOLI RecName: Full=dTDP-glucose 4,6-dehydratase;       
   10::328     8e-16  26%  664 aa  RHM3_ARATH RecName: Full=Probable rhamnose biosynthetic enzyme 3;  
    6::309     2e-15  28%  328 aa  STRE_STRGR RecName: Full=dTDP-glucose 4,6-dehydratase;       
   61::321     3e-15  27%  328 aa  FCL1_ORYSJ RecName: Full=Probable GDP-L-fucose synthase 1;       
    1::330     3e-15  25%  334 aa  CAPI_STAAU RecName: Full=Protein capI;         EC=4.-.-.-;
    8::324     4e-15  26%  348 aa  RMLB_STRMU RecName: Full=dTDP-glucose 4,6-dehydratase;       
  316::633     7e-15  26%  654 aa  ARNA_WIGBR RecName: Full=Bifunctional polymyxin resistance protein
    3::336     1e-14  28%  347 aa  GALE_MOUSE RecName: Full=UDP-glucose 4-epimerase;       
    3::255     2e-14  31%  320 aa  HLDD_ALHEH RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::305     3e-14  30%  332 aa  GALE_STRTR RecName: Full=UDP-glucose 4-epimerase;       
    4::337     3e-14  29%  348 aa  GALE_HUMAN RecName: Full=UDP-glucose 4-epimerase;       
   11::275     4e-14  28%  434 aa  TGDS_DICDI RecName: Full=dTDP-D-glucose 4,6-dehydratase;       
   10::307     4e-14  26%  312 aa  FCL1_ARATH RecName: Full=GDP-L-fucose synthase 1;       
    1::327     6e-14  27%  334 aa  YCL2_ECO11 RecName: Full=Uncharacterized 37.6 kDa protein in cld
    3::270     6e-14  30%  323 aa  HLDD_THICR RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    4::337     6e-14  29%  348 aa  GALE_PONAB RecName: Full=UDP-glucose 4-epimerase;       
   24::321     6e-14  26%  328 aa  FCL2_ARATH RecName: Full=Putative GDP-L-fucose synthase 2;       
    1::299     7e-14  27%  328 aa  GALE_CORDI RecName: Full=UDP-glucose 4-epimerase;       
    3::253     1e-13  30%  319 aa  HLDD_AZOSE RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    7::334     1e-13  28%  350 aa  GALE2_CYATE RecName: Full=UDP-glucose 4-epimerase GEPI48;       
   10::337     1e-13  24%  348 aa  EXOB_AZOBR RecName: Full=UDP-glucose 4-epimerase;       
    1::335     3e-13  26%  341 aa  LPSL_RHIME RecName: Full=UDP-glucuronate 5'-epimerase;       
    1::338     4e-13  27%  338 aa  GALE_PASMU RecName: Full=UDP-glucose 4-epimerase;       
    1::338     4e-13  26%  338 aa  GALE_NEIGO RecName: Full=UDP-glucose 4-epimerase;       
    1::327     5e-13  33%  336 aa  GALE_YEREN RecName: Full=UDP-glucose 4-epimerase;       
    1::306     5e-13  26%  333 aa  GALE_STRMU RecName: Full=UDP-glucose 4-epimerase;       
    3::268     6e-13  29%  317 aa  HLDD_SHELP RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::274     6e-13  28%  323 aa  HLDD_DESVV RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::274     6e-13  28%  323 aa  HLDD_DESVH RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     6e-13  27%  318 aa  HLDD_BRAHW RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
   92::317     6e-13  26%  320 aa  FCL_DICDI RecName: Full=GDP-L-fucose synthetase;       
   98::426     1e-12  29%  436 aa  ARAE4_ARATH RecName: Full=Putative UDP-arabinose 4-epimerase 4;    
   13::362     1e-12  29%  365 aa  YHEB_SCHPO RecName: Full=Uncharacterized protein PB2B2.11;
    3::268     1e-12  29%  317 aa  HLDD_SHEPW RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::329     2e-12  28%  337 aa  GALE_ERWAM RecName: Full=UDP-glucose 4-epimerase;       
    3::271     2e-12  27%  315 aa  HLDD_PELCD RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    6::358     2e-12  29%  373 aa  GM4D_SHIFL RecName: Full=GDP-mannose 4,6-dehydratase;       
    6::358     2e-12  29%  373 aa  GM4D_ECOLI RecName: Full=GDP-mannose 4,6-dehydratase;       
    6::358     2e-12  29%  373 aa  GM4D_ECOL6 RecName: Full=GDP-mannose 4,6-dehydratase;       
    6::358     2e-12  29%  373 aa  GM4D_ECO57 RecName: Full=GDP-mannose 4,6-dehydratase;       
    6::333     3e-12  27%  350 aa  GALE3_ARATH RecName: Full=UDP-glucose 4-epimerase 3;       
   10::323     4e-12  27%  355 aa  YGRE_SCHPO RecName: Full=Uncharacterized protein C365.14c;
    3::275     4e-12  25%  319 aa  HLDD_AERS4 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
   53::363     4e-12  30%  391 aa  ARAE2_ORYSJ RecName: Full=Probable UDP-arabinose 4-epimerase 2;    
   12::232     5e-12  29%  439 aa  HSDD1_ARATH RecName:
    3::275     5e-12  25%  318 aa  HLDD_AERHH RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::357     5e-12  28%  372 aa  GM4D_YERE8 RecName: Full=Probable GDP-mannose 4,6-dehydratase;     
    4::336     5e-12  26%  347 aa  GALE_RAT RecName: Full=UDP-glucose 4-epimerase;       
    7::320     7e-12  30%  328 aa  EXOB_RHIME RecName: Full=UDP-glucose 4-epimerase;       
    6::303     9e-12  30%  329 aa  GALE_STRLI RecName: Full=UDP-glucose 4-epimerase;       
   94::419     9e-12  27%  430 aa  GAE3_ARATH RecName: Full=UDP-glucuronate 4-epimerase 3;       
   95::431     9e-12  26%  434 aa  GAE2_ARATH RecName: Full=UDP-glucuronate 4-epimerase 2;       
   74::384     9e-12  29%  419 aa  ARAE1_ARATH RecName: Full=UDP-arabinose 4-epimerase 1;       
    1::269     1e-11  31%  335 aa  HLDD_POLSJ RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::311     1e-11  28%  317 aa  HLDD_NITOC RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
   27::368     1e-11  33%  372 aa  GMDS_HUMAN RecName: Full=GDP-mannose 4,6 dehydratase;       
    7::349     1e-11  27%  350 aa  GALE1_PEA RecName: Full=UDP-glucose 4-epimerase;       
  100::425     1e-11  25%  437 aa  GAE4_ARATH RecName: Full=UDP-glucuronate 4-epimerase 4;       
   13::342     2e-11  31%  354 aa  GALE1_CYATE RecName: Full=UDP-glucose 4-epimerase GEPI42;       
   91::416     2e-11  25%  429 aa  GAE1_ARATH RecName: Full=UDP-glucuronate 4-epimerase 1;       
   73::409     2e-11  29%  411 aa  ARAE3_ARATH RecName: Full=Putative UDP-arabinose 4-epimerase 3;    
    3::251     3e-11  29%  325 aa  HLDD_AZOSB RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
   27::368     3e-11  32%  372 aa  GMDS_MOUSE RecName: Full=GDP-mannose 4,6 dehydratase;       
  102::336     3e-11  28%  347 aa  FCL2_ORYSJ RecName: Full=Putative GDP-L-fucose synthase 2;       
   27::368     4e-11  32%  372 aa  GMDS_CRIGR RecName: Full=GDP-mannose 4,6 dehydratase;       
   10::351     4e-11  25%  351 aa  GALE1_ARATH RecName: Full=UDP-glucose 4-epimerase 1;       
  115::440     4e-11  28%  460 aa  GAE6_ARATH RecName: Full=UDP-glucuronate 4-epimerase 6;       
   20::341     8e-11  27%  361 aa  GMD1_ARATH RecName: Full=GDP-mannose 4,6 dehydratase 1;       
    8::293     8e-11  25%  321 aa  FCL_HUMAN RecName: Full=GDP-L-fucose synthetase;       
    3::268     1e-10  28%  317 aa  HLDD_SHEFN RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::332     1e-10  27%  333 aa  HLDD_CHRVO RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
   32::353     1e-10  27%  373 aa  GMD2_ARATH RecName: Full=GDP-mannose 4,6 dehydratase 2;       
  101::316     1e-10  26%  321 aa  FCL_ECOLI RecName: Full=GDP-L-fucose synthetase;       
    8::325     2e-10  26%  351 aa  NOEL_RHISN RecName: Full=GDP-mannose 4,6-dehydratase;       
   12::356     2e-10  28%  564 aa  HSDD2_ARATH RecName:
    3::295     2e-10  30%  318 aa  HLDD_CHRSD RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    7::326     2e-10  29%  327 aa  EXOB_RHILT RecName: Full=UDP-glucose 4-epimerase;       
   73::401     2e-10  27%  417 aa  ARAE2_ARATH RecName: Full=Putative UDP-arabinose 4-epimerase 2;    
    7::336     3e-10  24%  688 aa  GAL10_KLULA RecName: Full=Bifunctional protein GAL10;Includes:
   28::235     4e-10  28%  362 aa  NSDHL_MOUSE RecName: Full=Sterol-4-alpha-carboxylate
    1::327     4e-10  28%  339 aa  HLDD_POLNS RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::272     4e-10  28%  313 aa  HLDD_MARAV RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    8::325     5e-10  26%  351 aa  NOEL_RHIFR RecName: Full=GDP-mannose 4,6-dehydratase;       
    1::328     5e-10  28%  331 aa  HLDD_RALEH RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::276     6e-10  28%  330 aa  HLDD_PSEA7 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
   28::235     8e-10  27%  362 aa  NSDHL_RAT RecName: Full=Sterol-4-alpha-carboxylate 3-dehydrogenase,
   97::311     8e-10  25%  321 aa  FCL_MOUSE RecName: Full=GDP-L-fucose synthetase;       
   67::403     8e-10  29%  406 aa  ARAE3_ORYSJ RecName: Full=Probable UDP-arabinose 4-epimerase 3;    
   22::229     1e-09  27%  356 aa  NSDHL_BOVIN RecName: Full=Sterol-4-alpha-carboxylate
   15::355     1e-09  24%  699 aa  GAL10_YEAST RecName: Full=Bifunctional protein GAL10;Includes:
   20::299     2e-09  26%  329 aa  GALE_CORGL RecName: Full=UDP-glucose 4-epimerase;       
   97::293     2e-09  27%  321 aa  FCL_PONAB RecName: Full=GDP-L-fucose synthetase;       
   76::388     2e-09  28%  421 aa  ARAE1_ORYSJ RecName: Full=Probable UDP-arabinose 4-epimerase 1;    
    3::304     2e-09  26%  309 aa  HLDD_EDWI9 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    7::311     3e-09  27%  340 aa  GALE_MYCGE RecName: Full=UDP-glucose 4-epimerase;       
    1::328     5e-09  28%  331 aa  HLDD_CUPTR RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::232     7e-09  29%  313 aa  HLDD_VIBVY RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::232     7e-09  29%  313 aa  HLDD_VIBVU RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    6::244     7e-09  28%  332 aa  HLDD_THIDA RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::334     7e-09  27%  340 aa  HLDD_RHOFD RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::266     7e-09  26%  310 aa  HLDD_PASMU RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    7::359     7e-09  28%  373 aa  GM4D1_VIBCH RecName: Full=Probable GDP-mannose 4,6-dehydratase;    
    9::343     7e-09  29%  713 aa  GAL10_SCHPO RecName: Full=Bifunctional protein gal10;Includes:
   97::293     7e-09  27%  321 aa  FCL_CRIGR RecName: Full=GDP-L-fucose synthetase;       
   39::246     1e-08  26%  373 aa  NSDHL_HUMAN RecName: Full=Sterol-4-alpha-carboxylate
    3::305     2e-08  26%  309 aa  HLDD_HAMD5 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    9::251     2e-08  31%  356 aa  GMDS_DICDI RecName: Full=GDP-mannose 4,6 dehydratase;       
   99::422     2e-08  27%  436 aa  GAE5_ARATH RecName: Full=UDP-glucuronate 4-epimerase 5;       
    3::232     2e-08  24%  313 aa  HLDD_VIBF1 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::282     2e-08  27%  332 aa  HLDD_BORA1 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
   50::390     3e-08  26%  395 aa  GMDS_DROME RecName: Full=GDP-mannose 4,6 dehydratase;       
    1::279     4e-08  28%  335 aa  HLDD_POLNA RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::331     4e-08  24%  334 aa  HLDD_NEIMA RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::232     5e-08  24%  313 aa  HLDD_VIBFM RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::331     5e-08  24%  334 aa  HLDD_NEIM0 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     6e-08  25%  310 aa  HLDD_SALPC RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     6e-08  25%  310 aa  HLDD_SALCH RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    4::358     8e-08  26%  372 aa  GM4D2_VIBCH RecName: Full=Probable GDP-mannose 4,6-dehydratase;    
    3::305     1e-07  23%  310 aa  HLDD_SODGM RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::328     1e-07  26%  331 aa  HLDD_RALEJ RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::331     1e-07  24%  334 aa  HLDD_NEIMB RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::331     1e-07  24%  334 aa  HLDD_NEIMF RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
  120::313     1e-07  28%  323 aa  GM4D_PSEAE RecName: Full=GDP-mannose 4,6-dehydratase;       
    3::305     2e-07  25%  310 aa  HLDD_SALG2 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     2e-07  25%  310 aa  HLDD_SALEP RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     2e-07  25%  310 aa  HLDD_SALDC RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::257     2e-07  29%  331 aa  HLDD_RALPJ RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::253     2e-07  25%  311 aa  HLDD_PSYIN RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::307     2e-07  23%  312 aa  HLDD_PHOLL RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::138     2e-07  25%  139 aa  GALE_KLEPN RecName: Full=UDP-glucose 4-epimerase;       
    3::250     3e-07  25%  312 aa  HLDD_PROMH RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::304     3e-07  25%  308 aa  HLDD_HAEIG RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::304     3e-07  25%  308 aa  HLDD_HAEI8 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    7::334     3e-07  27%  351 aa  GALE2_ARATH RecName: Full=UDP-glucose 4-epimerase 2;       
    3::304     4e-07  25%  308 aa  HLDD_HAEIN RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::325     4e-07  28%  330 aa  HLDD_BURP8 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     5e-07  25%  310 aa  HLDD_SALTY RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     5e-07  25%  310 aa  HLDD_SALTI RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     5e-07  25%  310 aa  HLDD_SALSV RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     5e-07  25%  310 aa  HLDD_SALPK RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     5e-07  25%  310 aa  HLDD_SALPB RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     5e-07  25%  310 aa  HLDD_SALPA RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     5e-07  25%  310 aa  HLDD_SALNS RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     5e-07  25%  310 aa  HLDD_SALHS RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     5e-07  25%  310 aa  HLDD_SALAR RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     5e-07  25%  310 aa  HLDD_SALA4 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::173     1e-06  30%  330 aa  HLDD_PSEAE RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::257     1e-06  29%  330 aa  HLDD_BURVG RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::257     1e-06  30%  330 aa  HLDD_BURM1 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::257     1e-06  29%  330 aa  HLDD_BURCM RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::257     1e-06  29%  330 aa  HLDD_BURA4 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    5::293     1e-06  26%  323 aa  TGDS_MIMIV RecName: Full=Putative dTDP-D-glucose 4,6-dehydratase;  
    3::232     1e-06  29%  283 aa  SPSK_BACSU RecName: Full=Spore coat polysaccharide biosynthesis
    3::265     1e-06  26%  310 aa  HLDD_ECOSM RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
   90::314     1e-06  25%  321 aa  FCL_DROME RecName: Full=Probable GDP-L-fucose synthetase;       
    1::122     2e-06  30%  303 aa  YFHF_BACSU RecName: Full=Epimerase family protein yfhF;
    3::230     2e-06  26%  314 aa  HLDD_VIBCM RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::230     2e-06  26%  314 aa  HLDD_VIBCH RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::230     2e-06  26%  314 aa  HLDD_VIBC3 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::173     2e-06  30%  330 aa  HLDD_PSEAB RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::262     3e-06  28%  331 aa  HLDD_RALME RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     3e-06  24%  310 aa  HLDD_ENTS8 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
  150::300     4e-06  27%  314 aa  Y4AF_RHISN RecName: Full=Uncharacterized protein y4aF;
    3::265     4e-06  26%  310 aa  HLDD_SHISS RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_SHIFL RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_SHIF8 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_SHIDS RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_SHIBS RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_SHIB3 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::272     4e-06  26%  331 aa  HLDD_RALSO RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::249     4e-06  25%  308 aa  HLDD_MANSM RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     4e-06  25%  310 aa  HLDD_KLEP7 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     4e-06  25%  310 aa  HLDD_KLEP3 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ESCF3 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECOUT RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECOSE RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECOLU RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECOLI RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECOL6 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECOL5 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECOK1 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECODH RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECOBW RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECO8A RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECO81 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECO7I RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECO5E RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECO57 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECO55 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECO45 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECO27 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     4e-06  26%  310 aa  HLDD_ECO24 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::257     4e-06  27%  330 aa  HLDD_BURS3 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::257     4e-06  29%  330 aa  HLDD_BURCH RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::257     4e-06  29%  330 aa  HLDD_BURCC RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::257     4e-06  29%  330 aa  HLDD_BURCA RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
   37::369     4e-06  28%  382 aa  GMD2_CAEEL RecName: Full=GDP-mannose 4,6 dehydratase 2;       
    1::139     6e-06  33%  164 aa  YGAE_ERWAM RecName: Full=Uncharacterized protein in galE
    3::265     6e-06  27%  309 aa  HLDD_ENT38 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     6e-06  24%  310 aa  HLDD_CITK8 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::257     6e-06  29%  330 aa  HLDD_BURCJ RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     7e-06  22%  310 aa  HLDD_YERE8 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     7e-06  25%  310 aa  HLDD_KLEPN RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    7::316     7e-06  26%  338 aa  GALE_MYCPN RecName: Full=UDP-glucose 4-epimerase;       
    3::305     1e-05  22%  310 aa  HLDD_YERPY RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     1e-05  22%  310 aa  HLDD_YERPS RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     1e-05  22%  310 aa  HLDD_YERPP RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     1e-05  22%  310 aa  HLDD_YERPN RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     1e-05  22%  310 aa  HLDD_YERPG RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     1e-05  22%  310 aa  HLDD_YERPE RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     1e-05  22%  310 aa  HLDD_YERPB RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     1e-05  22%  310 aa  HLDD_YERPA RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::305     1e-05  22%  310 aa  HLDD_YERP3 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::315     1e-05  25%  316 aa  HLDD_RHILO RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    5::229     1e-05  27%  299 aa  Y2119_STAHJ RecName: Full=Epimerase family protein SH2119;
    3::250     1e-05  25%  313 aa  HLDD_HAEDU RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     1e-05  26%  310 aa  HLDD_ECOLC RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    3::265     1e-05  26%  310 aa  HLDD_ECOHS RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
   53::359     2e-05  26%  396 aa  Y4NG_RHISN RecName: Full=Uncharacterized protein y4nG;
    1::237     4e-05  27%  297 aa  YFCH_ECOLI RecName: Full=Epimerase family protein yfcH;
   15::121     5e-05  24%  333 aa  Y1061_METJA RecName: Full=Uncharacterized membrane protein MJ1061;
    3::331     5e-05  26%  332 aa  HLDD_FUSNN RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::127     6e-05  29%  307 aa  Y1223_SYNY3 RecName: Full=Epimerase family protein slr1223;
    7::40      6e-05  44%  153 aa  GAL10_CANMA RecName: Full=Bifunctional protein GAL10;Includes:
    3::227     8e-05  25%  310 aa  HLDD_PECCP RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
   10::124     2e-04  31%  231 aa  Y2567_STAAR RecName: Full=Uncharacterized oxidoreductase SAR2567;  
    8::164     2e-04  28%  304 aa  STRL_STRGR RecName: Full=dTDP-4-dehydrorhamnose reductase;       
   10::124     3e-04  31%  231 aa  Y2778_STAA8 RecName: Full=Uncharacterized oxidoreductase
   10::124     3e-04  31%  231 aa  Y2488_STAAC RecName: Full=Uncharacterized oxidoreductase SACOL2488;
   10::124     3e-04  31%  231 aa  Y2422_STAA3 RecName: Full=Uncharacterized oxidoreductase
  165::325     3e-04  31%  330 aa  HLDD_BURPP RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::49      3e-04  53%  294 aa  D39U1_BOVIN RecName: Full=Epimerase family protein
    1::40      5e-04  38%  276 aa  YQJ9_SCHPO RecName: Full=Uncharacterized protein C1840.09;
    1::75      5e-04  31%  298 aa  YL056_YEAST RecName: Full=Uncharacterized protein YLL056C;
   10::124     5e-04  30%  231 aa  Y2478_STAAM RecName: Full=Uncharacterized oxidoreductase SAV2478;  
   10::124     5e-04  30%  231 aa  Y2266_STAAN RecName: Full=Uncharacterized oxidoreductase SA2266;   
    1::80      5e-04  33%  315 aa  Y1014_HAEIN RecName: Full=Uncharacterized protein HI1014;
    1::30      7e-04  50%  295 aa  YGI2_SCHPO RecName: Full=Uncharacterized protein C2A9.02;
   79::178     7e-04  29%  205 aa  RCP_VIBCH RecName: Full=Protein rcp;AltName: Full=Protein sulA;
   10::124     9e-04  30%  231 aa  Y2403_STAAW RecName: Full=Uncharacterized oxidoreductase MW2403;   
   10::124     9e-04  30%  231 aa  Y2370_STAAS RecName: Full=Uncharacterized oxidoreductase SAS2370;  
    1::28      9e-04  54%  854 aa  Y2073_MYCBO RecName: Full=Uncharacterized protein Mb2073c;
    1::28      9e-04  54%  854 aa  Y2047_MYCTU RecName: Full=Uncharacterized protein Rv2047c/MT2107;
  295::361     9e-04  40%  482 aa  SQD1_SPIOL RecName: Full=UDP-sulfoquinovose synthase,
    1::317

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRCVITGGAGFLGSHLTDLILNQGHEVIVLDDLSTGSLSNLFHQISNPRLQIKTVDVRKKFEIDGPVDIV
UXS1_RAT        -RILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIE--VDQI
UXS1_PONAB      -RILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIE--VDQI
UXS1_MOUSE      -RILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIE--VDQI
UXS1_HUMAN      -RILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIE--VDQI
UXS1_XENTR      -RILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIE--VDQI
UXS1_DANRE      -RILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIE--VDQI
GALE_METJA      ---LVTGGAGFIGSHIVDKLIENNYDVIILDNLTTGNKNNI-----NPKAEFVNADIRDK-DLDKDVEVV
YTCB_BACSU      MKILVTGAAGFIGSHLCELLKDKKHNVIGIDDFTPFSXXXXXXXXXXPEKRLLTADLASLLE---GVDVI
TGDS_MOUSE      -RVLVTGGAGFIASHVIVSLVEDDYMIVNLDKLDCASLKNL-EPVSNKQIQGDICDVKLLFEVE-KIDIV
TGDS_BOVIN      -RVLVTGGAGFIASHMIVSLVEDNYMIINLDKLDCASLKNL-ETISNKQIQGDICDVKLLFETE-KIDIV
ARNA_AERS4      -RVLILGVNGFIGNHLTERLLKDGRYEIYGLDISASALGRF---IDHPHFHFVEGDISIHTEIEYHIDVI
TGDS_HUMAN      -RVLVTGGAGFIASHMIVSLVEDNYMIINLDKLDCASLKNL-ETISNKQIQGDICDVKLLFETE-KIDIV
ARNA_SERP5      -RVLILGVNGFIGNHLTERLLRDDRYDIYGLDIGSDAISRF---LGNPRFHFVEGDISIHSEIEYHIDVI
ARNA_PHOLL      -RVLILGVNGFIGNHLTERLLRDGNYDIYGMDIGSSAIERF---ISNPRFHFIEGDINIHTEIEYHIDVV
GME1_ORYSI      LRISITGAGGFIGSHIARRLKSEGHYIIASDHMTEDMFCHEFHLVD-----LRVMD--NCLKVTNSVDHV
SPSJ_BACSU      ---LITGGAGFIGLTFTKLMLREDARITVLDKLTYASHPEEMEKLQNSRFRFVKGDISVQEDIDRAFDET
GME1_ORYSJ      LRISITGAGGFIGSHIARRLKSEGHYIIASDHMTEDMFCHEFHLVD-----LRVMD--NCLKVTNGVDHV
ARNA_SALTY      IRVLILGVNGFIGNHLTERLLNEENYEVYGMDIGSNAISRF---LLHPRFHFVEGDISIHSEIEYHVDVV
ARNA_SALPC      IRVLILGVNGFIGNHLTERLLNEENYEVYGMDIGSNAISRF---LLHPRFHFVEGDISIHSEIEYHVDVV
ARNA_SALPB      IRVLILGVNGFIGNHLTERLLNEENYEVYGMDIGSNAISRF---LLHPRFHFVEGDISIHSEIEYHVDVV
ARNA_SALNS      IRVLILGVNGFIGNHLTERLLNEENYEVYGMDIGSNAISRF---LLHPRFHFVEGDISIHSEIEYHVDVV
ARNA_SALHS      IRVLILGVNGFIGNHLTERLLNEENYEVYGMDIGSNAISRF---LLHPRFHFVEGDISIHSEIEYHVDVV
ARNA_SALG2      IRVLILGVNGFIGNHLTERLLNEENYEVYGMDIGSNAISRF---LLHPRFHFVEGDISIHSEIEYHVDVV
ARNA_SALEP      IRVLILGVNGFIGNHLTERLLNEENYEVYGMDIGSNAISRF---LLHPRFHFVEGDISIHSEIEYHVDVV
ARNA_SALDC      IRVLILGVNGFIGNHLTERLLNEENYEVYGMDIGSNAISRF---LLHPRFHFVEGDISIHSEIEYHVDVV
ARNA_SALCH      IRVLILGVNGFIGNHLTERLLNEENYEVYGMDIGSNAISRF---LLHPRFHFVEGDISIHSEIEYHVDVV
ARNA_SALA4      IRVLILGVNGFIGNHLTERLLNEENYEVYGMDIGSNAISRF---LLHPRFHFVEGDISIHSEIEYHVDVV
ARNA_SODGM      -RVLILGVNGFIGNHLTERLLRDGNYEIYGLDIGTDAISRF---MVNPLFHFVEGDISIHSEIEYHIDIV
Y1055_METJA     ---LVTGSAGFIGFHLSKYLMDN------YEDLKVIGIDNL-NNYYNPVLKEKRNEILKNYENDKEIDLI
GALE_BACSU      MAILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAENRVKEITGKDLTFYEADLLDREAVDNEIEAV
ARNA_SHESH      -KVLIMGANGFIGNHLTKRLLDDGKYEIYAMDMSS---SQIEQHLSHPDFHFVEGDITIHNEIEYHIDIV
ARNA_PECCP      -RVLILGVNGFIGNHLTERLLRDDRYEIYGLDISSDAIARF---LGDPRFHFVEGDISIHNEIEYHIDVI
ARNA_ERWCT      -RVLILGVNGFIGNHLTERLLRDDRYEIYGLDISSDAIARF---LGDPRFHFVEGDISIHNEIEYHIDVI
ARNA_ENT38      -RVLILGVNGFIGNHLTERLLQDDNFEVYGLDIGSDAISRF---IGNSRFHFVEGDISIHSEIEYHIDVV
ARNA_ECOUT      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_ECOK1      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_ECO45      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_SHISS      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_SALSV      IRVLILGVNGFIGNHLTERLLNEENYEVYGMDIGSNAISRF---LLHPRFHFVEGDISIHSEIEYHVDVV
ARNA_ECOSM      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_ECOLU      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_ECO81      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---MNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_ECO7I      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_ECO27      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_AERHH      -RVLILGVNGFIGNHLTERLLQDGGYEVYGLDIGSSAVDRF---IGHPNFHFVEGDISIHTEIEYHIDVI
ARNA_ESCF3      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LTHPNFHFVEGDISIHSEIEYHIDVV
ARNA_ECOL6      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---MNHPHFHFVEGDISIHSEIEYHVDVV
RHM2_ARATH      ---LITGAAGFIASHVANRLIRNDYKIVVLDKLDYCSLKNLDPSFSSPNFKIASDDLVNYLLITENIDTI
RFBB_RHISN      MRILVTGGAGFIGSALVRYLVSINAEVLNVDKLTAGNLASLVEGLRNYRFLCDRVAINEAFETFQP-DYV
ARNA_SHIDS      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_SHIBS      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_PROMH      -RVLILGVNGFIGNHLTERLLKDGNYDIYGMDIGSSAIERF---IGNPRFHFIEGDVSIHTEIEYHIDVI
ARNA_ERWT9      -RVLILGVNGFIGNHLTELLVDDNFEVFGLD-IGSDAIGRF---IGHERFHFVEGDISIHSEIEYHIDVV
ARNA_ECOSE      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_ECOLI      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_ECOLC      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_ECOL5      -RVLILGVNGFIGNHLTERLLCEDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_ECOHS      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_ECODH      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_ECOBW      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_ECO8A      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_ECO5E      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_ECO57      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_ECO55      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_ECO24      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
RFBB_NEIGO      ---LVTGGAGFIGSAVVHIIQNTRDSVVNLDKLTAGNLESLTDIADNPRYAFEQVDICDRAELDRVFDAV
ARNA_SHIB3      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
GME2_ORYSJ      LRISITGAGGFIASHIARRLKSEGHYIIASDHMTEDMFCHEFHLVD-----LRVMD--NCLKVTTGVDHV
ARNA_SALTI      IRVLILGVNGFIGNHLTERLLDEENYEVYGMDIGSNAISRF---LLHPRFHFVEGDISIHSEIEYHVDVV
ARNA_SALPK      IRVLILGVNGFIGNHLTERLLDEENYEVYGMDIGSNAISRF---LLHPRFHFVEGDISIHSEIEYHVDVV
ARNA_SALPA      IRVLILGVNGFIGNHLTERLLDEENYEVYGMDIGSNAISRF---LLHPRFHFVEGDISIHSEIEYHVDVV
GME_ARATH       LKISITGAGGFIASHIARRLKHEGHYVIASDHMTEDMFCDEFHLVD---LRV----MENCLKVTEGVDHV
RFBB_NEIMA      -KILVTGGAGFIGSAVVHIIRNTQDSVVNLDKLTAGNLESLTDIADNPRYAFEQVDICDRAELDRVFDAV
GALE_LACHE      MKVLVIGGAGYIGSHAVRELVKEGNDVLVLDALYTG-----HRKAVDPKAKFYQGDIEDTFLVDEKIDAV
GALE_BACHD      MAILVTGGAGYIGSHTVLFLLEQGEQVIVLDNLQKGHAGAL-SDVTFYHGDIRDDQLLDTIFTTHSIDTV
RFFG_HAEIN      MNILVTGGSGFIGSALIRYIINHTQDFVIIDKLTYAANQSALREVNNPRYVFEKVDIENIFEKYQP-DAV
RFBB_NEIMB      -KILVTGGAGFIGSAVVRHIIRNTRDAVVNVDKLTGNLESLTEVADNPRYAFEQVDICDRAELDRVFDAV
ARNA_YERPY      -RVLILGVNGFIGNHLTERLLQDDRYEVYGLDIGSDAISRF---LGNPAFHFVEGDISIHSEIEYHIDVI
ARNA_YERPS      -RVLILGVNGFIGNHLTERLLQDDRYEVYGLDIGSDAISRF---LGNPAFHFVEGDISIHSEIEYHIDVI
ARNA_YERPP      -RVLILGVNGFIGNHLTERLLQDDRYEVYGLDIGSDAISRF---LGNPAFHFVEGDISIHSEIEYHIDVI
ARNA_YERPN      -RVLILGVNGFIGNHLTERLLQDDRYEVYGLDIGSDAISRF---LGNPAFHFVEGDISIHSEIEYHIDVI
ARNA_YERPG      -RVLILGVNGFIGNHLTERLLQDDRYEVYGLDIGSDAISRF---LGNPAFHFVEGDISIHSEIEYHIDVI
ARNA_YERPE      -RVLILGVNGFIGNHLTERLLQDDRYEVYGLDIGSDAISRF---LGNPAFHFVEGDISIHSEIEYHIDVI
ARNA_YERPB      -RVLILGVNGFIGNHLTERLLQDDRYEVYGLDIGSDAISRF---LGNPAFHFVEGDISIHSEIEYHIDVI
ARNA_YERPA      -RVLILGVNGFIGNHLTERLLQDDRYEVYGLDIGSDAISRF---LGNPAFHFVEGDISIHSEIEYHIDVI
ARNA_YERP3      -RVLILGVNGFIGNHLTERLLQDDRYEVYGLDIGSDAISRF---LGNPAFHFVEGDISIHSEIEYHIDVI
RFBB_SALTY      MKILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTGNLESLSDISESNRYNFEHADICDSAEITRQPDAV
ARNA_SHIF8      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_PSEAB      -RVLILGVNGFIGNHLSERLLRDGRYEVHGMDIGSDAIERLK---ADPHFHFVEGDIGIHSELEYHVDVV
ARNA_SHIFL      -RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRF---LNHPHFHFVEGDISIHSEIEYHVDVV
ARNA_PSEAE      -RVLILGVNGFIGNHLSERLLRDGRYEVHGMDIGSDAIERLK---ADPHFHFVEGDIGIHSELEYHVDVI
ARNA_PSEA8      -RVLILGVNGFIGNHLSERLLRDGRYEVHGMDIGSDAIERLK---ADPHFHFVEGDIGIHSELEYHVDVI
ARNA_PSEFS      -RVLILGVNGFIGNHLSERLLRDDRYEVYGLDIGSDAIERLFHYVEGD-ISIHTEWIEYHIK---KCDVV
RFFG_ECOLI      -KILITGGAGFIGSALVRYIINETSDAVVVVDKLTGNLMSLAPVAQSERFAFEKVDICDRAELEHQPDCV
YFNG_BACSU      ----VTGCTGLLGSYLVKELIEQGANVLVRDHVPQSNLYQGEHKMNIVRGSLEDLAVIERALGEYEIDTV
ARNA_PSEPF      -RVLILGVNGFIGNHLSERLLRDERYEVYGLDIGSDAIDRLR---SHPRFHFVEGDISIHSEIEYHIDVV
ARNA_PSEA7      -RVLILGVNGFIGNHLSERLLRDGRYEVHGMDIGSDAIERLK---ADPHFHFVEGDIGIHSELEYHVDVI
GALE_PASHA      MAILVTGGAGYIGSHTLVELLNENREIVVLDNLSNSSEVSLVKQITGKSVKILDRDILRKIFAENQIESV
ARNA_PSEF5      -RVLILGVNGFIGNHLSERLLRDDKYDVYGLDIGSDAIERLR---SHPNFHFVEGDISIHSEIEYHIDVV
GALE_NEIMC      -KILVTGGTGFIGSHTVVSLLKSGHQVVILDNLCNSSINILLKTITGQEIPFYQGDIRRRIFAENRIDSV
VIPB_SALTI      -RWLITGVAGFIGSGLLEELLFLNQTVIGLDNFSTGYQHNLDDVRTSSRFIFIQGDIRKFTDCQKAVDYV
ARNA_KLEP7      -RVLILGVNGFIGNHLTERLLQDDNYEIYGLDIGSDAISRF---LDCPRFHFVEGDISIHSEIEYHIDVV
RFBB_XANCB      ---LVTGGAGFIGGNFVLEAVSRGIRVVNLDALTAGNLNTLASLEGNADHIFVKGDIGDGALVEHQPDAV
GALE_HAEIN      MAILVTGGAGYIGSHTVVELLNVGKEVVVLDNLCNSSPKSLVKQITGKEAKFYEGDILQKIFAENEINSV
ARNA_KLEP3      -RVLILGVNGFIGNHLTERLLQDDNYEIYGLDIGSDAISRF---LESPRFHFVEGDISIHSEIEYHIDVV
RFBB_XANCP      ---LVTGRAGFIGGNFVLEAVSRGIRVVNLDALTAGNLNTLASLEGNADHIFVKGDIGDGALVEHQPDAV
ARNA_YERE8      -RVLILGVNGFIGNHLTERLLRDNRYEVYGLDIGSDAICRF---LDNPNFHFVEGDISIHSEIEYHIDVI
ACBB_ACTS5      MKILVTGGAGFIGSHFVTSLISXXXXXXXXDKLGYGNLRNLAEASADPRFSFVRGDICDEGLIEGLMDTV
RFBB_ECOLX      MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTGNLESLAEISDSERYSFENADICDA-EGDGQLDAV
RFBB_SHIFL      MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTGNLESLADVSDSERYAFEHADIMSRIFAQHQPDAV
GALE_YERPE      MYVLVTGGSGYIGSHTCVQLIEAGYKPVILDNLSKSSVLARIHSLTGYTPELYAGDIRDRTLLDSPIHAV
RHM1_ARATH      ---LITGAAGFIASHVANRLIRSDYKIVVLDKLDCSNLKNLNPSKHSPNFKIASADLVNHLLITEGIDTI
GALE_LACCA      MTIAVLGGAGYIGSHTVKQLLAAGEDVVVLDNLITG-----HRKAVDPRARFYQGDIRSQEKIDGIVHFA
GALE_NEIMB      -KILVTGGTGFIGSHTVVSLLKSGHQVVILDNLCNSSINILLKTITGQEIPFYQGDIRRRIFAENRIDSV
GALE_ECOLI      MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLSKRSVLPVIERLGGKHPTFVEGDIRNEALMDHAIDTV
GALE_SALTY      MRVLVTGGSGYIGSHTCVQLLQNGHDVVILDNLSKRSVLPVIERLGGKHPTFVEGDIRNEALIDHAIDTV
ARNA_PSE14      -RVLILGVNGFIGNHLSERLLQDDRYDIYGMDIGSDAIERLFHFIEGD-ISIHTEWIEYHIK---KCDVV
RFBE_SALTI      MKLLITGGCGFLGSNLASFALSQGIDLIVFDNLSKGATDNLHWLSSLGNFEFVHGDIRNKNDVTRLIDSC
GALE_SALTI      MRVLVTGGSGYIGSHTCVQLLQNGHDVVILDNLSKRSVLPVIERLGGKHPTFVEGDIRNEALIDHAIDTV
GALE_DROME      ---LVTGGAGYIGSHTVLEMLNAGYNVICVDNLCNAYSSGAVQEITGKKVNFYRVDITDREQVEHKIDMV
GALE_DICDI      -RIMVTGGAGYIGSHTVIELIEAGYTPVIVDNLSNSSLEAIVESITGKEIEFHHVDIMNEKALDGNIRSV
ARNA_PSEU2      -RVLILGVNGFIGNHLSERLLQDDRYEIYGMDIGSDAIERLFHFIEGD-ISIHTEWIEYHIK---KCDVV
GALE_NEIMA      ---LVTGGTGFIGSHTVVSLLKSGHQVVILDNLCNSSINILLKTITGQEIPFYQGDIRRRIFAENRIDSV
RFBB_ECOLI      MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTGNRESLADVSDSERYVFEHADI-----CDAPADAV
RHM3_ARATH      ---LITGAAGFIASHVANRLVRSDYKIVVLDKLDXXXXXXXXXXFKFVKGDIASADLVNYLLITEEIDTI
STRE_STRGR      ---LVTGAAGFIGSQYVRTLLGPGGPVTALDALTAGNPDNLAAVRGHPRYRFERGDI-----CDAPQDQV
FCL1_ORYSJ      -------------------------------------------------------DVEAFFAAELPRYVV
CAPI_STAAU      MKILITGTAGFIGSHLAKKLIKQGHYVIGVDSISVSLKEDRLKSIGKEKVKLENYDDLSKVFVDEQPEVV
RMLB_STRMU      ---IVTGGAGFIGSNFVHYVYNNHPDVTVLDKLTAGNRANL-EEILGDRVELVVGDIADSELVDAKADAI
ARNA_WIGBR      -KILILGVNGFIGYHITNLLLKYNNYKIYGIDIKNNLVKSF---IGNEKFCFIKGDIKQYYNVKKKIDII
GALE_MOUSE      -KVLVTGGAGYIGSHTVLELLEAGYSPVVIDNFSMPESLRRVQELTGRSVEFEEMDILDQAALQHSFKAV
HLDD_ALHEH      ---IVTGGAGFIGSNLVHELNRRGRDVIVVDNLTRGALNLADCVIADYYDKDDFITLIEADEGLGPVEAV
GALE_STRTR      MAILVLGGAGYIGSHMVDRLVEKGQEVVVVDSLVTGHRAAVHPDAIFYQGDLSDQDMRKVFKENPDVDAV
GALE_HUMAN      -KVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNGSLPESLQELTGRSVEFEEMDILKKYSFMA----V
TGDS_DICDI      -KILITGGAGFIGSHLAIYLTKKNSKIIVLDKLDCSNINNLGCVLKELNFKFYKGNILDSELLENKIDIV
FCL1_ARATH      ----VAGHRGLVGSAIVRKLQEQGFTNLVLKTHAELDLT-------------RQADVESFFSQEKPVYVI
YCL2_ECO11      MKYLVTGAAGFIGFHVSKRLLEAGHQVVGIDNLNDYYDVSLLELLAQPGFQFHKIDLADREGMSGHFERV
HLDD_THICR      ---VVTGGAGFIGSNIVKALNAQGRDILVVDNLKNGKK---FINIADCDIALDKEDFQSRFAEEGDIDCV
GALE_PONAB      -KVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNGSLPESLRRVQ--ELTGRSVEFEEMDILDGALQRL
FCL2_ARATH      ----VAGHRGLVGSAIVRKLQDQGFTNLVLRTHSELDLTS-------------QSDVESFFATEKPVYVI
GALE_CORDI      MKLLVTGGAGYVGSVCSTVLLEQGHEVTIVDNLTTGNRDAVPLGATFVEGDIK--DVADNVLSSDSFDAV
HLDD_AZOSE      ---IVTGGAGFIGSNIVQGLNARGTDILVVDDLTDGKCLNLIHDYMDKDDFLRRVEANEDF---GPVEAI
GALE2_CYATE     ---LVTGGAGYIGSHTVLQLLLGGFKAVVVDNLDNSSETAIHRNLSFHKLDLRDRDALEKIFSSTKFDSV
EXOB_AZOBR      -RVLVTGGAGYIGSHVLHALTDAGIPAVTIDDLSAGRREAIPAAVPLVEGDIGSAELLDRVMRDHRVDAV
LPSL_RHIME      MRYLITGTAGFIGFHVAKRLIDEGHFVVGFDGMTDVTLKERRHAILQRSNGFKAVTAMXXXXXXXXXEVI
GALE_PASMU      MAILVTGGAGYIGSHTVVELLNANKDVVVLDNLCNSSPKSLVAQITGKQVKFYQGDILQKIFAENQIQSV
GALE_NEIGO      MTVLITGGTGFIGSHTAVSLVQSGYDAVILDNLCNSSAAVLLRQITGRNIPFYQGDIRRQIFSEHEIESV
GALE_YEREN      MSILITGGAGYIGSHTVLTLLEQGRNVVVLDNLINSSAENFYHGDILDRSCLKLIFSSHK------IDSV
GALE_STRMU      MAILVLGGAGYIGSHMVDRLIEKGEEVVVVDSLVTGHRAAV-----HPAAKFYQGDLADRFRENPDVDAV
HLDD_SHELP      ---IVTGAAGFIGSNLVKALNNLGRDIIAVDDLTDGTMFNLADEIADYLDKADFIEQIAQGQFDGKVEVI
HLDD_DESVV      ---IVTGGAGFIGSAMVWKLNEMGEDIVVVDNLSTSKWKNLVNRRYVDYVHRDTMDMVLHGDLPWDVDAV
HLDD_DESVH      ---IVTGGAGFIGSAMVWKLNEMGEDIVVVDNLSTSKWKNLVNRRYVDYVHRDTMDMVLHGDLPWDVDAV
HLDD_BRAHW      ---IVTGGAGFIGSNIVKGLNNLGDDILVVDNLKNASKHKNLNRIKFRDYIDKNLDYLTSFVNNNKVEAI
FCL_DICDI       ----------------------------------------------------------------------
ARAE4_ARATH     ---LVTGGAGYIGSHAALRLLRDSYRVTIVDNLSRGTLQQLFPQTG--RLQFIYADLGEKIFSENAFDAV
YHEB_SCHPO      ---LITGGAGFIGSNFLDYAVDKDFHFTCIDKLSTVFLSKVLNQ---PNFRFLEMDLATNYKFINKITHI
HLDD_SHEPW      ---VVTGAAGFIGSNLVKALNDMGNDIIAVDDLTDGTMFNLADEIADYLDKDQFLEQIIAGEFDGKIEVI
GALE_ERWAM      MSILVTGGAGYIGSHTVLSLLQRGDDVVILDNLSNASRESI------NRVEKLTGKTATFFEGDHRISAV
HLDD_PELCD      ---IVTGGAGFIGSNIVQALNARGREILVVDDLTDGT---KFANIADARILDKDEFLRRIASGDSFGDRI
GM4D_SHIFL      ---LITGVTGQDGSYLAEFLLEKGYEVHGISSFNTERVDHIYQDTCNPKFHLHYGDLSDTSNLEVQPDEV
GM4D_ECOLI      ---LITGVTGQDGSYLAEFLLEKGYEVHGISSFNTERVDHIYQDTCNPKFHLHYGDLSDTSNLEVQPDEV
GM4D_ECOL6      ---LITGVTGQDGSYLAEFLLEKGYEVHGISSFNTERVDHIYQDTCNPKFHLHYGDLSDTSNLEVQPDEV
GM4D_ECO57      ---LITGVTGQDGSYLAEFLLEKGYEVHGISSFNTERVDHIYQDTCNPKFHLHYGDLSDTSNLEVQPDEV
GALE3_ARATH     ---LVTGGAGYIGSHTVLQLLEGGYSAVVVDNYDNSSAASLLAGENGNRLSFHQVDLREKIFSETKFDAV
YGRE_SCHPO      ---LVTGGAGYIGSHTCVVLLEKGYDVVIVDNLCNSRVEHRIEKLTGKKVIFHQVDLLDEPALDQNISAV
HLDD_AERS4      ---VVTGGAGFIGSNLVKQLNAQGRDIVVIDDLTDGTKLTIADYMDKDEFQARIVSGDEFEEWDDGIEVI
ARAE2_ORYSJ     ---LVTGGAGYIGSHATLRLLRDNYRVTIVDNLSRGNLQRLFPEPG--RLQFIYADLGNKIFSENAFDAV
HSDD1_ARATH     --CVVTGGRGFAARHLVEMLVRYQMFHVRIADLAPAIVLNLGEAIRSGRVQYVSADLRNKTQVFQGAEVV
HLDD_AERHH      ---VVTGGAGFIGSNLVKQLNAQGRDVVVIDDLTDGTKLTIADYMDKDEFQARIVSGDEFEEWDGGIEVI
GM4D_YERE8      -KALITGITGQDGSYLAEFLLEKGYQVHGISSFNTSRIDHIYHEV-NPHFFLHYGDLTDTSNLIRLVDEI
GALE_RAT        -KVLVTGGAGYIGSHTVLELLEAGYSPVVIDNFSMPESLRRVQELTGRSVEFEEMDILDQAALQHNFKAV
EXOB_RHIME      ---LVVGGAGYIGSHTCLQLAAKGYQPVVYDNLSNG------HEEFVKWGVLEKGDIRDRQRLDEVL---
GALE_STRLI      ---LVTGGAGYVGSVVAQHLVEAGNEVVVLHNLSTGFRAGVPAGASFYRGDIRDQDMRKVFRGRLSFDGV
GAE3_ARATH      ---LVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLARQALLERSGVFVVELKKLFEV-VPFTHV
GAE2_ARATH      ---LVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDTSLSRQALLERSGVFIVELKKLFEV-VPFTHV
ARAE1_ARATH     ---LVTGGAGYIGSHAALRLLKESYRVTIVDNLSRGNLAELFPEPG--RLQFIYADLGNKIFTENAFDAV
HLDD_POLSJ      MKIVVTGAAGFIGSNLVKGLNDRGDDIIAVDDLTHGNLADLQXXXXXXXXXXXXXXAEGAF---GQVEAV
HLDD_NITOC      ---IVTGGAGFIGSNIIK-ALNQGEDILVVDDLTQGKFSNLIYWDKQPFLQA----IKAGEEFPHPVDAF
GMDS_HUMAN      ---LITGITGQDGSYLAEFLLEKGYEVHGISSFNTGRIEHLYHIEGNMKLHVKIINEVKPTEIQSHVKIS
GALE1_PEA       -KILVTGSAGFIGTHTVVQLLNNGFNVSIIDNFDNSVMSNLSQNLEFTLGDLRNKDDLEKLFSKSKFDAV
GAE4_ARATH      ---LVTGAAGFVGTHVSAALKRRGDGVIGLDNF------NDYYDPSLKRARRALLERSGIFIVEGDINDV
GALE1_CYATE     ---LVTGGAGFIGSHTVVQLLKQGFHVSIIDNL-YNSVIDAVHRVRSSNLHFHHGDLRNIHDLDTKFDAV
GAE1_ARATH      ---LVTGATGFVGSHVSLALRKRGDGVVGLDNFNNXGIFVVEGDLNDAKLLAKLFDVTHVMHLAAQAGVR
ARAE3_ARATH     ---LVTGGAGYIGSHAALRLLKDSYRVTIVDNLSRGNLQGLFPEPG--RLQFIYADLGDAKAVDNAFDAV
HLDD_AZOSB      ---IVTGGAGFIGSNIVQGLNDRGTDILVVDDLRDGKCLNLXXXXXXXXXXXXXFLARIQTGEDGRVEAV
GMDS_MOUSE      ---LITGITGQDGSYLAEFLLEKGYEVHGISSFNTGRIEHLYHIEGNMKLHVKIINEVKPTEIQSHVKIS
FCL2_ORYSJ      ----------------------------------------------------------------------
GMDS_CRIGR      ---LITGITGQDGSYLAEFLLEKGYEVHGISSFNTGRIEHLYHIEGNMKLHVKIINEVKPTEIQSHVKIS
GALE1_ARATH     ---LVTGGAGFIGTHTVVQLLKDGFKVSIIDNFDNSVIEDRVRELVGPKLDFNLGDLRNKGDIEQRFDAV
GAE6_ARATH      ---LVTGAAGFVGSHCSLALRKRGDGVLGFDNF------NDYYDPSLKRARQELLEKQQVFIVEGPFTHI
GMD1_ARATH      ---LVTGITGQDGSYLTEFLLEKGYEVHGLSNFNTQRLNHIYHNVNKALMKLHYGDLRRWLDVIKP-DEV
FCL_HUMAN       MRILVTGGSGLVGKAI---------QKVVADGAGLPGEDWVFVSSKDADLT-DTAQTRALFEKVQPTHVI
HLDD_SHEFN      ---VVTGAAGFIGSNLVKQLNAMGNDIIAVDDLTDGTMFNLADEIADYLDKDDFIKQIKAGDFDNKLEVI
HLDD_CHRVO      MTIVVTGAAGFIGSNLVKGLNQRGTDIIAVDNLSNG---DKFHEISHYLDKHEFLHLLLDGEYEGELSAI
GMD2_ARATH      ---LITGITGQDGSYLTEFLLGKGYEVHGLSNFNTQRINHIYHNVNKALMKLHYADLTDASSLRRWIDVV
FCL_ECOLI       ----------------------------------------------------------------------
NOEL_RHISN      ---LISGVTGQDGAYLAELLLDEGYIVHGISSFNTQRIEHIYQERHDPEARFDSTNLLRIVQQTQPHEI-
HSDD2_ARATH     --CVVTGGRGFAARHLVEMLVRYEMFCVRIADLAPAIMLDLDEGLRSGRVQYISADLRDKSQVVKAAEVV
HLDD_CHRSD      ---VVTGGAGFIGANLVKALNARGREVLVVDDLSDGTFVNLADCTLGDYLDKDDFLARVKAELRGPIEAI
EXOB_RHILT      ---LVVGGAGYIGSHTCLDLANKGYRPVVFDNFSNG------HREFVRWGPAEEGDIRDRARLDEPAAIL
ARAE2_ARATH     ---LVTGGAGYIGSHAALRLLKDSYRVTIVDNLSRGNLGKILQQLEPGKLQFIYADLGNKIFSENAFDAV
GAL10_KLULA     --CLVTGGAGYIGSHTVVELCEAGYKCIVVDNLSNSSYESVAQEIKFAKIDLCELEPLNKLFDDYKIDSV
NSDHL_MOUSE     -KCTVIGGSGFLGQHMVEQLLERGYTVNVFD----------IHQFDNPRVQFFIGDLCNQQDLYPALKGV
HLDD_POLNS      MTIIVTGAAGFIGANIVQALNVRGEKIIAVDDLRP---ADKYRNLAD----LDIIDYLDKDEFFGKVKAV
HLDD_MARAV      ---VVTGGAGFIGANIIHALNLRGEDILVVDDLTDGTRFRNLAELDVTDYMDKGEFLERVKANDLPMGIV
NOEL_RHIFR      ---LISGVTGQDGAYLAELLLDEGYIVHGISSFNTQRIEHIYQERHDPEARFDSTNLLRIVQQTQPHEI-
HLDD_RALEH      MTIIVTGAAGFIGSNLVKGLNDRGENVIAVDNLTR---ADKFHNLVDCEISLDKQDFLARFARGGKVRAV
HLDD_PSEA7      MSIIVTGAAGFIGSNLLQALNQRGEDIIAVDDLTDGQFRNLADADIADYLDQNDFIERYARGDFGPVRAL
NSDHL_RAT       -KCTVIGGSGFLGQHMVEQLLSRGYAVNVFD---------VRQGFDNPRVQFFIGDLCNQQDLYPALKGV
FCL_MOUSE       ----------------------------------------------------------------------
ARAE3_ORYSJ     ---LVTGGAGYIGSHASLRLLKDNYRVTIVDNLSRGNLQELFPQPG--RLQFIYADLGNKIFAENAFDAV
NSDHL_BOVIN     -RCTVIGGCGFLGQHMVEQLLARGYAVNVFD---------IRQGFDNPRVQFFLGDLCSQQDLYPALKGV
GAL10_YEAST     ---LVTGGAGYIGSHTVVELIENGYDCVVADNLSNSTYDSVLEVLTKHHIPFYEVDLRKGLEKEYKIDSV
GALE_CORGL      -------------------LLEHGHDVTIIDNFSTGNREAV---PADARLIEGDVDVVEEVLSEGGFEGV
FCL_PONAB       ----------------------------------------------------------------------
ARAE1_ORYSJ     ---LVTGGAGYIGSHAALRLLKDSFRVTIVDNLSRGNLQNLFSEPG--RLQFIYADLGNRIFAENAFDAV
HLDD_EDWI9      ---IVTGGAGMIGSNIVKALNDKGYDILVVDNLKDGT-----KFVNLVDLDITDYMDKEDFDDFGDIDAV
GALE_MYCGE      -RVAIVGGIGYIGSCFASFIKEQNDKLIVIDNNKNNHVIKLLKKIGIEFYFADLLDRHKLTEVIAAIDVV
HLDD_CUPTR      MTIIVTGAAGFIGSNLVKGLNERGENVIAVDNLTR---ADKFHNLVDCEISLDKQDFLARFARGGKVRAV
HLDD_VIBVY      ---IVTGGAGMIGSNIVKALNEIGNDILVVDNLKNGKFKNLVD------LDITDYMDRDDFDNFGPIEAV
HLDD_VIBVU      ---IVTGGAGMIGSNIVKALNEIGNDILVVDNLKNGKFKNLVD------LDITDYMDRDDFDNFGPIEAV
HLDD_THIDA      ---VVTGAAGFIGANIVKALNERGENIIAVDNLTADKFKNLTDEIADYLDKTEFLSVVEEGVLDGSVAAI
HLDD_RHOFD      -RIVVTGAAGFIGSNIIQGLNARGNDIIAIDDLTQGKFRNLAHKISD------YVDASVFYDLYGQIEAV
HLDD_PASMU      ---IVTGGAGFIGSNIVKALNELGRDILVVDNLKDGTFANLVD------LDIADYCDKEDFIASGDIEVI
GM4D1_VIBCH     ---LITGITGQDGSYLAEFLLEKGYEVHGIKRRSTQRVDHLYKDPHEEDVNFKLTDSSNLTRILAEVDEV
GAL10_SCHPO     ---LVTGGAGYIGSHTVIELINHGYKVIIVDNLCNSCYDAVARVEFIVRKSIKKLDLRDKFKIKGVIHFA
FCL_CRIGR       ----------------------------------------------------------------------
NSDHL_HUMAN     -RCTVIGGSGFLGQHMVEQLLARGYAVNVFD---------IQQGFDNPQVRFFLGDLCSRQDLYPALKGV
HLDD_HAMD5      ---IVTGGAGFIGSNIVRALNKIGYDILVVDNLEKGAFVNLVDKIADYRDKDDFITSVRAKEVLGNIEAI
GMDS_DICDI      ---LITGITGQDGSYLTEFLISKGYYV-------HGIIQKIFHHFNTKNIYIKIDMLKEKESLTGDLTDA
GAE5_ARATH      ---LVTGASGFVGTHVSIALRRRGDGVLGLDN---------FNRYYDPKLKRARQGLLERFVVEGDINHV
HLDD_VIBF1      ---IVTGGAGMIGSNIVKSLNNKGNDILVVDNLKDGKKFKNLVDLDITDYMDKEDFITQIMAGDGPIEAI
HLDD_BORA1      ---VVTGAAGFIGSNLVRGLNRRGYDIIAIDDLTEG---DKFRNLVDCRIYMHHEDARALLKA-GQFPRV
GMDS_DROME      ---LITGITGQDGSYLAEFLLKKDYEVHIIRRASTFNTTRIEHLYADPRMKLHYGDMTDSSSLVKIINMV
HLDD_POLNA      MKIVVTGAAGFIGSNLVKGLNARGDDIIAVDDLTQG---DKFRNLADLRIAMDAGDFYDRFAEGGHVEAV
HLDD_NEIMA      MTIIVTGAAGFIGSNIVKALNQRGTDIVAVDNLSKGEKFKNLAECEIAHYLDKHEFIRQVREHILPIEAV
HLDD_VIBFM      ---IVTGGAGMIGSNIVKSLNDKGNDILVVDNLKDGKKFKNLVDLDITDYMDKEDFITQIMAGDGPIEAI
HLDD_NEIM0      MTIIVTGAAGFIGSNIVKALNQRGTDIVAVDNLSKGEKFKNLAECEIAHYLDKHEFIRQVREHILPIEAV
HLDD_SALPC      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDIEAI
HLDD_SALCH      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDIEAI
GM4D2_VIBCH     -KALITGVTGQDGSYLAEFLLAKGYEVHGISSFNTQRVDHIYQDVDNASFILHYGDLTDSSNLEVKPDEV
HLDD_SODGM      ---VVTGGAGFIGSNIVKALNQIGYDVLVVDNLKDGTYANLVDNISDYMDKEDFIASIVAGDDFGDIDAV
HLDD_RALEJ      MTIIVTGAAGFIGSNLVKGLNARGNHIVAVDNLHR---ADKFHNLVDCEIRLDKDDFLSRFERGGRVRAV
HLDD_NEIMB      MTIIVTGAAGFIGSNIVKALNQRGTDIVAVDNLSKGEKFKNLAECEIAHYLDKHEFIRQVREHILPIEAV
HLDD_NEIMF      MTIIVTGAAGFIGSNIVKALNQRGTDIVAVDNLSKGEKFKNLAECEIAHYLDKHEFIRQVREHILPIEAV
GM4D_PSEAE      ----------------------------------------------------------------------
HLDD_SALG2      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDIEAI
HLDD_SALEP      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDIEAI
HLDD_SALDC      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDIEAI
HLDD_RALPJ      MTIIVTGAAGFIGANIVKGLNERGEDIIAVDNLTADKFKNIVDQISDYLDKTDFVERFARGEF-GKVRAI
HLDD_PSYIN      ---IVTGGAGFIGSSIVKSLNERGTDILVVDDLTDGAFVNLVDQIMDYMDKDEFITQIVSGQDFGDIEAI
HLDD_PHOLL      ---IVTGGAGFIGSNIVKALNDEGYDILVVDNLKDGT-----KFINLADLDIADYMDKEEFDDFGDIDAI
GALE_KLEPN      MKVLVTGGSGYIGSHTCVQLLQRGHEVVILDNLSKRRILPVIERLGGKEATFIEGDIRNEARMDHAIEAV
HLDD_PROMH      ---IVTGGAGFIGSNIVKALNDEGYDILVVDNLKDGTKFVNLVDLNIADYMDKEDFIASIVAGDGDIDAV
HLDD_HAEIG      ---IVTGGAGFIGSNIVKALNDLGRDILVVDNLKDGTFANLIADYCDKEDFIASIIAGDEF---GDIDAV
HLDD_HAEI8      ---IVTGGAGFIGSNIVKALNDLGRDILVVDNLKDGTFANLIADYCDKEDFIASIIAGDEF---GDIDAV
GALE2_ARATH     ---LVSGGAGYIGSHTVLQLLLGGYXXXXXXXXXXXXXXXLLAAEHGERLSFHQVDLREKIFSETKFDAV
HLDD_HAEIN      ---IVTGGAGFIGSNIVKALNDLGRDILVVDNLKDGTFANLIADYCDKEDFIASIIAGDEF---GDIDAV
HLDD_BURP8      MTLIVTGAAGFIGSNLVKALNERGEDIIAVDNLTADKFKNLVDCEIDDYLD-KTEFVERFARGDGKVRAI
HLDD_SALTY      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDIEAI
HLDD_SALTI      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDIEAI
HLDD_SALSV      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDIEAI
HLDD_SALPK      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDIEAI
HLDD_SALPB      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDIEAI
HLDD_SALPA      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDIEAI
HLDD_SALNS      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDIEAI
HLDD_SALHS      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDIEAI
HLDD_SALAR      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKEGT-----KFVNLVDLNIADYMDKEDFLIQGDIEAV
HLDD_SALA4      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDIEAI
HLDD_PSEAE      MSIIVTGAAGFIGSNLLQALNRRGEDIIAVDDLTDGQFRNLADADIADYLDQNDFLERYARGDFGTVRAL
HLDD_BURVG      MTLIVTGAAGFIGANIVKALNERGERIIAVDNLTRADKFRNLVDCEIDDYLDKTEFVERFARGDGKVRAV
HLDD_BURM1      MTLIVTGAAGFIGANIVKALNERGERIIAVDNLTADKFKNLVDCEIDDYLD-KTEFVERFARGDGKVRAV
HLDD_BURCM      MTVIVTGAAGFIGANIVKALNERGERIIAVDNLTRADKFRNLVDCEIDDYLDKTEFVERFTRGDGKVRAV
HLDD_BURA4      MTVIVTGAAGFIGANIVKALNERGERIIAVDNLTRADKFRNLVDCEIDDYLDKTEFVERFTRGDGKVRAV
TGDS_MIMIV      ---LVTGGLGFIGSNFVNHISSKYDNVIYVYDIGDASVENVEW---NNRTKLIKGDIRN-FDLEHEIDTI
SPSK_BACSU      -KVLVTGAGGQLGLELCRQLKQAGYEVIAL----TKKMMNIADQRS----------VRHSFGHYQP-DIV
HLDD_ECOSM      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLDIADYMDKEDFLIQGDVEAI
FCL_DROME       ----------------------------------------------------------------------
YFHF_BACSU      MNIAMTGGTGFLGQHLTGVLTRQGHHVYILSRNARET-----EQKNMTYVQWLSEGAAPEQELP-HIDVW
HLDD_VIBCM      ---IVTGGAGMIGSNIIKALNERGTDILVVDHLKNGKFKNLVD------LQIADYMDRDDFDDFGFIDAI
HLDD_VIBCH      ---IVTGGAGMIGSNIIKALNERGTDILVVDHLKNGKFKNLVD------LQIADYMDRDDFDDFGFIDAI
HLDD_VIBC3      ---IVTGGAGMIGSNIIKALNERGTDILVVDHLKNGKFKNLVD------LQIADYMDRDDFDDFGFIDAI
HLDD_PSEAB      MSIIVTGAAGFIGSNLLQALNRRGEDIIAVDDLTDGQFRNLADADIADYLDQNDFLERYARGDFGTVRAL
HLDD_RALME      MTIIVTGAAGFIGSNIVKGLNERGENIIAVDNLTRAEKFNNLVDCEIADYLDKTDFVARFARGDGNVRAV
HLDD_ENTS8      ---IVTGGAGFIGSNIVKALNDIGYDILVVDNLKDGTKLNIADYMDKEDFQVQIM----SGEEFGEVEAV
Y4AF_RHISN      ----------------------------------------------------------------------
HLDD_SHISS      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLDIADYMDKEDFLIQGDVEAI
HLDD_SHIFL      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLDIADYMDKEDFLIQGDVEAI
HLDD_SHIF8      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLDIADYMDKEDFLIQGDVEAI
HLDD_SHIDS      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDVEAI
HLDD_SHIBS      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLDIADYMDKEDFLIQGDVEAI
HLDD_SHIB3      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLDIADYMDKEDFLIQGDVEAI
HLDD_RALSO      MTIIVTGAAGFIGANLVKGLNDRGEDIIAVDNLTRADKFRNLVDCEISDYLDKTEFVERFARGDGKVRAI
HLDD_MANSM      ---IVTGGAGMIGANIVKALNDMGRDILVVDNLKDGT-----KFINLVDLDIADYCDKEDFDDLGDIDAV
HLDD_KLEP7      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGEIEAI
HLDD_KLEP3      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGEIEAI
HLDD_ESCF3      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDVEAI
HLDD_ECOUT      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLDIADYMDKEDFLIQGDVEAI
HLDD_ECOSE      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDVEAI
HLDD_ECOLU      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLDIADYMDKEDFLIQGDVEAI
HLDD_ECOLI      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDVEAI
HLDD_ECOL6      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLDIADYMDKEDFLIQGDVEAI
HLDD_ECOL5      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLDIADYMDKEDFLIQGDVEAI
HLDD_ECOK1      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLDIADYMDKEDFLIQGDVEAI
HLDD_ECODH      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDVEAI
HLDD_ECOBW      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDVEAI
HLDD_ECO8A      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDVEAI
HLDD_ECO81      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLDIADYMDKEDFLIQGDVEAI
HLDD_ECO7I      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLDIADYMDKEDFLIQGDVEAI
HLDD_ECO5E      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDVEAI
HLDD_ECO57      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDVEAI
HLDD_ECO55      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDVEAI
HLDD_ECO45      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLDIADYMDKEDFLIQGDVEAI
HLDD_ECO27      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDVEAI
HLDD_ECO24      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDVEAI
HLDD_BURS3      MTLIVTGAAGFIGANIVKALNERGERIIAVDNLTRADKFRNLVDCEIDDYLDKTEFVERFARGDGKVRAV
HLDD_BURCH      MTLIVTGAAGFIGANIVKALNERGERIIAVDNLTRADKFRNLVDCEIDDYLDKTEFVERFARGDGKVRAV
HLDD_BURCC      MTLIVTGAAGFIGANIVKALNERGERIIAVDNLTRADKFRNLVDCEIDDYLDKTEFVERFARGDGKVRAV
HLDD_BURCA      MTLIVTGAAGFIGANIVKALNERGERIIAVDNLTRADKFRNLVDCEIDDYLDKTEFVERFARGDGKVRAV
GMD2_CAEEL      ---LITGITGQDGSYLAELLLSKGYKVHIIRRSSSFNTARIEHLYGNPVTHIKLISTIEPTEIQSHVKVS
YGAE_ERWAM      MKILVTGGAGFIGSAVIRHIINNTDDTVLIDKLTAGNLESLQEISDNPRDHFSKTDILKRAFNDFEPDVV
HLDD_ENT38      ---IVTGGAGFIGSNIIKALNDKGTDILVVDNLKDGTFANLVD------LNIADYMDKEDFLIQGEIEAI
HLDD_CITK8      ---IVTGGAGFIGSNIVKSLNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGDIEAV
HLDD_BURCJ      MTLIVTGAAGFIGANIVKALNERGERIIAVDNLTRADKFRNLVDCEIDDYLDKTEFVERFARGDGKVRAV
HLDD_YERE8      ---IVTGGAGFIGSNIVKALNNIGYDILVVDNLKDGTKFVNLVDLDIADYMDKEDFVASIVAGDGDIDAI
HLDD_KLEPN      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLNIADYMDKEDFLIQGEIEAI
GALE_MYCPN      -KVLVLGGLGYIGSCFIDQLLKQYPDVTVVIDINHTSLA---LQLLPRQVNVHFVNLLDRAQLTDTIDVV
HLDD_YERPY      ---IVTGGAGFIGSNIVKALNNIGYDILVVDNLKDGTKFVNLVDLDIADYMDKEDFVASIVAGDGDIDAI
HLDD_YERPS      ---IVTGGAGFIGSNIVKALNNIGYDILVVDNLKDGTKFVNLVDLDIADYMDKEDFVASIVAGDGDIDAI
HLDD_YERPP      ---IVTGGAGFIGSNIVKALNNIGYDILVVDNLKDGTKFVNLVDLDIADYMDKEDFVASIVAGDGDIDAI
HLDD_YERPN      ---IVTGGAGFIGSNIVKALNNIGYDILVVDNLKDGTKFVNLVDLDIADYMDKEDFVASIVAGDGDIDAI
HLDD_YERPG      ---IVTGGAGFIGSNIVKALNNIGYDILVVDNLKDGTKFVNLVDLDIADYMDKEDFVASIVAGDGDIDAI
HLDD_YERPE      ---IVTGGAGFIGSNIVKALNNIGYDILVVDNLKDGTKFVNLVDLDIADYMDKEDFVASIVAGDGDIDAI
HLDD_YERPB      ---IVTGGAGFIGSNIVKALNNIGYDILVVDNLKDGTKFVNLVDLDIADYMDKEDFVASIVAGDGDIDAI
HLDD_YERPA      ---IVTGGAGFIGSNIVKALNNIGYDILVVDNLKDGTKFVNLVDLDIADYMDKEDFVASIVAGDGDIDAI
HLDD_YERP3      ---IVTGGAGFIGSNIVKALNNIGYDILVVDNLKDGTKFVNLVDLDIADYMDKEDFVASIVAGDGDIDAI
HLDD_RHILO      ---IVTGGAGMIGSNIVAALNAEGHDILVVDDLTDGKIANLADLSIADYLDKDDFLTRIEAGALGRIEAV
Y2119_STAHJ     ---LITGGTGMVGSQLVNKLKNRDVHITIL--------TRSDKQSDDPKISYVNWSKDGWMSQVPDIDVV
HLDD_HAEDU      ---IVTGGFGMIGSNIINALNDIGRDILVVDNLKNGEKFINLVDLNIADYCDKDDFIASIIAGDGEIDAI
HLDD_ECOLC      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLDIADYMDKEDFLIQGDVEAI
HLDD_ECOHS      ---IVTGGAGFIGSNIVKALNDKGTDILVVDNLKDGT-----KFVNLVDLDIADYMDKEDFLIQGDVEAI
Y4NG_RHISN      ---LVTGGSGYFGELLSKQLLRQGTYVRVFDLNPPG--------FSHPNLEFTILDRNAVRQALSGIDKV
YFCH_ECOLI      MNIVITGGTGLIGRHLIPRLLELGHQITVVTRNPQKASS-----VLGPRVTL-WQGLADQSNLNG-VDAV
Y1061_METJA     ---LVTGGTGSIGKEIVKTLLKFNPKTIRVLDINETALFELEHELNSEKIRCFIGDVRDKDRLKEEVDVV
HLDD_FUSNN      ---IVTGGAGMIGSAFVWKLNEMGKDILIVDKL---------------RKEDKWLNIRKREYYDDNIEAV
Y1223_SYNY3     MKIILTGATGFVGCSLVPLLHQQGHELTLL-VRSVSKAQRLFAPGSFPQLKAIAYEATKSGDVDGQ-DAV
GAL10_CANMA     ---LVTGGAGYIGSHTVIELINHGIKVVIADNLSNSS---------------------------------
HLDD_PECCP      ---IVTGGAGFIGSNIVKSLNDIGYDILVVDNLKDGTKFVNLVDLDIADYMDKEDFIASIVAGDGDIDAV
Y2567_STAAR     ---VVTGAGSGIGEAIATLLHEEGAKV-VLAGRNKDKLQNVANQLAQDSVKVVPTDVTKKEEVDGGLDIV
STRL_STRGR      -RWLVTGASGMLGRELTPLLDRRGAAVTALGDITDGAA------------------VRSAVAEHRPA-VV
Y2778_STAA8     ---VVTGAGSGIGEAIATLLHEEGAKV-VLAGRNKEKLQNVANQLSQDSVKVVPTDVTNKEEVDGGLDIV
Y2488_STAAC     ---VVTGAGSGIGEAIATLLHEEGAKV-VLAGRNKEKLQNVANQLSQDSVKVVPTDVTNKEEVDGGLDIV
Y2422_STAA3     ---VVTGAGSGIGEAIATLLHEEGAKV-VLAGRNKEKLQNVANQLSQDSVKVVPTDVTNKEEVDGGLDIV
HLDD_BURPP      ----------------------------------------------------------------------
D39U1_BOVIN     MRVLVGGGTGFIGTALTQLLKARGHEVITWDDLTTSGL--------------------------------
YQJ9_SCHPO      MKIVVLGGSGFLGHNICKLAIAKGYEVVSVSRRGAGGLHN------------------------------
YL056_YEAST     MKVFITGASGFIGSAVLSELISSGHEVVGLSDEAAAKIKSIDPAAKILRGDLKDLEILKKTESDGVIHLG
Y2478_STAAM     ---VVTGAGSGIGEAIATLLHEEGAKV-VLAGRNKDKLQNVANQLAQDSVKVVPTDVTNKEEVDGGLDIV
Y2266_STAAN     ---VVTGAGSGIGEAIATLLHEEGAKV-VLAGRNKDKLQNVANQLAQDSVKVVPTDVTNKEEVDGGLDIV
Y1014_HAEIN     MKVVITGGQGFLGQRLAKTLLAQNN--VHIDDLILIDVVKPIAPNNDPRVRCYEMNLRYPTGLDELIDAI
YGI2_SCHPO      MRIFVTGAAGFIGSEIVRQLLEAGHEVVGL----------------------------------------
RCP_VIBCH       MRILITGGTGFVGFQLIKLL--SSHELLVLTRDLTKAAQRFAHIPSQNLQLLSPLDELSDF---NGIDAI
Y2403_STAAW     ---VVTGAGSGIGEAIATLLHEEGAKV-VLAGRNKEKLQNVANQLSQDSVKVVPTDVTNKEEVDGGLDIV
Y2370_STAAS     ---VVTGAGSGIGEAIATLLHEEGAKV-VLAGRNKEKLQNVANQLSQDSVKVVPTDVTNKEEVDGGLDIV
Y2073_MYCBO     MRIAVTGASGVLGRGLTARLLSQGHEVV------------------------------------------
Y2047_MYCTU     MRIAVTGASGVLGRGLTARLLSQGHEVV------------------------------------------
SQD1_SPIOL      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FNLASPASPPVYTQRRVECLLINSEAVLQVAEFALEKGARLVQASTSEVYGDPLSHPQLEHHWGNVNPIG
UXS1_RAT        YHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIG
UXS1_PONAB      YHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIG
UXS1_MOUSE      YHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIG
UXS1_HUMAN      YHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIG
UXS1_XENTR      YHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEEYWGHVNPIG
UXS1_DANRE      YHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQNEDYWGHVNPIG
GALE_METJA      IHQAAQINVRNSVENPVYDGDINVLGTINILEMMRKYDIKIVFASSGAVYGEPNYLPVDENH-----PIN
YTCB_BACSU      FHLAAPGVRSSWGNHFHPYAAHNIQALQRLLEACREHSIQFVFASTSSVYGEKQGKVSENTSLSPLSPYG
TGDS_MOUSE      LHFAAQTHVDLSFVRAFEFTYVNVYGTHVLVNAAYEAGVKFIYVSTDEVYGG-----SLDQEFDESSPKQ
TGDS_BOVIN      LHFAAQTHVDLSFVRAFEFTYVNVYGTHVLVSAAHERVEKFIYVSTDEVYGG-----SLDKEFDESSPKQ
ARNA_AERS4      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRYCVKYNKRIIFPSTSEVYGDDHSFDEDESRL-IVGPIK
TGDS_HUMAN      LHFAAQTHVDLSFVRAFEFTYVNVYGTHVLVSAAHERVEKFIYVSTDEVYGG-----SLDKEFDESSPKQ
ARNA_SERP5      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRDCVKYNKRIIFPSTSEVYGDDKEFDE-DHSRLIVGPIN
ARNA_PHOLL      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRYCVKYNKRIIFPSTSEVYGDDKEFDEDDSRL-IVGPIN
GME1_ORYSI      FNLAADMGGMGFIQSNHSVIMYNNTMIFNMLEAARINGVRFFYASSACIY------PEFKQLETNVSPAE
SPSJ_BACSU      YDGVIHFAAESHVDRSISFITTNVMGTYRLAEAVLKKAKKLIHISTDEVYGDLKAD---DPAFTETTPLS
GME1_ORYSJ      FNLAADMGGMGFIQSNHSVIMYNNTMIFNMLEAARINGVRFFYASSACIY------PEFKQLETNVSPAE
ARNA_SALTY      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRVVFPSTSEVYG-MCTDASFDEDKSNVGPVN
ARNA_SALPC      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRVVFPSTSEVYG-MCTDASFDEDKSNVGPVN
ARNA_SALPB      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRVVFPSTSEVYG-MCTDASFDEDKSNVGPVN
ARNA_SALNS      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRVVFPSTSEVYG-MCTDASFDEDKSNVGPVN
ARNA_SALHS      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRVVFPSTSEVYG-MCTDASFDEDKSNVGPVN
ARNA_SALG2      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRVVFPSTSEVYG-MCTDASFDEDKSNVGPVN
ARNA_SALEP      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRVVFPSTSEVYG-MCTDASFDEDKSNVGPVN
ARNA_SALDC      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRVVFPSTSEVYG-MCTDASFDEDKSNVGPVN
ARNA_SALCH      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRVVFPSTSEVYG-MCTDASFDEDKSNVGPVN
ARNA_SALA4      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRVVFPSTSEVYG-MCTDASFDEDKSNVGPVN
ARNA_SODGM      LPLVAIATPIEYTRNPLRVFELDFEENLKIIRHCVKYQKRIIFPSTSEVYG-MCTDPVFDEDDSSVGPIN
Y1055_METJA     VHLGAQAGVRYSLQNPWAYIKSNEMGTLNIFEFARRFDIKVVYAXXXXVYGGNRKIPFSEDDRVD-KPI-
GALE_BACSU      IHFASVAIPLKYYHNNLTGTFILCEA---MEKYGVKK---IVFSSSATVYGVPETSPITEDF-----PLG
ARNA_SHESH      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRACVKYDKRIIFPSTSEVYGDEDTSPLIT---GPINR--
ARNA_PECCP      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRDCVRYNKRIVFPSTSEVYG-MCDDKEFDEDTSRVGPIN
ARNA_ERWCT      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRDCVRYNKRIVFPSTSEVYG-MCDDKEFDEDTSRVGPIN
ARNA_ENT38      LPLVAIATPIEYTRNPLRVFELDFEENLKIIRDCVKYQKRIIFPSTSEVYG-MCSDKVFDEDHSNVGPIN
ARNA_ECOUT      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_ECOK1      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_ECO45      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_SHISS      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_SALSV      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRVVFPSTSEVYG-MCTDASFDEDKSNVGPVN
ARNA_ECOSM      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_ECOLU      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_ECO81      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_ECO7I      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_ECO27      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_AERHH      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRYCVKYHKRIIFPSTSEVYGMCDDHSFDEDSSRIVGPIN
ARNA_ESCF3      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVQYHKRIIFPSTSEVYGMCTDKFFDEDHSNIVGPIN
ARNA_ECOL6      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
RHM2_ARATH      MHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQRFIHVSTDEVYGETDEDAAVGNH--EASQLL
RFBB_RHISN      IHLAAESHVDRSITGADDFVQTNVNGTFTMLETARQYWSNLSQVSTDEVYGSLGDRGQFEEVXXXXXXXX
ARNA_SHIDS      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_SHIBS      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_PROMH      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRYCVKYNKRIIFPSTSEVYGDDKEFDE-DNSRLIVGPIN
ARNA_ERWT9      LPLVAIATPIEYTRNPLRVFELDFEENLKIIRDCVKYKKRIIFPSTSEVYG-MCTDASFDEDSSNVGPIN
ARNA_ECOSE      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_ECOLI      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_ECOLC      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_ECOL5      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_ECOHS      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_ECODH      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_ECOBW      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_ECO8A      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_ECO5E      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_ECO57      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_ECO55      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_ECO24      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
RFBB_NEIGO      MHLAAESHVDRAIGSAGEFIRTNIVGTFDLLEAARREAFRFHHISTDEVYGDLHGTDDL---FTETTXXX
ARNA_SHIB3      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
GME2_ORYSJ      FNLAADMGGMGFIQSNHSVIMYNNTMIFNMLEAARINGVRFFYASSACIYPDTVVSLKESDAW----PAE
ARNA_SALTI      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRVVFPSTSEVYG-MCTDASFDEDKSNVGPVN
ARNA_SALPK      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRVVFPSTSEVYG-MCTDASFDEDKSNVGPVN
ARNA_SALPA      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRVVFPSTSEVYG-MCTDASFDEDKSNVGPVN
GME_ARATH       FNLAADMGGMGFIQSNHSVIMYNNTMIFNMIEAARINGIRFFYASSACIYPEQLETTNVSLKESDAWPAE
RFBB_NEIMA      MHLAAESSAGEFIQTNIVGLLEAARAYRQQMPSEKHEAFRFHHISTDEVYGDLSGTDDL---FTETXXXX
GALE_LACHE      MHFAAYSLVPESVKKPLKYYDNNVTGMISLLQAMNDANVKLVFSSSAATYGIPKKLPITED-----TPLN
GALE_BACHD      IHFAANSLVGESVKQPIEYYENNVIGTHTLLKKMLEHDVKIVFSSTAATYGEPVQIPIQES-----DPTI
RFFG_HAEIN      MHLAAESHVDRSISGAVQTNIVGTYTLLEVADEAKKTTFRFHHISTDEVYGDSLSEPAFTEQXXXXXXXX
RFBB_NEIMB      MHLAAESSAGEFIQTNIVGLLEAARAYWQQMPSEQHEAFRFHHISTDEVYGDLGGTDDL---FTETXXXX
ARNA_YERPY      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRDCVKYNKRIVFPSTSEVYG-MCDDKEFDEDTSRVGPIN
ARNA_YERPS      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRDCVKYNKRIVFPSTSEVYG-MCDDKEFDEDTSRVGPIN
ARNA_YERPP      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRDCVKYNKRIVFPSTSEVYG-MCDDKEFDEDTSRVGPIN
ARNA_YERPN      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRDCVKYNKRIVFPSTSEVYG-MCDDKEFDEDTSRVGPIN
ARNA_YERPG      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRDCVKYNKRIVFPSTSEVYG-MCDDKEFDEDTSRVGPIN
ARNA_YERPE      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRDCVKYNKRIVFPSTSEVYG-MCDDKEFDEDTSRVGPIN
ARNA_YERPB      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRDCVKYNKRIVFPSTSEVYG-MCDDKEFDEDTSRVGPIN
ARNA_YERPA      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRDCVKYNKRIVFPSTSEVYG-MCDDKEFDEDTSRVGPIN
ARNA_YERP3      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRDCVKYNKRIVFPSTSEVYG-MCDDKEFDEDTSRVGPIN
RFBB_SALTY      MHLAAESGPAAF----IETNIVGTYALLEVARSALKNNFRFHHISTDEVYGD-LPHPEVENSFTETTXXX
ARNA_SHIF8      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_PSEAB      LPLVAIATPIEYTRNPLRVFELDFEENLRIVRYCVKYGKRVVFPSTSEVYG-MCQDPDFDEDRSNVGPIN
ARNA_SHIFL      LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYG-MCSDKYFDEDHSNVGPVN
ARNA_PSEAE      LPLVAIATPIEYTRNPLRVFELDFEENLRIVRYCVKYGKRVVFPSTSEVYG-MCQDPDFDEDRSNVGPIN
ARNA_PSEA8      LPLVAIATPIEYTRNPLRVFELDFEENLRIVRYCVKYGKRVVFPSTSEVYG-MCQDPDFDEDRSNVGPIN
ARNA_PSEFS      LPLVAIATPIEYTRNPLRVFELDFEENLKLVRYCVKYNKRVIFPSTSEVYG-MCQDQYFDEDTSNVGPVN
RFFG_ECOLI      MHLAAESGPAAFIETNIVTLLEAARAYWNALTEDKKSAFRFHHISTDEVYGDLHS---TDDFFTETTXXX
YFNG_BACSU      FHLAAQAIVGVANRNPISTFEANILGTWNILEACRKHPLRVIVASSDKAYGDQENLPYDENM-----PLQ
ARNA_PSEPF      LPLVAIATPIEYTRNPLRVFELDFEENLKLVRYCVKYNKRVIFPSTSEVYG-MCQDKHFDEDRSNVGPIN
ARNA_PSEA7      LPLVAIATPIEYTRNPLRVFELDFEENLRIVRYCVKYGKRVVFPSTSEVYG-MCQDPDFDEDRSNVGPIN
GALE_PASHA      IHFAGLKAVGETSENRYVTIKNNVTGSIVLVEEMLKANVNIVFSSSATVYGDPQIIPIVESVGGTTNP--
ARNA_PSEF5      LPLVAIATPIEYTRNPLRVFELDFEENLKLVRYCVKYNKRVIFPSTSEVYG-MCQDKNFDEDTSNVGPIN
GALE_NEIMC      IHFASVAEPMKYYDNNVSGSLVLAEEMARAGVF------KIVFSSSATVYGDPGKVPYTE----DMQPGD
VIPB_SALTI      LHQAALGSVPRSLKDPIATNSANIDGFLNMLTAARDAHVXXXXXXXXXXXGDHPDLPKIEERIGR--PL-
ARNA_KLEP7      LPLVAIATPIEYTRNPLRVFELDFEENLKIIRDCVKYNKRIIFPSTSEVYG-MCTDKNFDEDSSNVGPIN
RFBB_XANCB      LNFAAESGPGAFIQTNVVGTLALLEAVRKALPDTRRDAFRFLHVSTDEVYGTLGETGKFTE----TTPYA
GALE_HAEIN      IHFAGLKAVGESVQKPTEYYMNNVAGTLVLIQEMKKAGVNFVFSSSATVYGDPKIIPITEEVGGTTNPYG
ARNA_KLEP3      LPLVAIATPIEYTRNPLRVFELDFEENLKIIRDCVKYNKRIIFPSTSEVYG-MCTDKNFDEDTSNVGPIN
RFBB_XANCP      LNFAAESGPGAFIQTNVVGTLALLEAVRKALPDTRRDAFRFLHVSTDEVYGTLGETGKFTE----TTPYA
ARNA_YERE8      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRDCVKYNKRIVFPSTSEVYG-MCDDKEFDEDSSRVGPIN
ACBB_ACTS5      AHFAAETHVDVASGPFVASNLVGTQVLLDAA--LRHHIGRFLHVSTDEVYGSIDTGS-----WAEGHPLA
RFBB_ECOLX      MHLAAESGPAAF----IETNIVGTYVLLEAADDEKKKNFRFHHISTDEVYGD-LPHPDEVNSNETLQLFT
RFBB_SHIFL      MHLAAESGPAAF----IETNIVGTYVLLEAARSALKKSFRFHHISTDEVYGD-LPHPDEANNFTETTXXX
GALE_YERPE      IHFAGLKAVGESVNRPLEYYNNNVFGTLVLLEMRAAQVKNLIFSSSATVYGDQPQIPYVESF-----PTG
RHM1_ARATH      MHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQRFIHVSTDEVYGETDEDALVGNH--EASQLL
GALE_LACCA      AFSIVPESPLKYFDNNTGGMITLLEAMNQ---FGIKK---IVFSSTAATYGEPKQVPIKE-----TDPQV
GALE_NEIMB      IHFASVAEPMKYYDNNVSGSLVLAEEMARAGVFS------IVFSSSATVYGDPGKVPYTE----DMPPGD
GALE_ECOLI      IHFAGLKAVGESVQKPLEYYDNNVNGTLRISAMRAANVKNFIFSSSATVYGDQPKIPYVESF-----PTG
GALE_SALTY      IHFAGLKAVGESVARPLEYYDNNVNGTLRVSAMRAANVKNLIFSSSATVYGDQPKIPYVESF-----PTG
ARNA_PSE14      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRYCVKYNKRVIFPSTSEVYG-MCQDASFNEDTSNVGPIN
RFBE_SALTI      FHLAGQVAMTTSIDNPCMDFEINVGGTLNLLEAVRQSNCNIIYSSTNKVYGDLEQYKYNENGYDESTQLD
GALE_SALTI      IHFAGLKAVGESVAKPLEYYDNNVNGTLRVSAMRAANVKNLIFSSSATVYGDQPKIPYVESF-----PTG
GALE_DROME      AHFAALKAVGESCRIPLQYYHNNMTGTNVLLEAMADNNVKFVYSSSATVYGEPKFLPVTEEH-----PTG
GALE_DICDI      IHFAGLKAVGESNKLPLKYYNNNIAGTLTLLNLMKHRVKKLVFSSSATVYGDPHTVPITEDFLSATNPYG
ARNA_PSEU2      LPLVAIATPIEYTRNPLRVFELDFEENLKIVRYCVKYNKRVIFPSTSEVYG-MCQDANFNEDTSNVGPIN
GALE_NEIMA      IHFASVAEPMKYYDNNVSGSLVLAEEMARAGVFS------IVFSSSATVYGDPGKVPYTED-----MPLG
RFBB_ECOLI      MHLAAESGPAAFIETNIVGTYVLLEAARNALDSDKKNSFRFHHISTDEVYGD-LPHPD------EVNNTE
RHM3_ARATH      MHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQRFIHVSTDEVYGETDEDASVGNH--EASQLL
STRE_STRGR      VHLAAESHVDRSLLDASVFVRTNVHGTQTLLDAATRHGASFVQVSTDEVYGS------LEHSWTEDEPLR
FCL1_ORYSJ      LAAAKVGGIHANSTFPADFIAANLQIQTNVVDAALKCGSKLLFLGSSCIYPKFAPQPIPENSLGPLEPTN
CAPI_STAAU      VNLAAQAGVRYSIENPRTYIDSNIVGFMNILECSRHFNIQLIYASSSSVYGANTSKPNIDH------PL-
RMLB_STRMU      VHYAAESHNDNSLKDPSPFIYTNFVGTYILLEAARKYDIRFHHVSTDEVYGDPLREDLPGHGEGKYNP--
ARNA_WIGBR      LPLIAIARPMQYIKNPLKVFKIDFEENLKIIRYCVKYKKRIIFPSTSEVYGDYFDEENSNLVTGAIK--N
GALE_MOUSE      IHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMRAHGVKLVFSSSATVYGNPQYLPLDEAHGGCTNPYG
HLDD_ALHEH      FHLGACSATTEWDGRYM--MRNNFEYSRALFHWCQDRRIPFIYASSAAVYGGNSVFTEHPEHERPLNVYG
GALE_STRTR      IHFAAYSLVGESMEKPLKYFDNNTAGMVKLLEVMNECGVKIVFSSTAATYGIPEEIPILETTPQNINP--
GALE_HUMAN      IHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKLVFSSSATVYGNPQYLPLDEAHGGCTNPYG
TGDS_DICDI      IHLAAYTHVDNSFKQSIENNILGTHYLLETCKYKLKK---FIYVSTDEVYGSGLIEXXXXXXXXXXXXXX
FCL1_ARATH      LAAAKVGGIHANNTYPADFIGVNLQIQTNVIHSAYEHGVKLLFLGSSCIYPKPQPIPESALLTASLEPTN
YCL2_ECO11      FRLASLENPHAYADSNLTGFLNILEGCRH------NKIQHLLYASSSSVYGDSVDHPV------------
HLDD_THICR      FHEGACSATTEWDGKYM--MDNNYEYSKDLLNYCLNRKIPFLYASSAAVYGDGPTFIEERQYEKPLNVYG
GALE_PONAB      FHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKLVFSSSATVYGNPQYLPLDEAHGGCTNPYG
FCL2_ARATH      LAAAKVGGIHANNTYPADFIGVNLQIQTNVIHSAYTHGVKLLFLGSSCIYPKPQPIPESALLTGPLEPTN
GALE_CORDI      LHFAARSLVGESVEKPDEYWQHNMVTTLALLDAMKRNNVRIVFSSTAATYGEPETVPITED-----APTH
HLDD_AZOSE      FHEGACSSTTEWDGRFV--MAVNYEYTKSLLGWAVARKVPLLYASSASVYG---MGPTFRESREFEHPL-
GALE2_CYATE     IHFAGLKAVGESVQKPLLYYDNNLIGTIVLFEVMAAHGCKLVFSSSATVYGLPKEVPCTEEF-----PLS
EXOB_AZOBR      MHFAGSIVVPESVVKPLDYYRNNTANSLTLLGACLRAGIKVVFSSTAAVYGAPESVPIRED-----APTV
LPSL_RHIME      IHLAAQANPKAY----VDANLVGSWNMLELAKAIAPK--HLMLASTSSIYGANEKIPFAEADRAD-EPM-
GALE_PASMU      IHFAGLKAVGESVQKPAEYYMNNVTGSLVLIQEMKKAGVNFVFSSSATVYGDPEIIPITEKVGGTTNPYG
GALE_NEIGO      IHFASVAEPTKYYGNNVYGSLVLAE------EMARAGVLKIVFSSSATVYGDAEKVPYTE----DMRPGD
GALE_YEREN      IHFAGLKSVGESVEKPIEYYQNNVGSITLLEEMCLANVKKLIFSSSATVYGEPEFVPLTERIGGTTNP--
GALE_STRMU      IHFAAYSLVAESMKKPLKYFDNNTAGMIKLLEVMSEFGVKIVFSSTAATYGIPDEIPIKE-----TTPQR
HLDD_SHELP      FHQGACSSTTEWDGKFM--MANNYEYSKTLLHFCERNGSQFIYASSASVYGGSIEQRELE------KPL-
HLDD_DESVV      VHMGACSAT---TERDADFLMENNRYSRMLCELCMETGARFINASSAATYGDSLGFSDDDATMLRLKPLN
HLDD_DESVH      VHMGACSAT---TERDADFLMENNRYSRMLCELCMETGARFINASSAATYGDSLGFSDDDTTMLRLKPLN
HLDD_BRAHW      FHQGA-CSDTMETDGKY-MMKNNYEYTKNILHICLDKKIRLFYASSASVYGN--GENGFEEDEKNEYPL-
FCL_DICDI       ---------------------INDNVLACCKEFNVVK---CVSCLSTCIFPDKTTYPIDETMIHNGPPHP
ARAE4_ARATH     MHFAAVAESTLYPLKYYHNITSNTLGVLEA--MARHKVKKLIYSSTCATYGEPEKMPITED-----TPQV
YHEB_SCHPO      INFAAESSDPLYTQNLLECV-----RILLGKKEELRNRLNFVHVSTDEVYGEQDENASVDEK-SKLNP--
HLDD_SHEPW      FHQGACSSTTEWDGKFM--MSNNYEYSKTLLQFCDRTKCQYIYASSASVYG------------GSEKFIE
GALE_ERWAM      IHFAGLKAVGASTRKPLEYYQNNVTGTLVLLEEMRSAGVQFIFSSSATVYGADAPVPYVE-----TTPIG
HLDD_PELCD      EAIIHQGACSTTTEWDGRYMMENNYAYSKLLHYCLERRIPFLYASSAATYGGGCEEPQYE------RPL-
GM4D_SHIFL      YNLGAMSHVAVSFESPEYTADVDAMGTLRLLELGLEKKTRFYQASTSELYGLVQEIPQKE-----TTPFY
GM4D_ECOLI      YNLGAMSHVAVSFESPEYTADVDAMGTLRLLELGLEKKTRFYQASTSELYGLVQEIPQKE-----TTPFY
GM4D_ECOL6      YNLGAMSHVAVSFESPEYTADVDAMGTLRLLELGLEKKTRFYQASTSELYGLVQEIPQKE-----TTPFY
GM4D_ECO57      YNLGAMSHVAVSFESPEYTADVDAMGTLRLLELGLEKKTRFYQASTSELYGLVQEIPQKE-----TTPFY
GALE3_ARATH     IHFAGLKAVGESVEKPLLYYNNNIVGTVTLLEVMAQYGCKLVFSSSATVYGWPKEVPCTEE-----SPIS
YGRE_SCHPO      IHFAGLKAVGESVQVPLSYYKNNISGTINLIECMKKYNVRFVFSSSATVYGDP-TRP------GGTIPIP
HLDD_AERS4      FHEGACSATTEWNGKFI--MEVNYEYSKDLFHYCIEREIPFIYASSAATYGNFIEDPKFE------QPL-
ARAE2_ORYSJ     MHFAAVAYVGESTLEPLRYYNITSNTLTVLEAMAAYNVKTLIYSSTCATYGEPDTMPITEATPQNINP--
HSDD1_ARATH     FHMAAPDSSINNHQLQYS---VNVQGTTNVIDACIEVGVRLIYTSSPSVVFDGV-HGTLNADESLPYPPK
HLDD_AERHH      FHEGACSATTEWNGKFI--MEVNYEYSKDLFHYCIEREIPFIYASSAATYGNFIEDPKFE------QPL-
GM4D_YERE8      YNLGAQSHVAVSFESPEYTADVDAMGTLRLLEAVLEHKTRFYQASTSELYGLVQEIPQRE-----TTPFY
GALE_RAT        IHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMRAMGVKLVFSSSATVYGKPVASGRGPPHRGCTKPYG
EXOB_RHIME      -------------ARHKPRAILHFAAMIEVGESVKDPAAAFVFSSTCATYGLPDSVPMDESHQAPINPYG
GALE_STRLI      LHFASVVKPEKYWDNNVGGTMALLEAM---------RGARLVFSSTAATYGEPEQVPIVES-----APTR
GAE3_ARATH      MHLAAQANPSSYVHSNIAGFV----NLLEVCKSANPQPA-IVWASSSSVYGLNTKVPFSEKD----RTDQ
GAE2_ARATH      MHLAAQANPGSYVHSNIAGFV----NLLEVCKSANPQPA-IVWASSSSVYGLNTKVPFSEKD----RTDQ
ARAE1_ARATH     MHFAAVAYVGESTQFPLKYYHNITSNTLVVLETMAAHGVKLIYSSTCATYGEPDIMPITEE-----TPQV
HLDD_POLSJ      FHEGACSD----TMELDGKYMMDNNYTLSCELFCQEQGTRLLYASSAATYGGSDTFSESPEFERPLNVYG
HLDD_NITOC      IHQGACSATTEWNGRYM--MENNFYYSKRLLHYCLERRIPFLYASSAAVYGCGLTHREFE---------A
GMDS_HUMAN      FDLAEYTADGVGTLRLLDCGLINS--------------VKFYQASTSELYGKVQEIPQKE-----TTPFY
GALE1_PEA       IHFAKAVGESVENPRRFDNNLVGTINLYEV--MAKHNCKKMVFSSSATVYGQPEKIPCVEFKLQAMNPYG
GAE4_ARATH      MHLAAQAGVRYAMENPSSYVHSNIAGFVNLLEISVNPQPAIVWASSSSVYGLNTKVPFSEKDKTDQ----
GALE1_CYATE     IHFASVLNPSNYYDNN----LVATINLFQVSKFNCKK---LVISSSATVYGQPDQIPCVESNLHAMNPYG
GAE1_ARATH      YALENPQS---YVHSNIAGLV----NLLEICKAANPQPA-IVWASSSSVYGLNEKVPFSESDRTDQ----
ARAE3_ARATH     MHFAAVADPLKYYHNITSNTLVVLEAV------ARHKVKKLIYSSTCATYGEPDKMPIVE-----VTPQV
HLDD_AZOSB      FHEGACSSTTEWDGRFV--MRVNYEYTKALLAWCTQRKIPLIYASSASVYG---MGPTFREAREFEQPL-
GMDS_MOUSE      FDLAEYTADGVGTLRLLDCGLINS--------------VKFYQASTSELYGKVQEIPQKE-----TTPFY
FCL2_ORYSJ      ---ASSAAPAEY-------LTENLRITVNVVDAARRCGSKLLVLASSTIYPADAPQPTPESALLTGPPAE
GMDS_CRIGR      FDLAEYTADGVGTLRLLDCGLINS--------------VKFYQASTSELYGKVQEIPQKE-----TTPFY
GALE1_ARATH     IHFAGLKAVGESVENPRRYFDNNLVGTINLYETMAKYNCKMVFSSSATVYGQPEKIPCMEFELKAMNPYG
GAE6_ARATH      LHLAAQAGVR-YAMKNPQSYIASNIALLEVAKAANPQPA-IVWASSSSVYGLNTENPFSEEH----RTDQ
GMD1_ARATH      YNLAAQSHVPDYTADVVATGALRLLEAVRSHNIDNGRAIKYYQAGSSEMFGST-PPPQSE-----TTPFH
FCL_HUMAN       HLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTIFPDKTTYPIDETMIHNGPPHN
HLDD_SHEFN      FHQGACSSTTEWDGKFM--MANNFEYSKTLLHYSQANNCQFIYASSASVYGGSIEQRELE------KPL-
HLDD_CHRVO      LHQGACSDTMNHDGKYM--MDNNYQYTLALFDYCQHEEIQFLYASSAATYGKGTVFKEERQHEGPLNVYG
GMD2_ARATH      YNLAAQSHVPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGST-PPPQSE-----TTPFH
FCL_ECOLI       ---------------------------------------KLLFLGSSCIYPKLAKQPMAESELGTLEPTN
NOEL_RHISN      YNLAAQSHVQVSFETPEYTANADAIGTLRMLELGLTNRTRFYQASTSELYGLAQESPQNEK-----TPFY
HSDD2_ARATH     FHMAAPDSSINNHQLQYS---VNVQGTQNVIDACVDVGVRLIYTSSPSVVFDGV-HGILNGTESMAYPIK
HLDD_CHRSD      FHEGACSDTTEWDGKFM--LENNFEYSKVLLHFCQYKRIPFLYASSAATYGGSEVFVEAPEHEKPLNVYG
EXOB_RHILT      HFAASVKDPVSFYENNV----IGTLTLLSAAQAAGINA--FVFSSTCATYGLPQSVPLDEHRQVPINPYG
ARAE2_ARATH     MHFAAVAYVGESTQFPLKYYHNITSNTLVVLETMAAHGVKLIYSSTCATYGEPEKMPITEE-----TPQV
GAL10_KLULA     LHFAGLKAVGESTQIPLTYYFNNIVGTINLLECMKSHDVKLVFSSSATVYGDATRFENM-IPIPETCPTG
NSDHL_MOUSE     STVFHCASPPPYSNNKELFYRVNFIGTKTVIETCREAGVQILTSSASVVFEGVDIKNGTEDLPYAMKPI-
HLDD_POLNS      FH--EGACSDTMETDGIFMMANNYRYTMDLLDICTAQKVQLLYASSAATYGGSDVFVESREHEKPLNIYG
HLDD_MARAV      FHEGACSDT---TEWDGKFMMENNYTYSKVLHWCLDRKVPFLYASSAAVYGASDEFREERECERPLNVYG
NOEL_RHIFR      YNLAAQSHVQVSFETPEYTANADAIGTLRMLELGLIHRTRFYQASTSELYGLAQEIPQNEK-----TPFY
HLDD_RALEH      FH-EGACSDTMETDGRY-MMENNYRYTLSLMESCLEQGTQFLYASSAATYGASQVFREDREFERPLNVYG
HLDD_PSEA7      FHQGACASTLESNGRYM--MENNYRYSCRLLEASLELGVPFLYASSAAVYGAGRTFREARRYERPLNVYG
NSDHL_RAT       STVFHCASPPSNSNNKELFYRVNSTGTKTVIETCKEAGVQILTSSASVVFEGVDIKNGTEDLPYAMKPI-
FCL_MOUSE       -----------------------------VLHSAFEVGARKVVSCLSTIFPDKTTYPIDETMIHNGPPHS
ARAE3_ORYSJ     MHFAAVAYVGESTLEPLRYYHNITSNTLLILEAMASHGVKLIYSSTCATYGEPEKMPIVETRQLPINP--
NSDHL_BOVIN     STVFHCASPPPFNNNKELFYRVNYIGTKNVIETCKEAGVQILTSSASVIFEGVDIKNGTEDLPYATKPI-
GAL10_YEAST     IHFAGLKAVGESTQIPLRYYHNNILGTVVLLELMQQYNSKFVFSSSATVYGDATRFPNM-IPIPEECPLG
GALE_CORGL      VHFAARSLVGESVEKPNEYWHDNVVTALTLLDAMRAHGVNLVFSSTAATYGEPDVVPITEDM-----PTQ
FCL_PONAB       -----------------------------VLHSAFEVGARKVVSCLSTIFPDKTTYPIDETMIHNGPPHS
ARAE1_ORYSJ     MHFAAVAYVGESTLEPLRYYNITSNTLVVLEAMAAHNVRTLIYSSTCATYGEPEKMPITEG-----TPQF
HLDD_EDWI9      FHEGACSSTTEWDGKYV--MDNNYQYSKELLHFCLERQIPFLYASSAATYGMTDKFVEDRHYEGPLNVYG
GALE_MYCGE      FHFAAKTSVSESVHNPLKYFDCNVIGTLNLAISNLQKPIKLFFASSAAVYGQTISEEIVITETQATNPYG
HLDD_CUPTR      FH-EGACSDTMETDGRY-MMENNYRYTLSLMESCLEQGTQFLYASSAATYGASQVFREDREFERPLNVYG
HLDD_VIBVY      FHEGACSATTEWDGKYM--MLNNYEYSKELLHYCLEREIPFLYASSAATYGETTVFKEEREYEGALNVYG
HLDD_VIBVU      FHEGACSATTEWDGKYM--MLNNYEYSKELLHYCLEREIPFLYASSAATYGETTVFKEEREYEGALNVYG
HLDD_THIDA      FH-EGACSDTMETDGRY-MMDNNYRYSGALLKFCQDEGAQFLYASSASVYGSGRVFSESRECESPLNVYG
HLDD_RHOFD      FHEGACSDT---MESNGKYMMDNNYATVNLFQACQKRGARLLYASSAATYGDPAFERPLNVYGYSKLLFD
HLDD_PASMU      FHEGACSATTEWDGKYI--MHNNYEYSKELLHYCLDREIPFFYASSAATYGDKTEFREEREFEAPLN---
GM4D1_VIBCH     YNLGAQSHVAVSFQSPEYTADVDAIGTLRLLELGLTKKTKFYQASTSELYGLVQEIPQKE-----TTPFY
GAL10_SCHPO     ALKASMKLPLEYYDNNI-CGTITLLNVMRE-----HRVKTVVFSSSATVYGDAT-------RFDNMIPIP
FCL_CRIGR       -----------------------------VLHSAFEVGTRKVVSCLSTIFPDKTTYPIDETMIHNGPPHS
NSDHL_HUMAN     NTVFHCASPPPSSNNKELFYRVNYIGTKNVIETCKEAGVQILTSSASVIFEGVDIKNGTEDLPYAMKPI-
HLDD_HAMD5      FHLGACSSTMEWDGQFM--MKNNYEYSKTLLHFCLKACIPFLYASSAAVYGGRIEEPQYE------KPL-
GMDS_DICDI      SNLHSIVSKEIYNQSHVKVSFDMSEYTGDVRSCGMEKKVKYYQASTSELYGKVQEIPQSE-----TTPFY
GAE5_ARATH      MHLAAQAGVRYAMQNYVNSNIAGFVNLLEVSKSANPQPA-IVWASSSSVYGLNSKVPFSEKD----RTDQ
HLDD_VIBF1      FHEGACSATTEWDGKYI--MMNNYEYSKELLHFCIEREIPFLYASSAATYGETDTFIEERAYEGALNVYG
HLDD_BORA1      RAVLHQGACSDTTERNGQYMMDNNYRVLEWFEYCQANRVPLIYASSAAVYGASTVYVEDPANEGPLNVYG
GMDS_DROME      YNLAAQSHVKVSFDLSEYTAEVDAVGTLRILDAGMEKNVRFYQASTSELYGKVVETPQNEQ-----TPFY
HLDD_POLNA      FH--EGACSDTMEPDGKYMMANNYTLSCNLFRACQNQNTRLLYASSAATYGGSDTFSESPEFEKPLNVYG
HLDD_NEIMA      FHQGACSDTMNYDG--LYMMDNNYQYTLDLLDWCQDERIPFLYASSAAVYGKGEIFREERELEKPLNVYG
HLDD_VIBFM      FHEGACSATTEWDGKYI--MMNNYEYSKELLHFCIEREIPFLYASSAATYGETDTFIEEREYEGALNVYG
HLDD_NEIM0      FHQG--ACSDTMNHDGLYMMDNNYQYTLDLLDWCQDERIPFLYASSAAVYGKGEIFREERELEKPLNVYG
HLDD_SALPC      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLERGIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_SALCH      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLERGIPFLYASSAATYGGRTSFIESREYEKPLNVYG
GM4D2_VIBCH     YNLGAQSHVAVSFESPEYTADVDAMGTXXXXXXXXXKTTKFYQASTSELYGLVQETPQKE-----TTPFY
HLDD_SODGM      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCMERTIPFLYASSAATYGGRTEHFIEDRQY--EQPL-
HLDD_RALEJ      FHLG--ACTDTMEQDGRYLMENNYRYSKTLMELCLAQDTQFIYASSAAVYGESHSFREAREYERPLSVYG
HLDD_NEIMB      FHQG--ACSDTMNHDGLYMMDNNYQYTLDLLDWCQDERIPFLYASSAAVYGKGEIFREERELEKPLNVYG
HLDD_NEIMF      FHQG--ACSDTMNHDGLYMMENNYQYTLDLLNWCQDERIPFLYASSAAVYGKGEIFREERELEKPLNVYG
GM4D_PSEAE      ---------------------------------------RFYQASTSEMFGLIQAERQDEN-----TPFY
HLDD_SALG2      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_SALEP      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_SALDC      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_RALPJ      FH-EGACSDTMETDGRY-MMDNNYRYSLAVMRACLDQGVQFLYASSAATYGASETXXXXXXXXXXLNVYG
HLDD_PSYIN      FHEGACSATTEWNGKFM--MENNYEYSKDLLHYCIERDIPFLYASSAATYGGNDTFKEELKYEKPLNVYG
HLDD_PHOLL      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLERRTPFLYASSAATYGGRTDNFIEERQY--EKPL-
GALE_KLEPN      IHFAGLKAVGESVAKPLEYYDNNVTGTLKLVSAMRAAGVKFIFSSSATVYGDQPKIPYVE----------
HLDD_PROMH      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLDRQIPFLYASSAATYGGRTDHFIEERKYAPLNVYG
HLDD_HAEIG      FHEGACSATTEWDGKYI--MHNNYEYSKELLHYCLDREIPFFYASSAATYGDTKVFREEREFEGPLNVYG
HLDD_HAEI8      FHEGACSATTEWDGKYI--MHNNYEYSKELLHYCLDREIPFFYASSAATYGDTKVFREEREFEGPLNVYG
GALE2_ARATH     IHFAGLKAVGESVEKPLLYYNNNLVGTITLLEVMAQHGCKLVFSSSATVYGSPKEVPCTEEF-----PIS
HLDD_HAEIN      FHEGACSATTEWDGKYI--MHNNYEYSKELLHYCLDREIPFFYASSAATYGDTKVFREEREFEGPLNVYG
HLDD_BURP8      FH-EGACSDTMETDGRY-MMDNNFRYSRAVLDACLAQGVQFLYASSAATYGGSTRFVEEREVEAPLNVYG
HLDD_SALTY      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_SALTI      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_SALSV      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_SALPK      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_SALPB      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_SALPA      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_SALNS      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_SALHS      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_SALAR      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_SALA4      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_PSEAE      FHQGACASTLESNGRYM--MENNYRYSCRLLESSLELGVPFLYASSAAVYGSGRTFREARQYERPLNVYG
HLDD_BURVG      FH-EGACSDTMETDGRY-MMDNNFRYSRAVLDACLAQGAQFLYASSAAIYGGSTRFVEEREVEAPLNVYG
HLDD_BURM1      FH-EGACSDTMETDGRY-MMDNNFRYSRAVLDACLAQGAQFLYASSAAIYG------------GSTRFVE
HLDD_BURCM      FH-EGACSDTMETDGRY-MMDNNFRYSRAVLDACLAQGAQFLYASSAAIYGGSTRFVEEREVEAPLNVYG
HLDD_BURA4      FH-EGACSDTMETDGRY-MMDNNFRYSRAVLDACLAQGAQFLYASSAAIYGGSTRFVEEREVEAPLNVYG
TGDS_MIMIV      VHFAAHSHVDNSFKNSLETNVFGTHVLLECSRM-YGKLKLFFHMSTDEVYGEIDTTDTSRE----VSLLC
SPSK_BACSU      VNSAAFTSVDQCEKELDKAYLINGIGAYYTALESTRIGAQYVHISTDYVFNGKGTQPYRED-----DPLD
HLDD_ECOSM      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPLLYASSAATYGGRTSFIESREYEKPLNVYG
FCL_DROME       -----------------------------VLQTAHEQGCKVVSCLSTCIFPDKTSYPIDETMVHNGPPHP
YFHF_BACSU      INLAGKSIFGRWTEKTKQHILSSTREVQRLIQKQKEKPKTLIQASAVGIYGTSL----------------
HLDD_VIBCM      FHEGACSATTEWDGKYV--MLNNYEYSKELLHYCLDREIPFLYASSAATYGETDTFIEEPQYEGALNVYG
HLDD_VIBCH      FHEGACSATTEWDGKYV--MLNNYEYSKELLHYCLDREIPFLYASSAATYGETDTFIEEPQYEGALNVYG
HLDD_VIBC3      FHEGACSATTEWDGKYV--MLNNYEYSKELLHYCLDREIPFLYASSAATYGETDTFIEEPQYEGALNVYG
HLDD_PSEAB      FHQGACASTLESNGRYM--MENNYRYSCRLLESSLELGVPFLYASSAAVYGAGRTFREARQYERPLNVYG
HLDD_RALME      FHEGA-CSDTMETDGRY-MMENNYRYTLALLEACLEQGAQFLXXXXXXXXXXXXMFREDRDYEKPLNVYG
HLDD_ENTS8      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSDFIESREY--EKPL-
Y4AF_RHISN      ----------------------------------------------------------------------
HLDD_SHISS      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_SHIFL      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_SHIF8      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_SHIDS      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_SHIBS      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_SHIB3      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_RALSO      FH-EGACSDTMETDGRY-MMENNYRYTLALMKACLDQGVQFLYASSAATYGASDTFREDREFEKPLNVYG
HLDD_MANSM      FHEGACSATTEWDGKYL--MHNNYEYSKELLHYCLDREIPFFYASSAATYGDKTDFIEEREFEGPLN---
HLDD_KLEP7      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEQPLNVYG
HLDD_KLEP3      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEQPLNVYG
HLDD_ESCF3      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECOUT      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECOSE      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECOLU      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECOLI      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECOL6      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECOL5      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECOK1      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECODH      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECOBW      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECO8A      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECO81      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECO7I      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECO5E      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECO57      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECO55      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECO45      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECO27      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECO24      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_BURS3      FH-EGACSDTMETDGRY-MMDNNFRYSRAVLDTCLAQGTQFLYASSAAIYGGSTRFVEERDVEAPLNVYG
HLDD_BURCH      FH-EGACSDTMETDGRY-MMDNNFRYSRAVLDTCLAQGTQFLYASSAAIYGGSTRFVEERDVEAPLNVYG
HLDD_BURCC      FH-EGACSDTMETDGRY-MMDNNFRYSRAVLDTCLAQGTQFLYASSAAIYGGSTRFVEERDVEAPLNVYG
HLDD_BURCA      FH-EGACSDTMETDGRY-MMDNNFRYSRAVLDTCLAQGTQFLYASSAAIYGGSTRFVEERDVEAPLNVYG
GMD2_CAEEL      FDL------PEYT---AEVDAVGTLRLLDAIHACLTEKVRFYQASTSELYGKVQEIPQSE-----LTPFY
YGAE_ERWAM      MHLAAESGPAAF----IETNMIGTYVLLEAARMERKEAFRLHHISTDEVFGD------------------
HLDD_ENT38      FHEGACSSTTEWDGKYM--MDNNYQYSKEVLHYCLEHEIPFLYASSAATYGGRTSFIESREYEQPLNVYG
HLDD_CITK8      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLERDIPFLYASSAATYGGRTSDFIESREY--EKPL-
HLDD_BURCJ      FH-EGACSDTMETDGRY-MMDNNFRYSRAVLDTCLMQGTQFLYASSAAIYGGSTRFVEERDVEAPLNVYG
HLDD_YERE8      FHEGACSSTTEWDGKYM--MDNNYQYSKDILHFCLDRGIPFLYASSAATYGGRTDNFIEDRQY--EQPL-
HLDD_KLEPN      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEQPLNVYG
GALE_MYCPN      FHFAAKTSVKESTEQPLTYFDHNLVGTLNLALKELQKPIQLFFSSTAAVFGSASTLPIPE------NLVL
HLDD_YERPY      FHEGACSSTTEWDGKYM--MDNNYQYSKDILHFCLDRSIPFLYASSAATYGGRTDNFIEDRQY--EQPL-
HLDD_YERPS      FHEGACSSTTEWDGKYM--MDNNYQYSKDILHFCLDRSIPFLYASSAATYGGRTDNFIEDRQY--EQPL-
HLDD_YERPP      FHEGACSSTTEWDGKYM--MDNNYQYSKDILHFCLDRSIPFLYASSAATYGGRTDNFIEDRQY--EQPL-
HLDD_YERPN      FHEGACSSTTEWDGKYM--MDNNYQYSKDILHFCLDRSIPFLYASSAATYGGRTDNFIEDRQY--EQPL-
HLDD_YERPG      FHEGACSSTTEWDGKYM--MDNNYQYSKDILHFCLDRSIPFLYASSAATYGGRTDNFIEDRQY--EQPL-
HLDD_YERPE      FHEGACSSTTEWDGKYM--MDNNYQYSKDILHFCLDRSIPFLYASSAATYGGRTDNFIEDRQY--EQPL-
HLDD_YERPB      FHEGACSSTTEWDGKYM--MDNNYQYSKDILHFCLDRSIPFLYASSAATYGGRTDNFIEDRQY--EQPL-
HLDD_YERPA      FHEGACSSTTEWDGKYM--MDNNYQYSKDILHFCLDRSIPFLYASSAATYGGRTDNFIEDRQY--EQPL-
HLDD_YERP3      FHEGACSSTTEWDGKYM--MDNNYQYSKDILHFCLDRSIPFLYASSAATYGGRTDNFIEDRQY--EQPL-
HLDD_RHILO      FHQGACSTTTEWNGKMMEVNFAYSKRLLHACQAPRVPFLXXXXXXXXXXXXEFREEPALERPL-NVYAYS
Y2119_STAHJ     VNLAGATLTPSYKQLIMTSRIQSTQSLVDLFSQREHKPEVLFNASAMGYYPPSLYHTYTEKY--QTHPFD
HLDD_HAEDU      FHQGACSSTTEWNGKYL--MQNNYEYSKELLHFCVDRQIPFLYASSAATYGGRADNFIEERKFGPLNAYG
HLDD_ECOLC      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
HLDD_ECOHS      FHEGACSSTTEWDGKYM--MDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSFIESREYEKPLNVYG
Y4NG_RHISN      FH--NVAQVPLAKEKDLFWSVNCGGTQIIVDESVATGIEKFVYTSSSAVFGAPKSNPVTEE--TEPNPAE
YFCH_ECOLI      INLAEPIADKRWTHEQKERLCQSTQKLVDLINASDTPPSVLISGSATGYYGD-LGEVVVTEEEPPHNEFT
Y1061_METJA     FHAAALKHVPLCEYNPFEAVKTNVIGTQNLIEVAMDE---------------------------------
HLDD_FUSNN      IHMGACSAT---TETDADFLMDNNFGYTKFLNFCAEKNIKYIYASSAATYGDDVSPEELQ----KLMPLN
Y1223_SYNY3     INLASERWTEAYKAEIFDSRKLGTEKLVEAIAKADRKPQVMISGSAIGYYG-------------------
GAL10_CANMA     ----------------------------------------------------------------------
HLDD_PECCP      FHEGACSSTTEWDGKYM--MDNNYQYSKDVLHYCLDRNIPFLYASSAATYGG-----------RNDNFIE
Y2567_STAAR     INSAGQMLSSKITDYQVDMIDVNIKGTLYTAKAAL-----------------------------------
STRL_STRGR      VNCAAWTAVDEAESEPALAMAVNGEGPRHLAQACRAVGAVLLQLSTDYVFPGSGGRPYREDH-----PTG
Y2778_STAA8     INSAGQMLSSKITDYQVDMIDVNIKGTLYTAQAAL-----------------------------------
Y2488_STAAC     INSAGQMLSSKITDYQVDMIDVNIKGTLYTAQAAL-----------------------------------
Y2422_STAA3     INSAGQMLSSKITDYQVDMIDVNIKGTLYTAQAAL-----------------------------------
HLDD_BURPP      ----------------------------------------------------------------------
D39U1_BOVIN     ----------------------------------------------------------------------
YQJ9_SCHPO      ----------------------------------------------------------------------
YL056_YEAST     F---------------------------------------------------------------------
Y2478_STAAM     INSAGQMLSSKITDYQVDMIDVNIKGTLYTAQAAL-----------------------------------
Y2266_STAAN     INSAGQMLSSKITDYQVDMIDVNIKGTLYTAQAAL-----------------------------------
Y1014_HAEIN     FHLAAIVS--------------------------------------------------------------
YGI2_SCHPO      ----------------------------------------------------------------------
RCP_VIBCH       INLRPDNRLPINAEEKPKAGIARSR--LDITEQLVEK---------------------------------
Y2403_STAAW     INSAGQMLSSKITDYQVDMIDVNIKGTLYTVQAAL-----------------------------------
Y2370_STAAS     INSAGQMLSSKITDYQVDMIDVNIKGTLYTVQAAL-----------------------------------
Y2073_MYCBO     ----------------------------------------------------------------------
Y2047_MYCTU     ----------------------------------------------------------------------
SQD1_SPIOL      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ERSCYDEGKRFAEALLSAMRLEQGLNAGIIRIFNTYGPRMHPFDGRVISGFVRQALANEPLTVFGDGSQT
UXS1_RAT        PRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQT
UXS1_PONAB      PRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQT
UXS1_MOUSE      PRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQT
UXS1_HUMAN      PRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQT
UXS1_XENTR      PRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEQLTVYGSGEQT
UXS1_DANRE      PRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGSRMHMNDGRVVSNFILQALQGEALTVYGSGSQT
GALE_METJA      PLSPYGLSKYVGEEYIKLYNRLYGIEYAILRYSNVYGERQDPGEAGVISIFIDKMLKNQSPIIFGDGNQT
YTCB_BACSU      VT------KLTGEKLCHVYKQSFGIPIVILRFFTVYGPRQRP--DMAFHRLIKQHLQQKPLTIFGDGQQS
TGDS_MOUSE      PTNPYASSKAAAECFVQSYWERYKFPVVITRSSNVYGPHQYP--ERVIPKFISLLQHNRKCCIHGSGLQR
TGDS_BOVIN      PTNPYASSKAAAECFVQSYWEQYKFPVVITRSSNVYGPHQYP--EKVIPKFISLLQHNRKCCIHGTGLQT
ARNA_AERS4      QRWIYSVSKQLLDRVIWAYGKKEGLNFTLFRPFNWMGPRLDSLDSRAITQLILNLVDGTPIQLVDGGAQK
TGDS_HUMAN      PTNPYASSKAAAECFVQSYWEQYKFPVVITRSSNVYGPHQYP--EKVIPKFISLLQHNRKCCIHGSGLQT
ARNA_SERP5      QRWIYSVSKQLLDRVIWAYGAKEGLKFTLFRPFNWMGPRLDNLDSRAITQLILNLVEGSPIKLMDGGAQK
ARNA_PHOLL      QRWIYSVSKQLLDRVIWAYGEKEGLKFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLVDGGEQK
GME1_ORYSI      PQDAYGLEKLATEELCKHYTKDFGIECRVGRFHNIYGPFGTWKGGRAPAAFCRKATSTDRFEMWGDGLQT
SPSJ_BACSU      PNNPYSASKASSDLLVLSYVKTHKLPAIITRCSNNYGPYQH--SEKMIPTIIRHAKQGLPVPLYGDGLQI
GME1_ORYSJ      PQDAYGLEKLATEELCKHYTKDFGIECRVGRFHNIYGPFGTWKGGRAPAAFCRKATSTDRFEMWGDGLQT
ARNA_SALTY      KRWIYSVSKQLLDRVIWAYGEKEGLRFTLFRPFNWMGPRLDSLNSRAITQLILNLVEGTPIKLIDGGQQK
ARNA_SALPC      KRWIYSVSKQLLDRVIWAYGEKEGLRFTLFRPFNWMGPRLDSLNSRAITQLILNLVEGTPIKLIDGGQQK
ARNA_SALPB      KRWIYSVSKQLLDRVIWAYGEKEGLRFTLFRPFNWMGPRLDSLNSRAITQLILNLVEGTPIKLIDGGQQK
ARNA_SALNS      KRWIYSVSKQLLDRVIWAYGEKEGLRFTLFRPFNWMGPRLDSLNSRAITQLILNLVEGTPIKLIDGGQQK
ARNA_SALHS      KRWIYSVSKQLLDRVIWAYGEKEGLRFTLFRPFNWMGPRLDSLNSRAITQLILNLVEGTPIKLIDGGQQK
ARNA_SALG2      KRWIYSVSKQLLDRVIWAYGEKEGLRFTLFRPFNWMGPRLDSLNSRAITQLILSLVEGTPIKLIDGGQQK
ARNA_SALEP      KRWIYSVSKQLLDRVIWAYGEKEGLRFTLFRPFNWMGPRLDSLNSRAITQLILNLVEGTPIKLIDGGQQK
ARNA_SALDC      KRWIYSVSKQLLDRVIWAYGEKEGLRFTLFRPFNWMGPRLDSLNSRAITQLILNLVEGTPIKLIDGGQQK
ARNA_SALCH      KRWIYSVSKQLLDRVIWAYGEKEGLRFTLFRPFNWMGPRLDSLSSRAITQLILNLVEGTPIKLIDGGQQK
ARNA_SALA4      KRWIYSVSKQLLDRVIWAYGEKEGLRFTLFRPFNWMGPRLDSLNSRAITQLILNLVEGTPIKLIDGGQQK
ARNA_SODGM      QRWIYSVSKQLLDRVLWAYGEKEGLRFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSHIKLVDGGAQK
Y1055_METJA     --SLYASTKRSNELMAHVYHHLYGIKMIGLRFFTVYGEYGRP--DMAYFKFAKNILLGKEIEVYNYGNME
GALE_BACSU      ATNPYGQTKLMLEQILRDLHADNEWSVALLRYFNPFG--AHP-SGRILMPYVAQVAVGEQLSVFGDGTGV
ARNA_SHESH      QRWIYSTSKQLLDRVIWAYGKKDNLKFTLFRPFNWMGPRLDSLNSRAITQLILNLVEGTPIKLIDGGEQK
ARNA_PECCP      QRWIYSVSKQLLDRVIWAYGAKNGLRFTLFRPFNWMGPRLDTLDSRAITQLILNLVEGSPIKLVDGGAQK
ARNA_ERWCT      QRWIYSVSKQLLDRVIWAYGAKNGLRFTLFRPFNWMGPRLDTLDSRAITQLILNLVEGSPIKLVDGGAQK
ARNA_ENT38      QRWIYSVSKQLLDRVIWAYGEKEGLRFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGRQK
ARNA_ECOUT      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECOK1      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECO45      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_SHISS      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_SALSV      KRWIYSVSKQLLDRVIWAYGEKEGLRFTLFRPFNWMGPRLDSLNSRAITQLILNLVEGTPIKLIDGGQQK
ARNA_ECOSM      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECOLU      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECO81      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECO7I      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECO27      KRWIYSVSKQLIDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_AERHH      QRWIYSVSKQLLDRVIWAYGKKEGLNFTLFRPFNWMGPRLDSLDSRAITQLILNLVDGTPIQLVDGGAQK
ARNA_ESCF3      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECOL6      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
RHM2_ARATH      PTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFP--EKMIPKFILLAMSGKPLPIHGDGSNV
RFBB_RHISN      XXXXXXXXXHFA----TAWQRTYGLPVVISNCSNNYGP--FHFPEKLIPLMILNALDRKPLPVYGTGSNI
ARNA_SHIDS      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_SHIBS      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_PROMH      QRWIYSVSKQLLDRVIWAYGAKEGLKFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLVDGGEQK
ARNA_ERWT9      QRWIYSVSKQLLDRVIWAYGDKEGLRFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGRQK
ARNA_ECOSE      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECOLI      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECOLC      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECOL5      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECOHS      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECODH      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECOBW      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECO8A      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECO5E      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECO57      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECO55      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_ECO24      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
RFBB_NEIGO      XXXXXXXXXXXXDHLVRAWQRTYRLPSIVSNCSNNYGPRQFP--EKLIPLMILNALSGKPLPVYGDGAQI
ARNA_SHIB3      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
GME2_ORYSJ      PQDAYGLEKLATEELCKHYTKDFGIECRVGRFHNIYGPFGTWKGGRAPAAFCRKALTSDRFEMWGDGLQT
ARNA_SALTI      KRWIYSVSKQLLDRVIWAYGEKEGLRFTLFRPFNWMGPRLDSLNSRAITQLILNLVEGTPIKLIDGGQQK
ARNA_SALPK      KRWIYSVSKQLLDRVIWAYGEKEGLRFTLFRPFNWMGPRLDSLNSRAITQLILNLVEGTPIKLIDGGQQK
ARNA_SALPA      KRWIYSVSKQLLDRVIWAYGEKEGLRFTLFRPFNWMGPRLDSLNSRAITQLILNLVEGTPIKLIDGGQQK
GME_ARATH       PQDAYGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGRAPAAFCRKATSTDRFEMWGDGLQT
RFBB_NEIMA      XXXXXXXXXXXXDHLVRAWLRTYGLPTIVTNCSNNYGP--YHFPEKLIPLMILNALDGKPLPVYGDGMQI
GALE_LACHE      PINPYGETKMMMEKIMAWADKADGIKYTALRYFNVAGASSHAPETHLIPNILKSAISGDKFTIFGDGTNV
GALE_BACHD      PTNPYGETKLAIEKMFHWCQEAYGLQYVCLRYFNAAGAEDHSPESHLIPIVLQVALGRERVAIFGDDYQT
RFFG_HAEIN      XXXXXXXXNH----LVQAWHRTYGLPVIITNSSNNYGAYQHA--EKLIPLMISNAVMGKPLPIYGDGQQI
RFBB_NEIMB      XXXXXXXXXXXXDHLVRAWLRTYGLPTIVTNCSNNYGP--YHFPEKLIPLMILNALDGKPLPVYGDGMQI
ARNA_YERPY      QRWIYSVSKQLLDRVIWAYGVKEGLKFTLFRPFNWMGPRLDNLDSRAITQLILNLVEGSPIKLVDGGAQK
ARNA_YERPS      QRWIYSVSKQLLDRVIWAYGVKEGLKFTLFRPFNWMGPRLDNLDSRAITQLILNLVEGSPIKLVDGGAQK
ARNA_YERPP      QRWIYSVSKQLLDRVIWAYGVKEGLKFTLFRPFNWMGPRLDNLDSRAITQLILNLVEGSPIKLVDGGAQK
ARNA_YERPN      QRWIYSVSKQLLDRVIWAYGVKEGLKFTLFRPFNWMGPRLDNLDSRAITQLILNLVEGSPIKLVDGGAQK
ARNA_YERPG      QRWIYSVSKQLLDRVIWAYGVKEGLKFTLFRPFNWMGPRLDNLDSRAITQLILNLVEGSPIKLVDGGAQK
ARNA_YERPE      QRWIYSVSKQLLDRVIWAYGVKEGLKFTLFRPFNWMGPRLDNLDSRAITQLILNLVEGSPIKLVDGGAQK
ARNA_YERPB      QRWIYSVSKQLLDRVIWAYGVKEGLKFTLFRPFNWMGPRLDNLDSRAITQLILNLVEGSPIKLVDGGAQK
ARNA_YERPA      QRWIYSVSKQLLDRVIWAYGVKEGLKFTLFRPFNWMGPRLDNLDSRAITQLILNLVEGSPIKLVDGGAQK
ARNA_YERP3      QRWIYSVSKQLLDRVIWAYGVKEGLKFTLFRPFNWMGPRLDNLDSRAITQLILNLVEGSPIKLVDGGAQK
RFBB_SALTY      XXXXXXXXXXXXDHLVRAWRRTYGLPTIVTNCSNNYGP--YHFPEKLIPLVILNALEGKPLPIYGKGDQI
ARNA_SHIF8      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFLPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_PSEAB      QRWIYSVSKQLLDRVIWAYG-QQGLRFTLFRPFNWMGPRLDRLDSRAITQLILHLVEGTPIRLVDGGAQK
ARNA_SHIFL      KRWIYSVSKQLLDRVIWAYGEKEGLQFTLFLPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIDGGKQK
ARNA_PSEAE      QRWIYSVSKQLLDRVIWAYG-QQGLRFTLFRPFNWMGPRLDRLDSRAITQLILHLVEGTPIRLVDGGAQK
ARNA_PSEA8      QRWIYSVSKQLLDRVIWAYG-QQGLRFTLFRPFNWMGPRLDRLDSRAITQLILHLVEGTPIRLVDGGAQK
ARNA_PSEFS      QRWIYSVSKQLLDRVIWAYG-AKGLNFTLFRPFNWMGPRLDRLDSRAITQLILNLVEGTPIRLFDGGEQK
RFFG_ECOLI      XXXXXXXXXXXXDHLVRAWLRTYGLPTLITNCSNNYGP--YHFPEKLIPLMILNALAGKSLPVYGNGQQI
YFNG_BACSU      GKHPYDVSKSCADLISHTYFHTYGLPVCITRCGNLYGGGDLNFN-RIIPQTIQLVLNGEAPEIRSDGTFV
ARNA_PSEPF      QRWIYSVSKQLLDRVIWAYG-AKGLNFTLFRPFNWMGPRLDRLDSRAITQLILNLVEGTPIRLFDGGEQK
ARNA_PSEA7      QRWIYSVSKQLLDRVIWAYG-QQGLRFTLFRPFNWMGPRLDRLESRAITQLILHLVEGTPIRLVDGGAQK
GALE_PASHA      ----YGTSKYMVERILDTVKAFPQLSAVVLRYFNRVGAHESGLIGEDPNGFISQVAVGKQLSVFGDGTGV
ARNA_PSEF5      QRWIYSVSKQLLDRVIWAYG-AKGLNFTLFRPFNWMGPRLDRLDSRAITQLILNLVEGTPIRLFDGGEQK
GALE_NEIMC      TTSPYGTSKSMVERILSIQKADPRWSVILLRYFNPIGAHESGLIGEQPNGYICQVAAGKQLAVFGDGTGM
VIPB_SALTI      --SPYAVTKYVNELYADVFARSYEFNAIGLRYFNVFGRRQNPNGAAVIPRWILSLLKDEPIYINGDGSTS
ARNA_KLEP7      QRWIYSVSKQLLDRVIWAYGDKNGLKFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIEGGKQK
RFBB_XANCB      PNSPYSASKAASDHLVRAFHHTYGLPVLTTNCSNNYGP--YHFPEKLIPLVIAKALAGEPLPVYGDGKQV
GALE_HAEIN      TSKYMVE-----QILRDTAKAEPKFSMTILRYFNPVGAHESGLIGEDPNGYISQVAIGKQLSVFGDGTGV
ARNA_KLEP3      QRWIYSVSKQLLDRVIWAYGDKYDLKFTLFRPFNWMGPRLDNLNSRAITQLILNLVEGSPIKLIEGGKQK
RFBB_XANCP      PNSPYSASKAASDHLVRAFHHTYGLPVLTTNCSNNYGP--YHFPEKLIPLVIAKALAGEPLPVYGDGKQV
ARNA_YERE8      QRWIYSVSKQLLDRVIWAYGAKENLKFTLFRPFNWMGPRLDNLDSRAITQLILNLVEGSPIKLVDGGEQK
ACBB_ACTS5      PNSPYAASKAGSDLLALAYHQTHGMDVVVTRCSNNYGPRQFP--EKMIPLFVTRLLDGLDVPVYGDGRNI
RFBB_ECOLX      ETTXXXXXXXXXDHLVRAWKRTYGLPTIVSNCSNNYGP--YHFPEKLIPLVILNALEGKALPIYGKGDQI
RFBB_SHIFL      XXXXXXXXXXXXDHLVRAWKRTYGLPTIVTNCSNNYGP--YHFPEKLIPLVILNALEGKALPIYGKGDQI
GALE_YERPE      SPSSYGRSKLMVEQILQDVQLDPQWNMTILRYFNPVGAHPSGLMGEDPQGFIAQVAVRESLAIFGDGTGV
RHM1_ARATH      PTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFP--EKLIPKFILLAMRGQVLPIHGDGSNV
GALE_LACCA      PTNPYGESKLAMEKIMHWADVAYGLKFVALRYFNSIGEDHHP-ETHIVPIILQVAAGTRTLQIYGDGTNV
GALE_NEIMB      TTSPYGASKSMVERILTIQKADPRWSMILLRYFNPIGAHESGLIGEQPNGYICQVAAGKQLAVFGDGTGM
GALE_ECOLI      PQSPYGKSKLMVEQILTDLQKAQDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMRRDSLAIFGDGTGV
GALE_SALTY      PQSPYGKSKLMVEQILTDLQKAQEWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMRRESLAVFGDGTGV
ARNA_PSE14      QRWIYSVSKQLLDRVIWAYG-QKGLQFTLFRPFNWMGPRLDRLDSRAITQLILHLVEGTPIRLVDGGAQK
RFBE_SALTI      FHSPYGCSKGAADQYMLDYARIFGLNTVVFRHSSMYGGRQFTYDQGWVGWFCQKAVINKPFTISGNGKQV
GALE_SALTI      PQSPYGKSKLMVEQILTDLQKAQEWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMRRESLAVFGDGTGV
GALE_DROME      NTSPYGKTKYFTEEILKDLKSDKRWAVVSLRYFNPVGAHISGRIGEDPNGIAQVAVGRRPLSVYGDGTGV
GALE_DICDI      RTKLYVEG-----ILQDLCASDPEWNCIMLRYFNPVG--AHPIPNNLMPYVTQTAIGKRPLSIFGDGTGV
ARNA_PSEU2      QRWIYSVSKQLLDRVIWAYG-QKGLQFTLFRPFNWMGPRLDRLDSRAITQLILHLVEGTPIRLVDGGAQK
GALE_NEIMA      DTSPYGTSKSMVERILTIQKADPRWSMILLRYFNPIGAHESGLIGEQPNGIPNNLLPYPQLSVFGDGTGM
RFBB_ECOLI      ELPLFTEXXXXXDHLVRAWKRTYGLPTIVTNCSNNYGP--YHFPEKLIPLVILNALEGKALPIYGKGDQI
RHM3_ARATH      PTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFP--EKLIPKFILLAMNGKPLPIHGDGSNV
STRE_STRGR      PNSPYSASKASGDLLALAHHVSHGLDVRVTRCSNNYGPRQFP--EKLIPRFITLLMDGHRVPLYGDGLNV
FCL1_ORYSJ      E--WYAVAKIAGIKMCQAYRIQHGFDAISAMPTNLYGPQFHPENSHVLPALIRRASNAAEVVVWGTGSPL
CAPI_STAAU      --SLYAATKKSNELMAHTYSHLYNLPTTGLRFFTVYGPWGRP--DMALFKFTKAIVNDQAIDVYNHGNMM
RMLB_STRMU      -SSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQH--IEKFIPRQITNILSGIKPKLYGEGKNV
ARNA_WIGBR      QRWIYSSSKQLLDRIIWAYGVKNNLNFTIFRPFNWIGPGLDDFNARVTTQIIFNLINGLPVTIVNNGNQK
GALE_MOUSE      KSKFFIE-----EMIRDLCRADTAWNAVLLRYFNPIGAHASGRIGEDPQGIPNNLMRREALNVFGDGTGV
HLDD_ALHEH      SKLAFDQYLR---------RYLDDLSAQVVRYFNVYGPREQHKGGSVVHHFSRQLRESGQVRLFADGEQR
GALE_STRTR      ----YGESKLMMETIMKWSDQAYGIKYVPLRYFNVAGANLMPIILQVAQG------VREKIMIFGDGTNV
GALE_HUMAN      KSKFFIE-----EMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMRREALNVFGDGTGV
TGDS_DICDI      EKSIYSASKAGAEHLVQSYYKSFKLPVIITRANNIYGPKQYP--EKIIPKFINLLLNNKKCTIHGTGKNT
FCL1_ARATH      E--WYAIAKIAGIKTCQAYRIQHGWDAISGMPTNLYGPNFHPENSHVLPALMREAKVNEEVVVWGTGSPL
YCL2_ECO11      --SLYAATKKANELMAHTYSHLYGLPATGLRFFTVYGPWGRP--DMALFKFTKAMLEGKSIDVYNYGKMK
HLDD_THICR      YSKF-----QFDQYVRRILPLAESQVAGF-RYFNVYGPRQHKGDASVAFKLHNQVLAGEKLKLFGAGMQT
GALE_PONAB      KSKFFIE-----EMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMRREALNVFGDGTGV
FCL2_ARATH      E--WYAIAKIAGIKMCQAYRLQHQWDAISGMPTNLYGQNFHPENSHVLPALMREAKANDEVVVWGSGSPL
GALE_CORDI      PTNPYGATKLSIDYAITSYAHAYGFAATSLRYFNVAGAENREIETHLIPLVLQVALGHDKIFMFGDGTPI
HLDD_AZOSE      --NMYAYSKFLFDCHL--RRFAPGIDSQVVRYFNVYGPRQHKGSMASVAYHFHNQLNDEGADGYGPGEQQ
GALE2_CYATE     AANPYGRTKLIIEEICDIYRAEQEWKIILLRYFNPVGAHPSGYIGEDPRGFVQQAVGRRPLTVFGDGTGV
EXOB_AZOBR      PINPYGASKLMTEQMLRDAGAAHGLRSVILRYFNVAGADPAGRTGQVATHLIKQALLGRPLAIFGTDYDT
LPSL_RHIME      --TLYAATKKSMELMAHSYAHLYKVPTTSFRFFTVYGPWGRP--DMALFKFVDAIHNGRPIDIYGEGRMS
GALE_PASMU      TSKFMVE-----QILKDIAKATPEFSITILRYFNPVGAHESGLIGEDPNGYISQAIGKLPLSVFGDGTGV
GALE_NEIGO      TANPYGASKAMVERMLTIQKADPRWSVILLRYFNPIGAHESGLIGEQPNGYICQVASGRQLSVFGDGTGM
GALE_YEREN      ----YGTSKVMVEQILKDFSLHPDYSITALRYFNPVGAHPSGLIGEDPNGFITQVAIGKKLLVYGDGSGI
GALE_STRMU      PINPYGESKLMMETIMKWSDRAYGIKFVPLRYFNVAGAKPHSPETHLLPIILQVAQVREKIMIFGDGTNV
HLDD_SHELP      --NVYAYSKFLFDQYVRQHNFTTQV-AG-LRYFNVYGPREQHKGGSVAFHFNNQIKASGICRLFEDGKQL
HLDD_DESVV      MYG-------YSKQLFDLWAYREGRLDGILKFFNVYGPEYHKGDMRSVEGVMRLFRSCHP--DYADGGQM
HLDD_DESVH      MYG-------YSKQLFDLWAYREGRLDGILKFFNVYGPEYHKGDMRSVEGVMRLFRSCHP--DYADGGQM
HLDD_BRAHW      --NVYAFSKYHFDRYLNKLFKENKVNSQVVRYFNVYGPQEN-HKGRMASHLFNQIKAGERMKIFGSENFL
FCL_DICDI       SNEGYAYAKRMIDVLNRAYNEEYGCKFTSVIPTNIYGPHYHLTDGHVIPGLIHKTYLNQDLTIMGTGKPL
ARAE4_ARATH     PINPYGKAKKMAEDMILDFSKNSDMAVMILRYFNVIGPRPELREQGRISGACFDAARGPGLQVKGDGTCI
YHEB_SCHPO      -TSPYAASKAAVDLIIQSYRYSYKISVTVIRANNVYGPRQYPMTLGKLKKFINQKIMQDKITLHGDGLHK
HLDD_SHEPW      QRDLEKPLNVYAYSLFDQYVRQQKPNCQVLRYFNVYGPREQHKGGMVAFHFNNQLNANEGVDGYENGQQL
GALE_ERWAM      TTSPYGTSKLMVEQILDYAKANPEFKTIALRYFNPVGAHESGQMGEDPNGIPNNLLPYEKLGIFGDGTGV
HLDD_PELCD      --NVYGYSKALFDQYVRRVLPTADSQVAGFRYFNVYGPRQHKGSMASVAFHLRNQLLKEGCDGYGDGEQR
GM4D_SHIFL      PRSPYAVAKLYAYWITVNYRESYGMYACNGILFNHESPRR---GETFVTRKITRAIANESCLYLGNMDSL
GM4D_ECOLI      PRSPYAVAKLYAYWITVNYRESYGMYACNGILFNHESPRR---GETFVTRKITRAIANESCLYLGNMDSL
GM4D_ECOL6      PRSPYAVAKLYAYWITVNYRESYGMYACNGILFNHESPRR---GETFVTRKITRAIANESCLYLGNMDSL
GM4D_ECO57      PRSPYAVAKLYAYWITVNYRESYGMYACNGILFNHESPRR---GETFVTRKITRAIANESCLYLGNMDSL
GALE3_ARATH     ATNPYGRTKLFIEEICDVHRSDSEWKIILLRYFNPVGAHPSGYIGEDPLGYVQQAVGRRPLTVFGDGTGV
YGRE_SCHPO      E-SCPREGKLFIENIIDETKVNKSLNAALLRYFNPGG--AHPIPNNLLPYIAQVAVGRDHLNVFGDGTPI
HLDD_AERS4      --NVYGYSKQLFDQYVRRWMPEINSQVVGLKYFNVYGPREQHKGSMASVAFVKQGKLFEGCDGFPDGGQM
ARAE2_ORYSJ     ----YGKAKKMAEDIILDFSKRSEMAVMILRYFNVIGPRPELREGRISGACFDAALGIIPLKVRGDGTCI
HSDD1_ARATH     HNDSYSATKAEGEALILKANGRSGLLTCCIRPSSIFGPG----DKLMVPSLVTAARAGKSKFIIGDGSNF
HLDD_AERHH      --NVYGYSKQLFDQYVRRWMPEINSQVVGLKYFNVYGPREQHKGSMASVAFHLNTQVKEGCDGFPNGGQM
GM4D_YERE8      PRSPYAVAKMYAYWITVNYRESYGMYACNGILFNHESPRRETFVTRKITRAIANALGLEDCLYLGNMDSL
GALE_RAT        KSKFFIE-----EMIQDLCRADTAWNAVLLRYFIPIGAHRSARIGEDPQGIPNNLMRREALNVFGDGTGV
EXOB_RHIME      RT------KWICEQALKDYGLYKGLRSVILRYFNAAGA---DFEGRIIPLAIDAALGREGFKVFGDGTCV
GALE_STRLI      PTNPYGASKLAVDHMITGEAAAHGLGAVSVPYFNVAGANVHDPESHLIPLVLQVAQGREAISVYGDDYPT
GAE3_ARATH      PASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRP--DMAYFFFTRDILKGKAISIFNHGTVA
GAE2_ARATH      PASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRP--DMAYFFFTRDILKGKAISIFNHGTVA
ARAE1_ARATH     PINPYGKAKKMAEDIILDFSKNSDMAVMILRYFNVIGPRPELREHGRISGACFDAARGPGLQIKGDGTCV
HLDD_POLSJ      QRMRRELGARFENAATQV--------AG-FRYFNVYGPR-EQHKGRMASHQFNQFQAEGKVKLFGDGGQM
HLDD_NITOC      PRNVYGYSKWLFDQYVRRYLPTASSQIVGLRYFNIYGPREAHKGAMASVAYHAHCQLKETGRIYEHGEQR
GMDS_HUMAN      PRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGAFVTRKISRSVAKILGQLECFSLGNLDAK
GALE1_PEA       RTKLFLE-----EIARDIQKAEPEWRIVLLRYFNPVGPRGIPNN---LMPYIQQVAVGRELNVYGDGSAI
GAE4_ARATH      PASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRP--DMAYFFFTKDILKGKSISIFNHGTVA
GALE1_CYATE     RSKLFVE-----EVARDIQRAEAEWRIILLRYFNPVGPRGLPNN---LMPYIQQAVARLPLNIYGDGTAI
GAE1_ARATH      PASLYAATKKAGEEITHTYNHIYGLAITGLRFFTVYGPWGRP--DMAYFSFTRNILQGKPITIYRGKNRV
ARAE3_ARATH     PINPYGKAKKMAEDMILDFSKNSDMAVMILRYFNVIGPKPELREHGRISGACFDAARGPGLQVTGDGTCV
HLDD_AZOSB      --NMYAYSKFLFDCHL---RAQQGIESQVVRYFNVYGPREQHKGSMASVAYHFNNQLNESGRVYGPGEQR
GMDS_MOUSE      PRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGAFVTRKISRSVAKILGQLECFSLGNLDAK
FCL2_ORYSJ      GSEWYAIPKIAGIKMCQAVRAEYGLDAIAAAPNNLYGPR-HPFPSHVIPALIRRFHRAKEVAVWGSGAAA
GMDS_CRIGR      PRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGAFVTRKISRSVAKILGQLECFSLGNLDAK
GALE1_ARATH     RTKLFLE-----EIARDIQKAEPEWRIILLRYFNPVGAHESGSIGEDPKGYIQQVAVGRELNVYGDGSAV
GAE6_ARATH      PASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRP--DMAYFFFTKDILHGKSIDIYDNQEVA
GMD1_ARATH      PRSPYAASKCAAHWYTVNYREAYGLYACNGILFNHESPRRENFVTRKITRALGRIKVGLQTKLFGNIQAS
FCL_HUMAN       SNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHFNIEDGHVLPGLIHKVSSGSALTVWGTGNPR
HLDD_SHEFN      --NVYAYSKFLFDQYVRQQKL-TGQVAG-LRYFNVYGPREQHKGGSVAFHFNNQINTNEGVDGYENGQQL
HLDD_CHRVO      SKFLFDQVLR--------QRIKEGLSAQAVRYFNVYGPR-EQHKGRMASHHFNQYREHGKVKLFGNGMQS
GMD2_ARATH      PRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRENFVTRKITRALGRIKVGLQTKLFGNLQAS
FCL_ECOLI       EP--YAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHFHPSNSHVIPALLRRTAQNAPVVVWGSGTPM
NOEL_RHISN      PRSPYAAAKLYAYWIVVNYREAYGMHASNGILFNHESPRGETFVTRKITRAAAASLGKQEVLYLGNLDAQ
HSDD2_ARATH     HNDSYSATKAEGEELIMKANGRNGLLTCCIRPSSIFGPG----DRLLVPSLVAAARAGKSKFIIGDGNNL
HLDD_CHRSD      SKLLFDQYVRVHWESFDAQVVG-------FRYFNVYGPR-EQHKGKMASVAYHQVKRGENPKLFGAGMQS
EXOB_RHILT      RT------KYIVEQALADYDQYGSLRSVVLRYFNAAGA---DFEGRIIPLAIDAALGRQGFKVFGDGTCV
ARAE2_ARATH     PINPYGKAKKMAEDIILDFSKNSIMAVMILRYFNVIGPRPELSEHGRISGACFDAARGPGLQIKGDGTCV
GAL10_KLULA     PTNPYGKTKLTIEDMMRDLHFDKSFSFAILRYFNPIG--AHPIPNNLLPFMAQVAIGRRPLYVFGDGTPI
NSDHL_MOUSE     --DYYTETKILQEAVLDANDPKKNFLTAAIRPHGIFGPR----DPQLVPILIDAARKGKMKFMIGNGENL
HLDD_POLNS      SKFLFDQRKRFAEKTNTAQVVG-------FRYFNVYGPR-ESHKGRMASVAFHQYYANGHVKLFGEGEQS
HLDD_MARAV      Y-SKWQFDQYVRKILPSARSQIVGF-----RYFNVYGPR-EQHKGKMASHLHEQIKAGQNPKLFSDGGQQ
NOEL_RHIFR      PRSPYAAAKLYAYWIVVNYREAYGMHASNGILFNHESPRGETFVTRKITRAAAASLGKQEVLYLGNLDAQ
HLDD_RALEH      Y-------SKFLFDQIVRRRLPSALSQIVFRYFNVYGPR-ETHKGRMASHNFNQFRADGTVKLFGEGMQS
HLDD_PSEA7      SKFLFDQ--RVRRALPQARSQVVGL-----RYFNVYGPR-EGHKGRMASHCYQQLRRDGRVVLFGEGGHL
NSDHL_RAT       --DYYTETKILQEAVLDANDPKKNFLTAAIRPHGIFGPR----DPQLVPVLIDAARKGKMKFMIGNGKNL
FCL_MOUSE       SNFGYSYAKRMIDVQNRAYFQQHGCTFTAVIPTNVFGPNFNIEDGHVLPGLIHKVSSDSALTVWGTGKPR
ARAE3_ORYSJ     ----YGKAKKMAEIILDFTKGRKDMAVMILRYFNVIGPRPELREGRISGACFDAALGIIPLKVKGDGTCI
NSDHL_BOVIN     --DYYTETKILQEAVLGAHDPEKNFLTTAIRPHGIFGPR----DPQLVPILIEAAKKGKMKFMIGNGKNL
GAL10_YEAST     PTNPYGHTKYAIENILNDLSDKKSWKFAILRYFNPIGAHPSGLIGEDPLGIPNNLLRREKLYIFGDGTPI
GALE_CORGL      PTNAYGATKLSIDYAITSYAAAFGLAATSLRYFNVAGAYGNIGENREVETHLIPLVLQEKTFMFGDGTAV
FCL_PONAB       SNFGYSYVKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHFNIEDGHVLPGLIHKVSSGSALTVWGTGKPR
ARAE1_ORYSJ     PINPYGKAKKMAEDIIFSKSKKADMAVMILRYFNVIGPELRE-HGRISGACFDAALGIIPLKVKGDGTCV
HLDD_EDWI9      SKFLFDQYVR--RILPHAKSQICG-----FRYFNVYGPREGHKGGMASVAFHLNTQINQPKLFEGSENFR
GALE_MYCGE      LSKFLD------ELILNAVAKNSQLQVVCLRFFNVAGAILGNFNGNLIPNLVKAFLKQTPFFLYGDGSCI
HLDD_CUPTR      Y-------SKFLFDQIVRRRLPSALSQIVFRYFNVYGPR-ETHKGRMASHNFNQFRADGTVKLFGEGMQS
HLDD_VIBVY      SKQQFDNYVRWQDAEEHGETLSQITG---FRYFNVYGPREQHKGSMASVAFNNQILAGENPKLFAGSEQK
HLDD_VIBVU      SKQQFDNYVRWQDAEEHGETLSQITG---FRYFNVYGPREQHKGSMASVAFNNQILAGENPKLFAGSEQK
HLDD_THIDA      SKFLFDQSVR-------RLWAERTAQIAGFRYFNVYGPR-EQHKGRMASHFFNQYRAEGRVKLFPNGEQR
HLDD_RHOFD      QRMRRECGNDFRRSVAGKTGQVVG-----FRYFNVYGPH-EQHKGRMASHQFHQFQAEGKVKLFADGAQM
HLDD_PASMU      ---VYGYSKFLFDQYVRAILPEANSPVCGFRYFNVYGPRENHKGAMASVAFNNQILKGEKPKLFGSEHFR
GM4D1_VIBCH     PRSPYAVAKMYAYWITINYRESYGIYACNGILFNHESPRRETFVTRKITGMANIAQGLEKCLFMGNLDAL
GAL10_SCHPO     E-SCYGKTKYAIENIIKDLHTSDNTWRGILRYFNPIGAHPSGLLGEDPLGIPNNLLRREKLLVFGDGTPI
FCL_CRIGR       SNFGYSYAKRMIDVQNRAYFQQHGCTFTAVIPTNVFGPHFNIEDGHVLPGLIHKAKSNSALTVWGTGKPR
NSDHL_HUMAN     --DYYTETKILQEAVLGANDPEKNFLTTAIRPHGIFGPR----DPQLVPILIEAARNGKMKFVIGNGKNL
HLDD_HAMD5      --NIYGYSKFLFDQYVRKIWPKARAPICGFRYFNVYGPRTHKGSASVVFHLDKQIKAGKPPQLFGSEQFK
GMDS_DICDI      PRSPYAVAKQYAYWIVVNYREAYDMYACNGILFNHESPRRGPFVTRKITRFVAGACGRDEILYLGNINAK
GAE5_ARATH      PASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRP--DMAYFFFTKDILKGKTITVFDKGSVA
HLDD_VIBF1      SKQQFDNYVRWADAEEHNETLSQITG---FRYFNVYGPRQHKGSMASVAFHLNNQMGDNPKLFEGSDEFK
HLDD_BORA1      SKLLFDQVLRTRMDKLTAQVVG-------LRYFNVYGPH-EQHKGRMASHNMNQFLAEGHVRLFADGGQS
GMDS_DROME      PRSPYACAKMYGFWIVINYREAYNMYACNGILFNHESPRRENFVTRKITRSVAK-IYHKQMEYFGNLDSK
HLDD_POLNA      SKLLFDQHMRRE----LGMRFENAQTAGF-RYFNVYGPR-EQHKGRMASHQFNQFQADGKVKLFXXXXQM
HLDD_NEIMA      SKFLFDQVLR--------RRMKEGLTAQVVRYFNVYGQHFHHFHQYREHGYVNLFGSNDG---YGNGEQT
HLDD_VIBFM      SKQQFDNYVRWADAEEHNETLSQITG---FRYFNVYGPRQHKGSMASVAFHLNNQMGDNPKLFEGSDEFK
HLDD_NEIM0      SKFLFDQVLR--------RRMKEGLTAQVVRYFNVYGQHFHHFHQYREHGYVNLFGSNDG---YGNGEQT
HLDD_SALPC      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_SALCH      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
GM4D2_VIBCH     PRSPYAVAKMYAYWIVVNYRESYGMYACNGILFNHESPRRETFVTRKITGLANIAQGLEKCLYMGNMDAL
HLDD_SODGM      --NVYGYSKFLFDQYVRALLPQAESQICGFRYFNVYGPREGHKGGMASVAFHLNNQINNPKLFAGSEGFK
HLDD_RALEJ      SKFLFDQAVR--------NRLDGALSQVVLRYFNVYGPRM----ASIVCQQFEQFRAEGTVKLFGEGCQS
HLDD_NEIMB      SKFLFDQVLR--------RRMKEGLTAQVVRYFNVYGQHFHHFHQYREHGYVNLFGSNDG---YGNGEQT
HLDD_NEIMF      SKFLFDQVLR--------RRMKEGLTAQVVRYFNVYGQHFHHFHQYREHGYVNLFGSNDG---YGNGEQT
GM4D_PSEAE      PRSPYGVAKLYGHWITVNYRESFGLHASSGILFNHESPRGIEFVTRKVTDAVRIKLGKQQELRLGNVDAK
HLDD_SALG2      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_SALEP      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_SALDC      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_RALPJ      SKLLFDQVVR--RVMLTALSQIVG-----FRYFNVYGPR-EQHKGRMASHNFNQFRSEGTVKLFGEGGQM
HLDD_PSYIN      SKFQFDQYVRWEDAAAHDETLPQIVG---FRYFNVYGPREQHKGSMASVAFHNQLNAGENAKLF-EGEHK
HLDD_PHOLL      --NVYGYSKFLFDQYVREILPQADSQICGFRYFNVYGPREGHKGSMASVAFHLNNQINQPKLFAGSEGFQ
GALE_KLEPN      ----------------------------------------------------------------------
HLDD_PROMH      SKFLFDEYVR--QILPEAQSMVCG-----FRYFNVYGPREGHKGSMASVAFHLNTQVNDPKLFEGSETFQ
HLDD_HAEIG      SKFLFDQYVR--NILPEAKSPVCG-----FRYFNVYGPRENHKGSMASVAFNNQILKGEPKLFAGSEGFR
HLDD_HAEI8      SKFLFDQYVR--NILPEAKSPVCG-----FRYFNVYGPRENHKGSMASVAFNNQILKGEPKLFAGSEGFR
GALE2_ARATH     ALNPYGRTKLFIEEICDVYGSDPEWKIILLRYFNPVG--AHPSDPRGIPNFVQQAVGRRPLTVFGDGTGV
HLDD_HAEIN      SKFLFDQYVR--NILPEAKSPVCG-----FRYFNVYGPRENHKGSMASVAFNNQILKGEPKLFAGSEHFR
HLDD_BURP8      YSKFL-----FDQVIRRVLPTAKSQIAG-FRYFNVYGPRESHKARMASVAFFNQFRAEGKVKLFGEGEQT
HLDD_SALTY      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_SALTI      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_SALSV      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_SALPK      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_SALPB      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_SALPA      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_SALNS      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_SALHS      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_SALAR      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_SALA4      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_PSEAE      SKFLFDQ--RVRRALPQARSQVVGL-----RYFNVYGPR-------------------------------
HLDD_BURVG      SKFLFDQVIR--RVLPSARSQIAG-----FRYFNVYGPR-ETHKGRMASHNFNQFRAEGKVKLFGEGEQT
HLDD_BURM1      ERSVYGYSKFLFDQVVRRVLPNAKSQIAGFRYFNVYGPR-ETHKGRMASHNFNQFRAEGKVKLFGEGEQT
HLDD_BURCM      SKFLFDQVIR--RVLPSAKSQIAG-----FRYFNVYGPR-ETHKGRMASHNFNQFRAEGKVKLFGEGEQT
HLDD_BURA4      SKFLFDQVIR--RVLPSAKSQIAG-----FRYFNVYGPR-ETHKGRMASHNFNQFRAEGKVKLFGEGEQT
TGDS_MIMIV      PTNPYAATKAGAEHIVKSYFLSYKLPIIIARCNNVYGRNQYP--EKLIPKFICSLLDGKKLHIQGTGNSR
SPSK_BACSU      PKTIYGKSKRLGEELIRLTTKD----STIIRTSWVYGHGGSNF----VETMLKLAETKQELRVVSD--QI
HLDD_ECOSM      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
FCL_DROME       SNYGYSYAKRLIDVQNHAYHDKYGRVYTSVIPCNIFGPHYNPEVSHVIPGMIYRMLVTEKFTVFGSGMPL
YFHF_BACSU      ----------------------------------------------------------------------
HLDD_VIBCM      SKQQFDNYVR--RLWLDAKQHDETLSQITFRYFNVYGPRQHKGSMASVAFHLNNQMGENPKLFAGSENFK
HLDD_VIBCH      SKQQFDNYVR--RLWLDAKQHDETLSQITFRYFNVYGPRQHKGSMASVAFHLNNQMGENPKLFAGSENFK
HLDD_VIBC3      SKQQFDNYVR--RLWLDAKQHDETLSQITFRYFNVYGPRQHKGSMASVAFHLNNQMGENPKLFAGSENFK
HLDD_PSEAB      SKFLFDQ--RVRRALPQARSQVVGL-----RYFNVYGPR-------------------------------
HLDD_RALME      SKFLFDQVVR--RRLPSAHSQIVGF-----RYFNVYGPREF-HKGRMASHHFNQFRAEGTVKLFGEGTQS
HLDD_ENTS8      --NVYGYSKFLFDEYVRQILPEANSQITGFRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
Y4AF_RHISN      --------------LCQAYRKQYGANFISAMPTNLYGPR-DKFDSHVVPALIRKAHEAKILSIWGSGTPT
HLDD_SHISS      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_SHIFL      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_SHIF8      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_SHIDS      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_SHIBS      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_SHIB3      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_RALSO      SKFLFDQIVR--RTLPGALSQIVG-----FRYFNVYGPR-EQHKGRMASHNFNQFRTEGTVKLFGEGGQM
HLDD_MANSM      ---AYGYSKFLFDQYVRAILPEANSPVCGFKYFNVYGPREQHKGSMASVAFNNQILKGEPKLFAGSEHFL
HLDD_KLEP7      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNSPKLFEGSDGFK
HLDD_KLEP3      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNSPKLFEGSDGFK
HLDD_ESCF3      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECOUT      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECOSE      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECOLU      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECOLI      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECOL6      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECOL5      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECOK1      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECODH      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECOBW      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECO8A      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECO81      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECO7I      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECO5E      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECO57      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECO55      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECO45      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECO27      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_ECO24      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGESPKLFEGSEN
HLDD_BURS3      YSKFL-----FDQVIRRVLPTAKSQIAG-FRYFNVYGPR-ETHKGRMASHNFNQFRAEGKVKLFGEGEQT
HLDD_BURCH      SKFLFDQVIR--RVLPSAKSQIAG-----FRYFNVYGPR-ETHKGRMASHNFNQFRAEGKVKLFGEGEQT
HLDD_BURCC      SKFLFDQVIR--RVLPSAKSQIAG-----FRYFNVYGPR-ETHKGRMASHNFNQFRAEGKVKLFGEGEQT
HLDD_BURCA      SKFLFDQVIR--RVLPSAKSQIAG-----FRYFNVYGPR-ETHKGRMASHNFNQFRAEGKVKLFGEGEQT
GMD2_CAEEL      PRSPYAVAKMYGYWIVVNYREAYKMFACNGILFNHESPRRETFVTRKITRSVAKSLRQQEHIELGNLSAL
YGAE_ERWAM      ----------------------------------------------------------------------
HLDD_ENT38      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNGETPKLFEGSDK
HLDD_CITK8      --NVYGYSKFLFDEYVRQILPEASSQIVGFRYFNVYGPREHKGSMASVAFHLNTQLNNGETPKLFEGSEN
HLDD_BURCJ      SKFLFDQVIR--RVLPSAKSQIAG-----FRYFNVYGPR-ETHKGRMASHNFNQFRAEGKVKLFGEGEQT
HLDD_YERE8      --NVYGYSKFLFDQYVREILPQADSQICGFRYFNVYGPREHKGSMASVAFHLNNQIGENPKLFSGSENFK
HLDD_KLEPN      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREHKGSMASVAFHLNTQLNNSPKLFEGSDGFK
GALE_MYCPN      EETLYGISKFLSEIVLQTLTRSPHFQVIALRYFNVAG-ASNPFGNLLIPNLIKAFMEKRTFFLYGDGSCI
HLDD_YERPY      --NVYGYSKFLFDQYVREILPQADSQICGFRYFNVYGPREHKGSMASVAFHLNNQIGERPKLFAGSENFK
HLDD_YERPS      --NVYGYSKFLFDQYVREILPQADSQICGFRYFNVYGPREHKGSMASVAFHLNNQIGERPKLFAGSENFK
HLDD_YERPP      --NVYGYSKFLFDQYVREILPQADSQICGFRYFNVYGPREHKGSMASVAFHLNNQIGERPKLFAGSENFK
HLDD_YERPN      --NVYGYSKFLFDQYVREILPQADSQICGFRYFNVYGPREHKGSMASVAFHLNNQIGERPKLFAGSENFK
HLDD_YERPG      --NVYGYSKFLFDQYVREILPQADSQICGFRYFNVYGPREHKGSMASVAFHLNNQIGERPKLFAGSENFK
HLDD_YERPE      --NVYGYSKFLFDQYVREILPQADSQICGFRYFNVYGPREHKGSMASVAFHLNNQIGERPKLFAGSENFK
HLDD_YERPB      --NVYGYSKFLFDQYVREILPQADSQICGFRYFNVYGPREHKGSMASVAFHLNNQIGERPKLFAGSENFK
HLDD_YERPA      --NVYGYSKFLFDQYVREILPQADSQICGFRYFNVYGPREHKGSMASVAFHLNNQIGERPKLFAGSENFK
HLDD_YERP3      --NVYGYSKFLFDQYVREILPQADSQICGFRYFNVYGPREHKGSMASVAFHLNNQIGERPKLFAGSENFK
HLDD_RHILO      KKLFDDYVRR------TVFDTDHSQVAG-LRYFNVYGPR-EAHKGAMASVFNQVERGENPRLFFGPGEQS
Y2119_STAHJ     FLS------------------------DVVYQWERFAKRFESFGTRVVLGRFSMILSNDPYKFFGSGFQW
HLDD_HAEDU      SKFLFDEYVR---------RLLPEANSAIFKYFNVYGPREQHKGSMASVAFNNQMLKGEPKLFAGSEHFL
HLDD_ECOLC      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREGHKGSMASVAFHLNTQLNKPKLFEGSENFK
HLDD_ECOHS      SKFLFDEYVR---------QILPEANSQIVRYFNVYGPREGHKGSMASVAFHLNTQLNKPKLFEGSENFK
Y4NG_RHISN      D---YGRAKLAGEIICKEAMQRDGLDVAIVR------PRTVLGYGRILFDWVERGL---DIPVLGGGNNK
YFCH_ECOLI      HKLC----ARWEEIACRAQ--SDKTRVCLLRTGVVLAP-----DGGILGKMLRLGLGGP----IGSGRQY
Y1061_METJA     ----------------------------------------------------------------------
HLDD_FUSNN      K---YGYSKKFFDDWAFKQKNQPKQWNGL-KFFNVYGPQFHTYNQYKENGYVK--LFKSYKEGFKDGEQL
Y1223_SYNY3     ----------------------------------------------------------------------
GAL10_CANMA     ----------------------------------------------------------------------
HLDD_PECCP      ERNVYGYSKFLFDQYVREILPEAESQICGFRYFNVYGPREGHKGSMASVAFHLNNQINQPKLFSGSENFK
Y2567_STAAR     ----------------------------------------------------------------------
STRL_STRGR      PRTVYGCTKRAGERAVLEVLPDTGYIVRTAWLYGAGGP--------------------------------
Y2778_STAA8     ----------------------------------------------------------------------
Y2488_STAAC     ----------------------------------------------------------------------
Y2422_STAA3     ----------------------------------------------------------------------
HLDD_BURPP      ------------------------------RYFNVYGPRETHKARMASVAFFNQFRAEGKVKLFGEGEQT
D39U1_BOVIN     ----------------------------------------------------------------------
YQJ9_SCHPO      ----------------------------------------------------------------------
YL056_YEAST     ----------------------------------------------------------------------
Y2478_STAAM     ----------------------------------------------------------------------
Y2266_STAAN     ----------------------------------------------------------------------
Y1014_HAEIN     ----------------------------------------------------------------------
YGI2_SCHPO      ----------------------------------------------------------------------
RCP_VIBCH       ----------------------------------------------------------------------
Y2403_STAAW     ----------------------------------------------------------------------
Y2370_STAAS     ----------------------------------------------------------------------
Y2073_MYCBO     ----------------------------------------------------------------------
Y2047_MYCTU     ----------------------------------------------------------------------
SQD1_SPIOL      ------------------------LNQGVVYGVMTEETAMHEFDGTALNRFCVQAAVGHPLTVYGKGGQT


                         .         .         .         +         .         .         .:280
query           RSFCYVSDLVRGLWLMGNSNQPGPINLGNPIEQTVLSMAHLIKESTNSESSITFEPLPSDDPVRRRPDIS
UXS1_RAT        RAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIK
UXS1_PONAB      RAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIK
UXS1_MOUSE      RAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIK
UXS1_HUMAN      RAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIK
UXS1_XENTR      RAFQYVSDLVNGLVALMNSNVSSPVNLGNPQEHSIVQFARLIKQLVGSGGEISFLSEAQDDPQRRKPDIR
UXS1_DANRE      RAFQYVSDLVNGLVSLMNSNISSPVNLGNPEEHTILEFAQLIKSLVASRSHIQFLPEAXXXXXXXXXXIR
GALE_METJA      RDFVYVGDVAKAN-LMALNWKNEIVNIGTGKETSVNELFDIIKHEIGFRGEAIYDKPREGEVYRIYLDIK
YTCB_BACSU      RDFTYISDCVKGITVLGKPHLIGTVNIGGAERASVLKVVSLIEDISGRKATLHFSDKIAGEPSNTWADIS
TGDS_MOUSE      RNFLYAADVVEAFLTVLTKGEPGEINIGTNFEMSVVQLAQLIKETNSESETESWVDYVSDRPHNRYPMKS
TGDS_BOVIN      RNFLYATDVVEAFLTVLKKGKPGEINIGTNFEMSVLQLAQLIKE-TNSESEMEVDDRPTND--MRYPMKS
ARNA_AERS4      RCFTDIEDGIEALFRIGNRCDGQIINIGSPNEASILQMAEVLLGKFEAHESKSFYGDGYQDVSHRRPSIK
TGDS_HUMAN      RNFLYATDVVEAFLTVLKKGKPGEINIGTNFEMSVVQLAQLIKE-TNSESEMNWVDYVNDRPTNRYPMKS
ARNA_SERP5      RCFTDINDGIEALFRI-IENRDGIVNIGNPTEASIRELAEMLLESFNNHESSSYYGKGYQDVEHRTPSIK
ARNA_PHOLL      RCFTDINDGIEALFRI-IENREGIINIGNPTEASIRQLAEILLDSEDHELRDHFPPFAGQDVEHRKPSIK
GME1_ORYSI      RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIILSFEDRE--LPIHHIPGPEGVRRNSDNT
SPSJ_BACSU      RDWLFAEDHCRAIKLILEKGTDGEVNIGGGNERTNKELASVILKHLGCEELFAHVEDRKGHDRRYAINAS
GME1_ORYSJ      RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIILSFEDRE--LPIHHIPGPEGVRRNSDNT
ARNA_SALTY      RCFTDIRDGIEALFRIGDRCDGKIINIGNPNEASIQELATLLLDSFDKHESRSYYGKGYQDVAHRKPSID
ARNA_SALPC      RCFTDIRDGIEALFRIGDRCDGKIINIGNPNEASIQELATLLLDSFDKHESRSYYGKGYQDVAHRKPSID
ARNA_SALPB      RCFTDIRDGIEALFRIGDRCDGKIINIGNPNEASIQELATLLLDSFDKHESRSYYGKGYQDVAHRKPSID
ARNA_SALNS      RCFTDIRDGIEALFRIGDRCDGKIINIGNPNEASIQELATLLLDSFDKHESRSYYGKGYQDVAHRKPSID
ARNA_SALHS      RCFTDIRDGIEALFRIGDRCDGKIINIGNPNEASIQELATLLLDSFDKHESRSYYGKGYQDVAHRKPSID
ARNA_SALG2      RCFTDIRDGIEALFRIGDRCDGKIINIGNPNEASIQELATLLLDSFDKHESRSYYGKGYQDVAHRKPSID
ARNA_SALEP      RCFTDIRDGIEALFRIGDRCDGKIINIGNPNEASIQELATLLLDSFDKHESRSYYGKGYQDVAHRKPSID
ARNA_SALDC      RCFTDIRDGIEALFRIGDRCDGKIINIGNPNEASIQELATLLLDSFDKHESRSYYGKGYQDVAHRKPSID
ARNA_SALCH      RCFTDIRDGIEALFRIGDRCDGKIINIGNPNEASIQELATLLLDSFDKHASRSYYGKGYQDVAHRKPSID
ARNA_SALA4      RCFTDIRDGIEALFRIGDRCDGKIINIGNPNEASIQELATLLLDSFDKHESRSYYGKGYQDVAHRKPSID
ARNA_SODGM      RCFTDISDGIEALFRIDNNCDGQIINIGNPNEASIRQLAELLLASFERHESSSYYGKGYQDVEHRKPSIR
Y1055_METJA     RDFTYISDVVDGILRAIKKDFDYEINLGNSKPVKLMYFIELIEKYLNXXXXXXFLPMQDGDVLRTYADLS
GALE_BACSU      RDYIHVVDLVKALEKVLNSTGADAYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRPGDIATCFADPA
ARNA_SHESH      RCFTDISEAIEALFRV-IENKDGLINIGSPDEASIKVMAETLVEKFNLVESQSFYGDGYQDVQHRRPSIK
ARNA_PECCP      RCFTDIHDGIEALFIIENRNDGQIINIGNPNEASIRELGDMLLTSFNAHESSSYYGKGYQDVAHRTPSIR
ARNA_ERWCT      RCFTDIHDGIEALFVIENRNDGQIINIGNPNEASIRELGEMLLTSFNAHESSSYYGKGYQDVAHRTPSIR
ARNA_ENT38      RCFTDISDGIEALFRIKNSNCDGQINIGNPNEASIKELAEMLLASFEKHESSTYYGKGYQDVEHRKPSIR
ARNA_ECOUT      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECOK1      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECO45      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_SHISS      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_SALSV      RCFTDIRDGIEALFRIGDRCDGKIINIGNPNEASIQELATLLLDSFDKHESRSYYGKGYQDVAHRKPSID
ARNA_ECOSM      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECOLU      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECO81      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECO7I      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECO27      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_AERHH      RCFTDIEDGIEALFRIENRCDGQIINIGNPNEASIQQMAEILLAKFEAHESKSFYGDGYQDVSHRRPSIA
ARNA_ESCF3      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGKMLLASFDKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECOL6      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
RHM2_ARATH      RSYLYCEDVAEAFEVVLHKGEIGHVNVGTKRERRVIDVARDICKGKDPESSIQFENRPFNDQ-RYFLDDQ
RFBB_RHISN      RDWLYVDDHARALWLIVREGRPGKYNVGDVVNRICLLLDELSPNASHYGDLITFVKDRPGHDARYAIDAT
ARNA_SHIDS      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_SHIBS      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_PROMH      RCFTDINDGIEALFRIDNKCDGQIINIGNPTEASIRELAEMLLDCFEKHESSSYYGKGYQDVEHRKPSIK
ARNA_ERWT9      RCFTDIHDGIEALFLIIENKQKNIINIGNPNEASIKQLAEQLLESFERHESSTYYGKGYQDVEHRKPSIR
ARNA_ECOSE      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECOLI      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECOLC      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECOL5      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECOHS      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECODH      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECOBW      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECO8A      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECO5E      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECO57      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECO55      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
ARNA_ECO24      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSSYYGKGYQDVEHRKPSIR
RFBB_NEIGO      RDWLFVEDHARALYQVVTEGVVGTYNIGGHNEKTVKTICALLEEVARYEDLITFVQDRPGHDARYAVDAA
ARNA_SHIB3      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGKMLLASFEKHESSSYYGKGYQDVEHRKPSIR
GME2_ORYSJ      RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFENKQ--LPIHHIPGPEGVRRNSDNT
ARNA_SALTI      RCFTDIRDGIEALFRIGDRCDGKIINIGNPNEASIQELATLLLDSFDKHESRSYYGKGYQDVAHRKPSID
ARNA_SALPK      RCFTDIRDGIEALFRIGDRCDGKIINIGNPNEASIQELATLLLDSFDKHESRSYYGKGYQDVAHRKPSID
ARNA_SALPA      RCFTDIRDGIEALFRIGDRCDGKIINIGNPNEASIQELATLLLDSFDKHESRSYYGKGYQDVAHRKPSID
GME_ARATH       RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMV--LSFEEKKLPIHHIPGPEGVRRNSDNN
RFBB_NEIMA      RDWLFVEDHARALYQVVTEGVVGTYNIGGHNEEVVKTICALLEEVARYEDLITFVQDRPGHDARYAVDTA
GALE_LACHE      RDYVQVEDLILALKHMMKTNKSDVFNLGTAHGYSNLEILESAKKVTGIDIPYTMGPRRGGDPDSLVADST
GALE_BACHD      RDYIHVMDLANAHYLLRKDGQSGSFNLGNGKGFSVKEVIEVCRQVTGHPIPAEIAPRRSGDPASLIASSE
RFFG_HAEIN      RDWLFVEDHVQASYLVLTKGRVGEYNIGGNCEKTNLEVVQLLEELAPSEDLMTFVKDRPGHDVRYSLDCS
RFBB_NEIMB      RDWLFVEDHARALYQVVTEGVVGTYNIGGHNEEVVKTICALLEEVARYEDLITFVQDRPGHDVRYAVDAA
ARNA_YERPY      RCFTDIHDGIEALFRI-IENRDGIINIGNPTEASIRELAEMLLTSENHELRDHFPPFAGQDVEYRTPSIK
ARNA_YERPS      RCFTDIHDGIEALFRI-IENRDGIINIGNPTEASIRELAEMLLTSENHELRDHFPPFAGQDVEYRTPSIK
ARNA_YERPP      RCFTDIHDGIEALFRI-IENRDGIINIGNPTEASIRELAEMLLTSENHELRDHFPPFAGQDVEYRTPSIK
ARNA_YERPN      RCFTDIHDGIEALFRI-IENRDGIINIGNPTEASIRELAEMLLTSENHELRDHFPPFAGQDVEYRTPSIK
ARNA_YERPG      RCFTDIHDGIEALFRI-IENRDGIINIGNPTEASIRELAEMLLTSENHELRDHFPPFAGQDVEYRTPSIK
ARNA_YERPE      RCFTDIHDGIEALFRI-IENRDGIINIGNPTEASIRELAEMLLTSENHELRDHFPPFAGQDVEYRTPSIK
ARNA_YERPB      RCFTDIHDGIEALFRI-IENRDGIINIGNPTEASIRELAEMLLTSENHELRDHFPPFAGQDVEYRTPSIK
ARNA_YERPA      RCFTDIHDGIEALFRI-IENRDGIINIGNPTEASIRELAEMLLTSENHELRDHFPPFAGQDVEYRTPSIK
ARNA_YERP3      RCFTDIHDGIEALFRI-IENRDGIINIGNPTEASIRELAEMLLTSENHELRDHFPPFAGQDVEYRTPSIK
RFBB_SALTY      RDWLYVEDHARALHMVVTEGKAGTYNIGGHNEKKNLDVVEIVPKATSYREQITYVADRPGHDRRYAIDAG
ARNA_SHIF8      RCFTDIRDGIEALYRIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSCYYGKGYQDVEHRKPSIR
ARNA_PSEAB      RCFTDVDDGIEALARI-IDNRDGRVNIGNPDNEASIRQEELLRQFEAHPLRAQFPPFAGQDVAHRKPSID
ARNA_SHIFL      RCFTDIRDGIEALYHIGNRCDGEIINIGNPNEASIEELGEMLLASFEKHESSCYYGKGYQDVEHRKPSIR
ARNA_PSEAE      RCFTDVDDGIEALARI-IDNRDGRVNIGNPDNEASIRQEELLRQFEAHPLRAQFPPFAGQDVAHRKPSID
ARNA_PSEA8      RCFTDVDDGIEALARI-IDNRDGRVNIGNPDNEASIRQEELLRQFEAHPLRAQFPPFAGQDVAHRKPSID
ARNA_PSEFS      RCFTDIADGIEALRIIDNDNDAQIINIGNPENEASIRQAHPLRAGFRDVESKAFYGTGYQDVAHRKPSIE
RFFG_ECOLI      RDWLYVEDHARALYCVATTGKVGTYNIGGHNERKNLDVVETICEVAHYRDLITFVADRPGHDLRYAIDAS
YFNG_BACSU      RDYFYIEDAVQAYLLLAEKMEENNLNFSNEIQLTVLELVEKILKKMNSNLKPKVLNQGSNEIKHQYLSAE
ARNA_PSEPF      RCFTDIADGVEALRIIDNDNNGQIINIGNPDNEASIRQAHPLRSNFRDVESKAFYGAGYQDVEHRKPSIA
ARNA_PSEA7      RCFTDVDDGIEALARI-IDNRDGRVNIGNPDNEASIRQEELLRQFEAHPLRAQFPPFAGQDVAHRKPSIE
GALE_PASHA      RDYIHVVDLALGKALDKHQNDAGVYNLGTGTGYSVLDMV----KAFEAANGIT---IPYKVVDRRPGDIA
ARNA_PSEF5      RCFTDIADGIEALRIVDNENNGQIINIGNPDNEASIRQAHPLRAGFRDVESKAFYGAGYQDVEHRKPSID
GALE_NEIMC      RDYIHVMDLAEGAAMQAKSNVAGTLNLGSGRASSVLEIIRAFEAASGLTIPYEVKPRRAGDLACFYADPS
VIPB_SALTI      RDFCYIENVIQANLLSATTNDLASKNKVYNVDRTSLNLYYLIRDGLNSRAEPIYKDFRDGDVKHSQADIT
ARNA_KLEP7      RCFTDISDGIEALFRI-IENKDGRINIGNPNEASIKELAEMLLAGFREVESSDYYGKGYQDVEHRKPSIR
RFBB_XANCB      RDWLFVSDHCEAIRTVLAKGRVGTYNVGGNSERQNIEVVQAIEDGKPRESQIAYVTDRPGHDRRYAIDAS
GALE_HAEIN      RDYIHVVDLAVGKALQRHENDAGIYNLGTGHGYSVLDMVKAFEKANNITIAYKLVERRSGDIATCYSDPS
ARNA_KLEP3      RCFTDISDGIEALFRI-IENKDGRINIGNPNEASIKELAEMLLAGFREVESSDYYGKGYQDVEHRKPSIR
RFBB_XANCP      RDWLFVSDHCEAIRTVLAKGRVGTYNVGGNSERQNIEVVQAIEDGKPRESQIAYVTDRPGHDRRYAIDAS
ARNA_YERE8      RCFTDIHDGIEALFRI-IENRDGAINIGNPTEASIRELAELLRCFEKHELRHNFPPFAGQDVEYRTPSIR
ACBB_ACTS5      RDWLHVSDHCXXXXXXXXXXXXXEVHIGGGWEATNLELTEILLEACGAPASISFVTDRKGHDRRYSLDYS
RFBB_ECOLX      RDWLYVEDHARALYTVVTEGKAGTYNIGGHNEKVVFTICDLLDEIVPKEKSITYVADRPGHDRRYAIDAD
RFBB_SHIFL      RDWLYVEDHARALYTVVTEGKAGTYNIGGHNEKVVLTICDLLDEIVPKEKSITYVADRPGHDRRYAIDAD
GALE_YERPE      RDYIHVVDLADGAAMKTLHGKPGVFNLGAGVGHSVLQVVAAFSKACGKPLAYHFAPRREGDLPAYWADAT
RHM1_ARATH      RSYLYCEDVAEAFEVVLHKGEVGHVNIGTKKERRVNDVAKDICKLFNPEANIKFVDNRPFNDQRYFLDDQ
GALE_LACCA      RDYVHVVDLILALKYLDAGNKSSAFNIGSAHGFSNLEILNAARKVTGQEIPATMGPRRAGDPSTLIASSE
GALE_NEIMB      RDYIHVMDLAEGAAMQAKSNVAGTLNLGSGRASSVLEIIRAFEAASGLTIPYEVKPRRAGDLACFYADPS
GALE_ECOLI      RDYIHVMDLADGVAMEKLANKPGVYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADAS
GALE_SALTY      RDYIHVMDLADGMEKLADKSGVHIYNLGAGVGSSVLDVVNAFSKACGKPINYHFAPRRDGDLPAYWADAS
ARNA_PSE14      RCFTDVADGIEALARI-IENRDGIINIGNPDNEASIRQAHPLRAGFREVESQSFYGKGYQDVSHRKPSID
RFBE_SALTI      RDVLHAEDMI-SLYFTALANRGNAFNIGGTIVNXXXXXXXXXXXXDYCNIDMRFTNLPVRESDQRVADIK
GALE_SALTI      RDYIHVMDLADGMEKLADKSGVHIYNLGAGVGSSVLDVVNAFSKACGKPINYHFAPRRDGDLPAYWADAS
GALE_DROME      RDYIHIVDLAEGLDKLRNIAETGAYNLGTGVGYSVLDMVKAFEKASGKKVNYTLVDRRSGDVATCYADAT
GALE_DICDI      RDFIHVVDLAKGALSSLHSKKQGCVNLGTGRGYSVLEMVGALKQASHKEIPYQIVSRRKGDVASSFADPS
ARNA_PSEU2      RCF---TDVVDGIEALARENRDGRINIGNPDNEASIRQAHPLRAGFREVESQSFYGKGYQDVSHRTPSID
GALE_NEIMA      RDYIHVMDLAEGAAMQAKSNVAGTLNLGSGRASSVLEIIRAFEAASGLTIPYEVKPRRAGDLACFYADPS
RFBB_ECOLI      RDWLYVEDHARALYTVVTEGKAGTYNIGGHNEKVVLTICDLLDEIVPKEKSITYVADRPGHDRRYAIDAE
RHM3_ARATH      RSYLYCEDVAEAFEVVLHKGEVNHVNIGTTRERRVIDVANDISKGIDPDSTIQYENRPFNDQ-RYFLDDQ
STRE_STRGR      REWLHVDDHVRGIEAVRTRGRAGRVNIGGGATLSNKXXXXXXXXXXXXDGSVEYVEDRKGHDRRYAVDST
FCL1_ORYSJ      REFLHVDDLADAIFLMDHYSGLEHVNVGSGSEVTIKELAELVKEVVGFQGKLVWDSSKPDGTPRKLMDSS
CAPI_STAAU      RDFTYVDDIVEAISRLGSSYAPYKVNIGNNSPVRLMEFVEAIENKLGKEARKNYMDLQPGDVPETYANVD
RMLB_STRMU      RDWIHTNDHSTGVWAILTKGRIGETYLGEKNNKEVLEL--ILEKMSQPKNAYDHVTDRAGHDLRYAIDST
ARNA_WIGBR      RCFTDIDDGIEALFXXXXXXXXXXXXXGNPNEYTIMQLTKXXXSGFNMLSGTNYYGEGYQDIDRRKPNID
GALE_MOUSE      RDYIHVVDLAKGAALKKLKEQCGTYNLGTGTGYSVLQMVQAMEKASGKK-------IPYKVVARREGDVS
HLDD_ALHEH      RDFVDVSDCVRKLWLLDHPEVSGIYNCGTGRARTFNAMAHAV----------------------------
GALE_STRTR      RDYVHPFDLADAHLLLRKGNESTAFNLGSSTGFSNLQILEAARKVTGKE-------IPAEKADRRDPDIE
GALE_HUMAN      RDYIHVVDLAKGAALRKLKEQCGIYNLGTGTGYSVLQMVQAMEKASGKK-------IPYKVVARREGDVS
TGDS_DICDI      RNYLYIDDIVSAFDIILRKGEIGNVNIGTDFEISNLDVAKKI----------------------------
FCL1_ARATH      REFLHVDDLADAVFLLDRYSGLEHVNIGSGQEVTIRELAELVKEVVGFEGKLGWDCTKPDGTPRKLMDSS
YCL2_ECO11      RDFTYIDDIAEAIWTVETGTPAASINIGNSSPVELMDYIQALEDALGIEAKKNMLPLQPGDVLETSADTK
HLDD_THICR      RDFVFIEDVVNNLWFMENPEQSGIFNLGPAAAEPFKHIADAVID-FHGQGEIEYIPFP------------
GALE_PONAB      RDYIHVVDLAKGAALRKLKEQCGIYNLGTGTGYSVLQMVQAMEKASGKK-------IPYKVVARREGDVS
FCL2_ARATH      REFLHVDDLADAVFLMDQYSGFEHVNVGSGVEVTIKELAELVKEVVGFKGKLVWDTTKPDGTPRKLMDSS
GALE_CORDI      RDYIHIRDLADAHILALQSNVEGSFNLGSGEGYSVKQVIDTCREVTGHLIPAEVAPRRAGDPAVLIASSA
HLDD_AZOSE      RDFIHVDDVVANLWLLDNPGVRGIFNVGTGRAQSFNEVAH------------------------------
GALE2_CYATE     RDYIHVVDLADGIAALRKLNDPEVYNLGTGKGTSVLEMVKAFEQASGKKIPLVMAGRRPGDAEVVYASTN
EXOB_AZOBR      PDGTCIRDYIHXXXXXXXXXXXXXMNCGYGRGASVREVVRTLEEVSGEQVPATFADRRPGDPPQLVAGAD
LPSL_RHIME      RDFTYIDDLVESIVRLSHENRVAPVNTGGGQPVELMTFVETVEKAVGRPAIHNMLPMQQGDVPRASPDLL
GALE_PASMU      RDYIHVVDLAIG-HLKALDRHEGDYNLGTGSGYSVLDMVKAFEKVNDIKIPYKLVDRRPGDIATCYSDPS
GALE_NEIGO      RDYIHVMDLAEGXXXXXXXXXXHLFNLGSGRAYSVLEIIRAFEAASGLHIPYRIQPRRAGDLACSYADPS
GALE_YEREN      RDYIHVMDLAEGSTLINLTSGFRIYNLGTGVGYSVL---HMIKEF----ERITGKNIPFDIVSRRPGDIA
GALE_STRMU      RDYVHPFDLLLALNYLRQGNPSTAFNLGSSTGFSNLQILEAARKVTGQKIPAEKAARRSGDPDTLIASSE
HLDD_SHELP      RDFVYVEDVVKNLWLWQNPGISGVYNCGTGQAQSFNDVANAV-IAYHGKGEIEYIPFP------------
HLDD_DESVV      RDFIYVKDCVEVMWLLQNPGVNGVFNVGTGKARTWNDLVTAVFRAMDREPVIEYIDMP------------
HLDD_DESVH      RDFIYVKDCVEVMWLLQNPGVNGVFNVGTGKARTWNDLVTAVFRAMDREPVIEYIDMP------------
HLDD_BRAHW      RDFIHIDDVVSNNFFFENPNKSGIFNCGTGNAESFVEIAKALKEVYKSAS---IEYIAFPDALRTQADLK
FCL_DICDI       RQFIYSYDLAKFVWTLNNYEEMSPLSVGEEDEISIADVARLITEAMEFKGKLIFDTSKADGQYKKTASNL
ARAE4_ARATH     RDYIDVTDLVDAHVKALEKAQPGIYNVGTGKGRSVKEFVEACKKATGVEIKVDFLPRRPGDYAEVYSDPT
YHEB_SCHPO      RKYLHIYDFINAIDLVWESKMSGQINIGSDDEIDNLSLVKFILKNLDYSKYITFVQDRNYNDSRYSLNYE
HLDD_SHEPW      RDFVYVEDVVKNLWLWQNSEVSGIFNCGTGQAQSFNDVANAV-IAHHGKGAVEYIPFP------------
GALE_ERWAM      RDYIHVMDLAEGLDHLSAIEGYKAYNLGAGKGYSVLEMVKAFEKASGGTVAYQISPRRDGDLAAFWADAT
HLDD_PELCD      RDFIYVGDVVDNLWFLDHPEVSGIYNVGTGRSQTFNDVAHAVLKA-HEGGELQYVPFP------------
GM4D_SHIFL      RDWGHAKDYVKMQWMMLQQEQPEDFVIATGVQYSVRQFVEMAAEGTGVEESVTGHDAPAVDPRYFRPDPT
GM4D_ECOLI      RDWGHAKDYVKMQWMMLQQEQPEDFVIATGVQYSVRQFVEMAAEGTGVEESVTGHDAPAVDPRYFRPDPT
GM4D_ECOL6      RDWGHAKDYVKMQWMMLQQEQPEDFVIATGVQYSVRQFVEMAAEGTGVEESVTGHDAPAVDPRYFRPDPT
GM4D_ECO57      RDWGHAKDYVKMQWMMLQQEQPEDFVIATGVQYSVRQFVEMAAEGTGVEESVTGHDAPAVDPRYFRPDPT
GALE3_ARATH     RDYIHVMDLADGHIAALRKLDDLKINLGTGNGTSVLEMVAAFEKASGKKIPLVMAGRRPGDAEVVYASTE
YGRE_SCHPO      RDYIHVCDLAEAHYLRQHFVSCRPWNLGSGTGSTVFQVLNAFSKAVGRDLPYKVTPRRAGDVVNLTANPT
HLDD_AERS4      RDFIYVDDVCKNLWFWQNPQHSGIFNCGTGRAEPFQNVAEAVIKH-HQQGAIEYIPFP------------
ARAE2_ORYSJ     RDYIDVTDLVDAHVKALDKAQPGKVNVGTGHGRSVKEFVEACKSATGASIKVSFLTRRPGDYAEVYSDPS
HSDD1_ARATH     YDFTYVENVV------------------------------------------------------------
HLDD_AERHH      RDFIYVDDVCKNLWFWLNPQHSGIFNCGTGRAEPFQNVAEAVIKH-HQKGAIEYIPFP------------
GM4D_YERE8      RDWGHAKDYVRMQWMMLQQDQPEDFVIATGKQITVREFVRMSAKEAGIESAISDEYATSADPRYFRPDPS
GALE_RAT        RDYIHVVDLAKGAALKKLKEQCGIYNLGTGTGYSVLQMVQAMEKASGKK-------IPYKVVARREGDVS
EXOB_RHIME      RDYIHVLDLVRAVDYLLEGGESVALNLGTGTGTTVKELLDAIEKVAKRPFNIGYAERREGDSTTLVANND
GALE_STRLI      RDYIHVADLAEA-HLLAVRRRPGNCNLGNGNGFSXXXXXXXXXXXXGHPIPEIMAPRRGRDPAVLVASAG
GAE3_ARATH      RDFTYIDDIVKGLGALDTAEQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQTHANIS
GAE2_ARATH      RDFTYIDDIVKGLGALDTAEQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPRNGDVPTHANIS
ARAE1_ARATH     RDYIDVTDLVDAHVKALQKAKPGIYNVGTGKGSSVKEFVEACKKATGVEIKIDYLPRRAGDYAEVYSDPS
HLDD_POLSJ      RDFVFIDDVVANLWFLDHPEKSGIFNLGQPFNDVALAVVNTLRQSQNA----------------------
HLDD_NITOC      RDFVSVADAAANLWFLEHPNQSGIFNVGTGQAQTFNEVAQAVL-AFHGHGEIEYIPFP--DHLRGRADIH
GMDS_HUMAN      RDWGHAKDYVEAMWLMLQNDEPEDFVIATGVEKSFLHIGKTIVWEGKNENEVTGKVHVTVDLKYYRPDCT
GALE1_PEA       RDYIHVMDLADGLRKLFTSENIGAYNLGTGRGSSVLEMVAAFEKASGKKIALKLCPRRPGDATEVYASTA
GAE4_ARATH      RDFTYIDDIVKGCLAAGKKRGPAQLNLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPRNGDVPTHANIS
GALE1_CYATE     RDYIHVMDLADGLRKLFTTDNIGAYNLGTGRGTSVLEMVAAFEKASGKKIPIKMCPRRPGDATAVYASTE
GAE1_ARATH      RDFTYIDDIVKGCLXXXXXXXXXXFNLGNTSPVTVPILVDILEKHLKVKAKRNFVEMPGNGDVPTHANIS
ARAE3_ARATH     RDYIDVTDLVDAHVKALEKAKPGIYNVGTGKGRSVKEFVEACKKATGVDIKVDFLPRRPGDYAEVYSDPA
HLDD_AZOSB      RDFIHVDDVVANLWLFDNPQVSGIYNLGTGRAQSFNDVA-------------------------------
GMDS_MOUSE      RDWGHAKDYVEAMWLMLQNDEPEDFVIATGVEKSFMHIGKTIVWEGKNENEVTGKVHVTVDLKYYRPDCS
FCL2_ORYSJ      REFTHVDDLAEAVVLMERYSGEEHVNVGSGEEVTVRELAEAVRGVVGYEGVVAWDAARPEGVARRVVDSG
GMDS_CRIGR      RDWGHAKDYVEAMWLMLQNDEPEDFVIATGVEKSFMHIGKTIVWEGKNENEVTGKIHVTVDLKYYRPDCS
GALE1_ARATH     RDYIHVMDLADGHIAALRKLFADPYNLGTGQGTSVLEMVAAFEKASGKKIPIKLCPRRSGDATAVYASTE
GAE6_ARATH      RDFTYIDDIVKGLDTAEKSTGSGVYNLGNPVGRLVSILEGLL--GTKAKKHLIKMPRNGDVPY-THANVS
GMD1_ARATH      RDWGFAGDYVEAMWLMLQQEKPDDYVVATEESHTVKEFLDVSKDHVEIDKRY-FRPTEVDN---LKGDAS
FCL_HUMAN       RQFIYSLDLAQFIWVLREYNEVEPISVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNS
HLDD_SHEFN      RDFVFVEDVVKNLWLWQNPSVSGIYNCGTGQAQSFNDVANAV-IAYHGKGHIEYIPFP------------
HLDD_CHRVO      RDFVSVEDVVKNLFFLDNPGKSGIYNLGSGRSQPALTLAEMIQQGIVEYIDFP-DALKGKYQSFTQADIA
GMD2_ARATH      RDWGFAGDYVEAMWLMLQQEKPDDYVVGHTVEEFLVSFGYLWKDYVEIDQRY-FRPAEVDN---LQGDAS
FCL_ECOLI       REFLHVDDLAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVT
NOEL_RHISN      RDWGHAREYVRGMWMMCQQDRPGDYVLATGVTTSVRTFVEWAFEETGMTDAATGRCVVAVDPRYFRPDAT
HSDD2_ARATH     YDFTYVENVARALASGGDVSTKAPIKFWEFMSQIMMPIAHLV-ELTYKVLGPYGMTVPQLTPSRRTFDST
HLDD_CHRSD      RDFVYVGDVVDNLWCLDHPEVSGIFNLGTGRAEPFKAIAETVIDATGKIDYIDFEELKGRYQSYTRADIS
EXOB_RHILT      RDYIHVLDLVRAVEYLLKGGDSVALNLGTGTGTTVKELLGAIEEVSNRPFPVEYIGRREGDSHTLVANND
ARAE2_ARATH     RDYIDVTDLVDAHVKALEKAKPGIFNVGTGKGSSVKEFVEACKKATGVDIKVDYLERRAGDYAEVYSDPR
GAL10_KLULA     RDYIHVVDLAKGKYLEKYAGTCREWNLGTGHGTTVLQMYRAFCDAIGFNFEYVVTARRDGDVLNLTAKCD
NSDHL_MOUSE     VDFTFVENVVHG----------------------------------------------------------
HLDD_POLNS      RDFVSVEDVVKNLFFLDHPEISGIFNLGSGRAQPFNDVAHAVANAMRKEKAIEYIPFP--DALKGRADLT
HLDD_MARAV      RDFVYVDDVCKNLWFYDNPEQSGIFNLGTGRAQSFLDVAQAVIR-YHGKGSVEFIPFPDE----------
NOEL_RHIFR      RDWGHAREYVRGMWMMCQQDRPGDYVLATGVTTSVRTFVEWAFEETGMTDAATGKCVVAVDPRYFRPDAT
HLDD_RALEH      RDFISVEDVVKNLHFFDHPDKSGIFNLGQPFNDIAATVVNTLREAEGQEGLLEYVKFP--DALRTQSDVS
HLDD_PSEA7      RDFVAVEDVARNLHFLDHPQRSGIFNLGSSFNEVALAVINSVRASADQPPLVLAQALES-----------
NSDHL_RAT       VDFTFVENVVHG----------------------------------------------------------
FCL_MOUSE       RQFIYSLDLARFIWVLREYSEVEPISVGEEDEVSIKEAAEAVVEAMDFNGEVTFDSTKSDGQYKKTASNG
ARAE3_ORYSJ     RDYIDVTDLVDAHVKALNKAEPGIYNVGTGRGRSVKEFVDACKKATGVNIKIEYLSRRPGDYAEVYSDPT
NSDHL_BOVIN     VDFTFVENVVHG----------------------------------------------------------
GAL10_YEAST     RDYIHVVDLAKGQYLEAYNENEGEWNLGSGKGSTVFEVYHAFCKASGIDLPYKVTGRRAGDVLNLTAKPD
GALE_CORGL      RDYIHILDLAKAHVLALESNEAGKFNLGSGDGYSVKQVVEMCREVTGHPIPAEVAPRRAGDPATLIASSE
FCL_PONAB       RQFIYSLDLAQFIWVLREYNEVEPISVGEDDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNS
ARAE1_ORYSJ     RDYIDVTDLVDAHVKALNKAERGKVNVGTGKGRSVKEFVEACKKATGVDIKVDYFPRRPGDYAEVYSDPA
HLDD_EDWI9      RDFIYVGDVADNLWFWEN-GVSGIFNCGTGNAESFQAVADAV-VAYHQKGSVTYIPFPDKLKGRTQADTT
GALE_MYCGE      RDYIHVYDICNALWKWLNDHRQETFNLGSGIGTSNLEVIDIAKKFYPSRLNLEIRPKRSWDPAILVANVA
HLDD_CUPTR      RDFISVEDVVKNLFFFDHPEKSGIFNLGQPFNDIAATVVNTLREAEGK------PPLSLDDLVQEQSDVS
HLDD_VIBVY      RDFIYVGDVCKNLWFMQN----------------------------------------------------
HLDD_VIBVU      RDFIYVGDVCKNLWFMQN----------------------------------------------------
HLDD_THIDA      RDFVSVEDVVRNMWFLDHPEVSGIFNVG------------------------------------------
HLDD_RHOFD      RDFIFIDDVVANLWFFDHPGVSGIFNLGTGRAQPFNDVASSVVNALRGLSGXXIEYIPFPDALRTQADLS
HLDD_PASMU      RDFVYVGDVAANIWCWQN-NISGIYNLGTGNAESFLEVAKVVKFHGKTEADIEIIPFP------------
GM4D1_VIBCH     RDWGHAKDYVKMQWMMLQQDEPRDFVIATGVQYSVREFIDMVDEKAVVKSVITKAPIVAVDPAYFRPDPS
GAL10_SCHPO     RDYIHVVDLAKGNYLNKINNSEGMYNLGTGKGSSVFDIYHAFCKEVGKDLPYEVVGRRTGDVLNLTASPN
FCL_CRIGR       RQFIYSLDLARFIWVLREYNEVEPISVGEEDEVSIKEAAEAVVEAMDFCGEVTFDSTKSDGQYKKTASNG
NSDHL_HUMAN     VDFTFVENVVHG----------------------------------------------------------
HLDD_HAMD5      RDFIFVDDVAQNLWCWQNQIS-GIFNCGTGHAASFQTLADTVVAYHNSKQYVDFENLKGCYQTFTQADIT
GMDS_DICDI      RDWGHARDYVEAMWLMLQQEKP------------------------------------------------
GAE5_ARATH      RDFTYIDDIVKGLGALDTAEXXXXYNLGNPVPVTKL-VTXXXXXXXXXXXXXXXXXXRNGDVEFTHANIT
HLDD_VIBF1      RDFVYVGDVAANLWFLEN----------------------------------------------------
HLDD_BORA1      RDFISVEDVVDNLHFLDHPGTSGIFNCGQPFNDVAAAVVNTLR-AEQGEAPLSLDELVSQGLIRYIP---
GMDS_DROME      RDWGHASDYVEAMWMMLQRESPSDYVIATGETHSVAAFKHIDREITWKGKGVDEVGVENGTGIVRRPDAS
HLDD_POLNA      RDFVFIDDVVANLWFFDHPEKSGIFNLGQPFNDVAIAVVNTLRQSQNA------APLSLEDAVR------
HLDD_NEIMA      RDFVSVEDVAKNLYFFDHPELSGIYNLGTGRSQQFNELAAATVRAAEGKPEMSLKELVEEELIRYIPDIT
HLDD_VIBFM      RDFVYVGDVAANLWFLEN----------------------------------------------------
HLDD_NEIM0      RDFVSVEDVAKNLYFFDHPELSGIYNLGTGRSQQFNELAAATVRAAEGKPEMSLKELVEEELIRYIPDIT
HLDD_SALPC      RDFVYVGDVAANLWFL-ESGKSGIFNLGTGRAESFQAVADATL-AYHKKGSIEYIPFPDKLKGRTQADLT
HLDD_SALCH      RDFVYVGDVAANLWFL-ESGKSGIFNLGTGRAESFQAVADATL-AYHKKGSIEYIPFPDKLKGRTQADLT
GM4D2_VIBCH     RDWGHAKDYVRMQWMMLQQDQPEDFVIATGVQYSVRQFIEWSAKELG--VTLTFEGQGVDDPRYFRPDPS
HLDD_SODGM      RDFIYVGDVAANLWFWQN-NVSGIFNCGTGRAESFQAVSDAVLD-YHKKGQLEYIPFPEKLKGRTQADLT
HLDD_RALEJ      HDFVSIDDVVKNLFFLDHPRRSGIFNVGSGHARSFNDVACVVLRAAEDKPPLALEELVQEDALRGRSDSS
HLDD_NEIMB      RDFVSVEDVAKNLYFFDHPELSGIYNLGTGRSQQFNELAAATVRAAEGKPEMSLKELVEEELIRYIPDIT
HLDD_NEIMF      RDFVSVEDVAKNLYFFDHPELSGIYNLGTGRSQQFNELAAATVRAAEGKPEMSLKELVEEELIRYIPDIT
GM4D_PSEAE      RDWGFAGDYVEAMWLMLQQDKADDYVVATGVTTTVRDMCQIAFEHVG----LDYRDFLKIDPAFFRPNPA
HLDD_SALG2      RDFVYVGDVAANLWFL-ESGKSGIFNLGTGRAESFQAVADATL-AYHKKSSIEYIPFPDKLKGRTQADLT
HLDD_SALEP      RDFVYVGDVAANLWFL-ESGKSGIFNLGTGRAESFQAVADATL-AYHKKSSIEYIPFPDKLKGRTQADLT
HLDD_SALDC      RDFVYVGDVAANLWFL-ESGKSGIFNLGTGRAESFQAVADATL-AYHKKSSIEYIPFPDKLKGRTQADLT
HLDD_RALPJ      RDFVSVEDVVKNLFFFDNPDKSGIFNLGNDIATTVMN---------------------------------
HLDD_PSYIN      RDFVYIGDVCKNLWFFDN-NVSGIYNLGTGQAESFLEVGQAV----------------------------
HLDD_PHOLL      RDFIYVGDAAANLWFWKN-GVSGIYNCGTGRAESFQAVADAVVE-CHKDKSLTVEHIDFPEHLKGRADLT
GALE_KLEPN      ----------------------------------------------------------------------
HLDD_PROMH      RDFIYVGDVAANLWFWRN-NVSGIYNCGTGRAESFQAVADAV----------------------------
HLDD_HAEIG      RDFVYVGDVAANIWCWQNGIS-GIYNLGTGNAESFRAVADAVVK-FHGKGEIETIPFPEHLKSRTQADLT
HLDD_HAEI8      RDFVYVGDVAANIWCWQNGIS-GIYNLGTGNAESFRAVADAVVK-FHGKGEIETIPFPEHLKSRTQADLT
GALE2_ARATH     RDYIHVIDLADGHIAALRKLEDCKINLGTGNGTSVLEMVDAFEKASGKKIPLVIAGRRPGDAEVVYASTE
HLDD_HAEIN      RDFVYVGDVAANIWCWQNGIS-GIYNLGTGNAESFRAVADAVVK-FHGKGEIETIPFPEHLKSRTQADLT
HLDD_BURP8      RDFVSVEDLVKNLHFFDHPEKSGIFNLGNDIASTVLSLAELVQRG-------LIEYIPFPDALRTQADLT
HLDD_SALTY      RDFVYVGDVAANLWFL-ESGKSGIFNLGTGRAESFQAVADATL-AYHKKGSIEYIPFPDKLKGRTQADLT
HLDD_SALTI      RDFVYVGDVAANLWFL-ESGKSGIFNLGTGRAESFQAVADATL-AYHKKGSIEYIPFPDKLKGRTQADLT
HLDD_SALSV      RDFVYVGDVAANLWFL-ESGKSGIFNLGTGRAESFQAVADATL-AYHKKGSIEYIPFPDKLKGRTQADLT
HLDD_SALPK      RDFVYVGDVAANLWFL-ESGKSGIFNLGTGRAESFQAVADATL-AYHKKGSIEYIPFPDKLKGRTQADLT
HLDD_SALPB      RDFVYVGDVAANLWFL-ESGKSGIFNLGTGRAESFQAVADATL-AYHKKGSIEYIPFPDKLKGRTQADLT
HLDD_SALPA      RDFVYVGDVAANLWFL-ESGKSGIFNLGTGRAESFQAVADATL-AYHKKGSIEYIPFPDKLKGRTQADLT
HLDD_SALNS      RDFVYVGDVAANLWFL-ESGKSGIFNLGTGRAESFQAVADATL-AYHKKGSIEYIPFPDKLKGRTQADLT
HLDD_SALHS      RDFVYVGDVAANLWFL-ESGKSGIFNLGTGRAESFQAVADATL-AYHKKGSIEYIPFPDKLKGRTQADLT
HLDD_SALAR      RDFVYVGDVADNLWFL-ESGKSGIFNLGTGRAESFQAVADATL-AYHKKGSIEYIPFPDKLKGRTQADLT
HLDD_SALA4      RDFVYVGDVAANLWFL-ESGKSGIFNLGTGRAESFQAVADATL-AYHKKGSIEYIPFPDKLKGRTQADLT
HLDD_PSEAE      ----------------------------------------------------------------------
HLDD_BURVG      RDFVSVEDVAKNLFFFDHPEKSGIFNLGNDIASTVVN---------------------------------
HLDD_BURM1      RDFVSVEDVAKNLFFFDHPEKSGIFNLGNDIASTVVN---------------------------------
HLDD_BURCM      RDFVSVEDVAKNLFFFDHPEKSGIFNLGNDIASTVVN---------------------------------
HLDD_BURA4      RDFVSVEDVAKNLFFFDHPEKSGIFNLGNDIASTVVN---------------------------------
TGDS_MIMIV      RNFIHAIDVADAVDLVINNGVIGTYNIGVTNEHSVLDVAQILCDGVNLENQLEYVPDRLFNDFRYNITND
SPSK_BACSU      GSPTYTKDLAEAV-IKLFSHPPGIYHVSNSGICSWYEFATAIMEESGLETAI------------------
HLDD_ECOSM      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
FCL_DROME       RQFVYSRDLAEMIWVLRNYESVEPIILSEVQEVTIFEVAQAVAKAFNFNGRLVCDTSKSDGQYKKTASNA
YFHF_BACSU      ----------------------------------------------------------------------
HLDD_VIBCM      RDFVYVGDVAANLWFL------------------------------------------------------
HLDD_VIBCH      RDFVYVGDVAANLWFL------------------------------------------------------
HLDD_VIBC3      RDFVYVGDVAANLWFL------------------------------------------------------
HLDD_PSEAB      ----------------------------------------------------------------------
HLDD_RALME      RDFVSVEDVVKNLYFLDHPEKSGIFNLGQPFNDIAVSVVNALRES-------------------------
HLDD_ENTS8      RDFIYVGDVAANLWFWQN-GVSGIFNCGTGRAESFQAVADAAL-AFHKKGSIEYIPFP------------
Y4AF_RHISN      RDFLYSEDCSDALFLLKHYSETEHINXXXXXXXXXXXLAHIVCRVVGFKGDIVFDTSKPDGTPRKLLS-S
HLDD_SHISS      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_SHIFL      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_SHIF8      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_SHIDS      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_SHIBS      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_SHIB3      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_RALSO      RDFVSVEDVVKNLFFFDHPDKSGIFNLGQPFNDIATTVVNTLREAEGKPALSTEE---------------
HLDD_MANSM      RDFVYVGDVAENLWAWEN-GVSGIFNLGTGNAESFKAVAEAV----------------------------
HLDD_KLEP7      RDFVYVGDVADNLWFWEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGSIEYIPFPDKLKGRTQADLT
HLDD_KLEP3      RDFVYVGDVADNLWFWEN-GVSGIFNLGTGRAESFQAVADATL-AFHKKGSIEYIPFPDKLKGRTQADLT
HLDD_ESCF3      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECOUT      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECOSE      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECOLU      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECOLI      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECOL6      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECOL5      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECOK1      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECODH      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECOBW      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECO8A      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECO81      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECO7I      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECO5E      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECO57      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECO55      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECO45      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECO27      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECO24      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_BURS3      RDFVSVEDVTKNLFFFDHPEKSGIFNLGNDIASTVVN---------------------------------
HLDD_BURCH      RDFVSVEDVTKNLFFFDHPEKSGIFNLGNDIASTVVN---------------------------------
HLDD_BURCC      RDFVSVEDVTKNLFFFDHPEKSGIFNLGNDIASTVVN---------------------------------
HLDD_BURCA      RDFVSVEDVTKNLFFFDHPEKSGIFNLGNDIASTVVN---------------------------------
GMD2_CAEEL      RDWGHAKEYVEAMWRILQQDTPDDFVIATGKQFSVREFCNLIGEQLVWEGEGVDEVGKNQDGVVRRPNPA
YGAE_ERWAM      ----------------------------------------------------------------------
HLDD_ENT38      RDFVYVGDVAANLWFWEN-GVSGIFNLGTGRAESFQAVADAAL-AFHKKDSLEYIPFP------------
HLDD_CITK8      RDFVYVGDVADNLWFWEN-GVSGIFNLGTGRAESFQAVADAAL-AYHKKSDLEYIPFP------------
HLDD_BURCJ      RDFVSVEDVTKNLFFFDHPEKSGIFNLGNDIASTVVN---------------------------------
HLDD_YERE8      RDFIYVGDVADNLWFWQN-GVSGIFNCGTGRAESFQAVADAVVDQSGPVEYIEFEKLKGRYQAYTQADLT
HLDD_KLEPN      RDFVYVGDVADNLWFWEN-GVSGIFNLGTGRAESFQPVADATL-AYHKKGSIEYIPFPDKLKGRTQADLT
GALE_MYCPN      RDYIHVVDLLAWKWLQANPKRFESFNLGSGSNWEVINTAQAI--FAPEQLQLKIESRRAGDPPVLVVDCT
HLDD_YERPY      RDFIYVGDVADNLWFWQN-GVSGIFNCGTGRAESFQAVADAVVDQSGPVEYIEFEKLKGRYQAYTQADLT
HLDD_YERPS      RDFIYVGDVADNLWFWQN-GVSGIFNCGTGRAESFQAVADAVVDQSGPVEYIEFEKLKGRYQAYTQADLT
HLDD_YERPP      RDFIYVGDVADNLWFWQN-GVSGIFNCGTGRAESFQAVADAVVDQSGPVEYIEFEKLKGRYQAYTQADLT
HLDD_YERPN      RDFIYVGDVADNLWFWQN-GVSGIFNCGTGRAESFQAVADAVVDQSGPVEYIEFEKLKGRYQAYTQADLT
HLDD_YERPG      RDFIYVGDVADNLWFWQN-GVSGIFNCGTGRAESFQAVADAVVDQSGPVEYIEFEKLKGRYQAYTQADLT
HLDD_YERPE      RDFIYVGDVADNLWFWQN-GVSGIFNCGTGRAESFQAVADAVVDQSGPVEYIEFEKLKGRYQAYTQADLT
HLDD_YERPB      RDFIYVGDVADNLWFWQN-GVSGIFNCGTGRAESFQAVADAVVDQSGPVEYIEFEKLKGRYQAYTQADLT
HLDD_YERPA      RDFIYVGDVADNLWFWQN-GVSGIFNCGTGRAESFQAVADAVVDQSGPVEYIEFEKLKGRYQAYTQADLT
HLDD_YERP3      RDFIYVGDVADNLWFWQN-GVSGIFNCGTGRAESFQAVADAVVDQSGPVEYIEFEKLKGRYQAYTQADLT
HLDD_RHILO      RDFIHVGDVALWLWKRGSS---GIFNCGTGRAQPFRAIAETVID-TLGKGEIEFIPFP--DHLKTQADMS
Y2119_STAHJ     YSWIHINDLVRALFTIDNPNAKGPFNMAAPIAE-------------------------------------
HLDD_HAEDU      RDFVYVEDVAKNIWAWKN-NISGIYNLGTGKAESFQTVAQAV----------------------------
HLDD_ECOLC      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
HLDD_ECOHS      RDFVYVGDVADNLWFLEN-GVSGIFNLGTGRAESFQAVADATL-AYHKKGQIEYIPFP------------
Y4NG_RHISN      YQFVHSDDLASACIAASNVKGFATYNIGAAEFGTMRELLQVVIKHAETGSRIKSIPMGPTXXXXXXXDIS
YFCH_ECOLI      LAWIHIDDMVNGLWLLDNELR-GPFNMVSPYPVRNEQFAHAL----------------------------
Y1061_METJA     ----------------------------------------------------------------------
HLDD_FUSNN      RDFVYVKDVVDIMYFMVNDVKSGIYNIGTGKARSFLSMATMRAASHNKNEVVKLIEMPEDLQGRTEAKIN
Y1223_SYNY3     ----------------------------------------------------------------------
GAL10_CANMA     ----------------------------------------------------------------------
HLDD_PECCP      RDFVYVGDVAANLWFWQN----------------------------------------------------
Y2567_STAAR     ----------------------------------------------------------------------
STRL_STRGR      ----------------------------------------------------------------------
Y2778_STAA8     ----------------------------------------------------------------------
Y2488_STAAC     ----------------------------------------------------------------------
Y2422_STAA3     ----------------------------------------------------------------------
HLDD_BURPP      RDFVSVEDVVKNLFFFDNPDKSGIFNLGSGRAQPFNDIASTVLRSLNNEPALSIEYIPFPDALRTQADQS
D39U1_BOVIN     ----------------------------------------------------------------------
YQJ9_SCHPO      ----------------------------------------------------------------------
YL056_YEAST     ----------------------------------------------------------------------
Y2478_STAAM     ----------------------------------------------------------------------
Y2266_STAAN     ----------------------------------------------------------------------
Y1014_HAEIN     ----------------------------------------------------------------------
YGI2_SCHPO      ----------------------------------------------------------------------
RCP_VIBCH       ----------------------------------------------------------------------
Y2403_STAAW     ----------------------------------------------------------------------
Y2370_STAAS     ----------------------------------------------------------------------
Y2073_MYCBO     ----------------------------------------------------------------------
Y2047_MYCTU     ----------------------------------------------------------------------
SQD1_SPIOL      RGYLDIRDTVQ-----------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KAKELLGWEPLVGIDVGLREVINWQIETQRTYAEKIS
UXS1_RAT        KAKLMLGWEPVVPLEEGLNKAIHY-------------
UXS1_PONAB      KAKLMLGWEPVVPLEEGLNKAIHY-------------
UXS1_MOUSE      KAKLMLGWEPVVPLEEGLNKAIHY-------------
UXS1_HUMAN      KAKLMLGWEPVVPLEEGLNKAIHY-------------
UXS1_XENTR      KAKLLLGWEPVVPLEEGLNKTIHY-------------
UXS1_DANRE      KAKLLLGWEPVVPLEEGLNKTIQY-------------
GALE_METJA      KA-ESLGWKPEIDLKEGIKRVVNWMKNNNRT------
YTCB_BACSU      KAKQLLHYDPATSLKDGLTNEI---------------
TGDS_MOUSE      EKIHSLGWKPKVPWEEGIKKTVEW-------------
TGDS_BOVIN      EKIHGLGWRPKVPWKEGIKKTIEWYRE----------
ARNA_AERS4      NARRLLDWEPTIEMEETIGKTLDFFLQ----------
TGDS_HUMAN      EKIHGLGWRPKVPWKEGIKKTIEWYRE----------
ARNA_SERP5      NARRLLDWQPTIAMQQTVADTLDYFLRT---------
ARNA_PHOLL      NAERLLDWKPTIDMKQTINETLDF-------------
GME1_ORYSI      LIKEKLGWAPTMKLKDGLRFTYFWQIEKEKTQGVDIA
SPSJ_BACSU      KLKNELGWRQEVTFEEGIARTIQWYTDNDR-------
GME1_ORYSJ      LIKEKLGWAPTMKLKDGLRFTYFWQIEKEKTQGVDIA
ARNA_SALTY      NARRCLGWEPSIAMRDTVEETLDF-------------
ARNA_SALPC      NARRCLGWEPSIAMRDTVEETLDF-------------
ARNA_SALPB      NARRCLGWEPSIAMRDTVEETLDF-------------
ARNA_SALNS      NARRCLGWEPSIAMRDTVEETLDF-------------
ARNA_SALHS      NARRCLGWEPSIAMRDTVEETLDF-------------
ARNA_SALG2      NARRCLGWEPSIAMRDTVEETLDF-------------
ARNA_SALEP      NARRCLGWEPSIAMRDTVEETLDF-------------
ARNA_SALDC      NARRCLGWEPSIAMRDTVEETLDF-------------
ARNA_SALCH      NARRCLGWEPSIAMRDTVEETLDF-------------
ARNA_SALA4      NARRCLGWEPSIAMRDTVEETLDF-------------
ARNA_SODGM      NAKRLLGWAPSVPMAQTIDETLDFFLQT---------
Y1055_METJA     KSEKLLGYKPKVTIEEGLKRFCNWFLENK--------
GALE_BACSU      KAKRELGWEAKRGLEEMCADSWRWQSSNVNGY-----
ARNA_SHESH      NAKKLLNWEPTIMMDQTIEDTLDFFLKT---------
ARNA_PECCP      NAKRLLEWEPTVKMEQTVAETLDYFLRT---------
ARNA_ERWCT      NAKRLLEWEPTVKMEQTVAETLDYFLRT---------
ARNA_ENT38      NAHRLISWTPTVEMEKTIDETLDFFLKT---------
ARNA_ECOUT      NARRCLNWEPKIDMQETIDETLDFFLRT---------
ARNA_ECOK1      NARRCLNWEPKIDMQETIDETLDFFLRT---------
ARNA_ECO45      NARRCLNWEPKIDMQETIDETLDFFLRT---------
ARNA_SHISS      NARRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_SALSV      NARRCLDWEPSIAMRDTVEETLDF-------------
ARNA_ECOSM      NARRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_ECOLU      NARRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_ECO81      NARRCLNWEPKIDMQETIDETLDFFLRT---------
ARNA_ECO7I      NARRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_ECO27      NARRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_AERHH      NARRLLDWEPTIEMEETIGNTLDFFLQ----------
ARNA_ESCF3      NARRCLDWEPTIDMQETIDETLDFFLRT---------
ARNA_ECOL6      NARRCLDWEPKIDMQETIDETLDFFLRT---------
RHM2_ARATH      KLKK-LGWQERTNWEDGLKKTMDWYTQNPEWWGD---
RFBB_RHISN      KLETELGWKAQENFDTGIRKTVEWYLE----------
ARNA_SHIDS      NAHRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_SHIBS      NAHRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_PROMH      NAERLLDWKPTIETRQTVEETLDF-------------
ARNA_ERWT9      NAKQLLNWQPTIAMDKTIDDTLDFFLQS---------
ARNA_ECOSE      NAHRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_ECOLI      NAHRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_ECOLC      NAHRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_ECOL5      NARRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_ECOHS      NAHRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_ECODH      NAHRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_ECOBW      NAHRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_ECO8A      NAHRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_ECO5E      NAHHCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_ECO57      NAHHCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_ECO55      NAHRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_ECO24      NAHRCLDWEPKIDMQETIDETLDFFLRT---------
RFBB_NEIGO      KIRRDLGWLPLETFESGLRKTVQWYLDNK--------
ARNA_SHIB3      NAHRCLDWEPKIDMQETIDETLDFFLRT---------
GME2_ORYSJ      LIKEKLGWAPTMRLKDGLRITYFWQLEKEKAEGVDLS
ARNA_SALTI      NARRCLDWEPSIAMRDTVEETLDF-------------
ARNA_SALPK      NARRCLDWEPSIAMRDTVEETLDF-------------
ARNA_SALPA      NARRCLDWEPSIAMRDTVEETLDF-------------
GME_ARATH       LIKEKLGWAPNMRLKEGLRITYFWQIEKEKAKGSDVS
RFBB_NEIMA      KIRRDLGWQPLETFESGLRKTVQWYLDNK--------
GALE_LACHE      KARTVLGWKPKENVDDVIATAWKWHKSHPKGYEDK--
GALE_BACHD      KAQTILGWEPYPSLETMVEHAWNWHKEHPHGYS----
RFFG_HAEIN      KIHAELGWQPQITFEQGLRQTVKWYL-----------
RFBB_NEIMB      KIRRDLGWLPLETFESGLRKTVQWYLDNK--------
ARNA_YERPY      NARRILHWQPEIAMQQTVTETLDF-------------
ARNA_YERPS      NARRILHWQPEIAMQQTVTETLDF-------------
ARNA_YERPP      NARRILHWQPEIAMQQTVTETLDF-------------
ARNA_YERPN      NARRILHWQPEIAMQQTVTETLDF-------------
ARNA_YERPG      NARRILHWQPEIAMQQTVTETLDF-------------
ARNA_YERPE      NARRILHWQPEIAMQQTVTETLDF-------------
ARNA_YERPB      NARRILHWQPEIAMQQTVTETLDF-------------
ARNA_YERPA      NARRILHWQPEIAMQQTVTETLDF-------------
ARNA_YERP3      NARRILHWQPEIAMQQTVTETLDF-------------
RFBB_SALTY      KISRELGWKPLETFESGIRKTVEWYL-----------
ARNA_SHIF8      NAHRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_PSEAB      NARRLLDWQP----TIELRETI---------------
ARNA_SHIFL      NAHRCLDWEPKIDMQETIDETLDFFLRT---------
ARNA_PSEAE      NARRLLDWQP----TIELRETI---------------
ARNA_PSEA8      NARRLLDWQP----TIELRETI---------------
ARNA_PSEFS      NAKRLLNWEPTV-------------------------
RFFG_ECOLI      KIARELGWLPQETFESGMRKTVQWYLANE--------
YFNG_BACSU      KARKLLNWTPAYTIDEGLEKTIEWYTE----------
ARNA_PSEPF      NAKRLLDWTPTV-------------------------
ARNA_PSEA7      NARRLLDWQPA----IELRETI---------------
GALE_PASHA      KALEQLGWETERGLEQMMKDTWNWQKNNPNGY-----
ARNA_PSEF5      NAKRLLNWEPTV-------------------------
GALE_NEIMC      YAKAQIGWQ----------------------------
VIPB_SALTI      KIKTFLSYEPEFDIKEGLKQTLKWYIDKHST------
ARNA_KLEP7      NAKRCLNWEPKVEMEETVEHTLDFFLRTVELVDDK--
RFBB_XANCB      KLKDELGWEPAYTFEQGIALTVDWYLTNQ--------
GALE_HAEIN      LAAKELGWVAERGLEKMMQDTWNWQKNNPKGYRD---
ARNA_KLEP3      NAKRCLNWEPKVEMEETVEHTLDFFLRTVELVDDK--
RFBB_XANCP      KLKDELGWEPAYTFEQGIAQTVDWYLTNQ--------
ARNA_YERE8      NARRILDWQPEIALEQTVMETLDF-------------
ACBB_ACTS5      KIAGELGYRPRVDFTDGIAETVAW-------------
RFBB_ECOLX      KISRELGWKPQETFESGIRKTVEWYL-----------
RFBB_SHIFL      KISRELGWKPQETFESGIRKTVEWYL-----------
GALE_YERPE      KAAEQLGWRVSRSLDEMAADTWHWQSKNPQGYPD---
RHM1_ARATH      KLKK-LGWSERTTWEEGLKKTMDWYTQNPEWWGD---
GALE_LACCA      KARDILGWKPYDDIDKIIETAWNW-------------
GALE_NEIMB      YTKAQIGWQ----------------------------
GALE_ECOLI      KADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD---
GALE_SALTY      KADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD---
ARNA_PSE14      NARQLIGWTP---------------------------
RFBE_SALTI      KITNAIDWSPKVSAKDGVQKMYDW-------------
GALE_SALTI      KADRELNWRVTRTLDEMAQDTWHWQSRHPQGYSD---
GALE_DROME      LADKKLGWKAERGIDKMCEDTWRWQSQNPNGYANK--
GALE_DICDI      KALKELGWKATHNQDDMCRDAWKWQSLNPNGYSD---
ARNA_PSEU2      NAKKLIGWTP---------------------------
GALE_NEIMA      YTKAQIGWQ----------------------------
RFBB_ECOLI      KIGRALGWKPQETFESGIRKTVEWYLSNTK-------
RHM3_ARATH      KLKK-LGWCERTNWEEGLRKTMEWYTENPEWWGD---
STRE_STRGR      RIQRELGFAPAVDLADGLAATVAW-------------
FCL1_ORYSJ      KIQE-MGWKPKVPLKEGLVETYKWYVE----------
CAPI_STAAU      DLFRDIDFKPETTIQDGVNKFVDWYLE----------
RMLB_STRMU      KLREELGWKPFTNFEEGLEDTIKWYTE----------
ARNA_WIGBR      IAKKLLNWTP---------------------------
GALE_MOUSE      LAHEELGWTAALGLDRMCEDLWRWQ------------
HLDD_ALHEH      -------------------------------------
GALE_STRTR      KARTVLGWKP---------------------------
GALE_HUMAN      LAQEELGWTAALGLDRMCEDLWRWQ------------
TGDS_DICDI      -------------------------------------
FCL1_ARATH      KLAS-LGWTPKVSLRDGLSQTYDWYLK----------
YCL2_ECO11      ALYEVIGFTPETTVKDGVKNFVNW-------------
HLDD_THICR      -------------------------------------
GALE_PONAB      LAHEELGWTAALGLDRMCEDLWRWQ------------
FCL2_ARATH      KLAS-LGWTPKISLKDGLSQTYEWYLE----------
GALE_CORDI      KAQSELGWKP---------------------------
HLDD_AZOSE      -------------------------------------
GALE2_CYATE     KAERELNWKAKYGIDEMCRDQWNW-------------
EXOB_AZOBR      RIREQLGWVPKHDLDGIVRSALSWERSLEQSVGQ---
LPSL_RHIME      EA--LTGFKPSVSVEEGVARFVEWYDQNYR-------
GALE_PASMU      LAKTELNWTAARGLEQMMKDTWHWQKKNPKGYRD---
GALE_NEIGO      HTKQQTGWETKRGLQQMMEDSWRWVSRNPGRYGD---
GALE_YEREN      ESPELLGWYAKRTLVDMLQDAWKWQ------------
GALE_STRMU      KAREVLGWKP---------------------------
HLDD_SHELP      -------------------------------------
HLDD_DESVV      -------------------------------------
HLDD_DESVH      -------------------------------------
HLDD_BRAHW      KLRAAGYDKPFMNVNTGVKK-----------------
FCL_DICDI       KLKSLVPDLTFTPIQQAIKESCQWFIDNYET------
ARAE4_ARATH     KILKDLNWTAFTNLQDSLQVAWRWQ------------
YHEB_SCHPO      KIKS-LGWRPQIPLETGLRKLID--------------
HLDD_SHEPW      -------------------------------------
GALE_ERWAM      LADKELNWRVSRGIDEMMRDTWNWQ------------
HLDD_PELCD      -------------------------------------
GM4D_SHIFL      KAHEKLGWKP----EITLREMVSEMVANDLEAAKKHS
GM4D_ECOLI      KAHEKLGWKP----EITLREMVSEMVANDLEAAKKHS
GM4D_ECOL6      KAHEKLGWKP----EITLREMVSEMVANDLEAAKKHS
GM4D_ECO57      KAHEKLGWKP----EITLREMVSEMVANDLEAAKKHS
GALE3_ARATH     KAERELNWKAKNGIEEMCRDLWNW-------------
YGRE_SCHPO      RANEELKWK----------------------------
HLDD_AERS4      -------------------------------------
ARAE2_ORYSJ     KIHDELNW-----------------------------
HSDD1_ARATH     -------------------------------------
HLDD_AERHH      -------------------------------------
GM4D_YERE8      KAKEKLGWVPEITVEEMCAEMVAGDLQQAKQHA----
GALE_RAT        LAHEELGWTAALGLDRMCEDLWRWQ------------
EXOB_RHIME      KARQVLGWEPQYDLAAITESAWNW-------------
GALE_STRLI      TAREKLGWNP---------------------------
GAE3_ARATH      SAQRELGYKPTTDLQTGLKKFARWYL-----------
GAE2_ARATH      SAQREFGYKPSTDLQTGLKKFVRWYLGYYKQGGKKVA
ARAE1_ARATH     KIRKELNW-----------------------------
HLDD_POLSJ      -------------------------------------
HLDD_NITOC      ALREAGYAEPFALVEKGVKTYLDW-------------
GMDS_HUMAN      KAKQKLNWKPRVAFDELVREMVHADVELMRT------
GALE1_PEA       KAEKELGWKAKYGVEEMCRDQWNWAKNNPWGYSGK--
GAE4_ARATH      LAQRELGYKPTTDLQTGLKKFVRWYL-----------
GALE1_CYATE     KAEKELGWKAKYGVEEMCRDQWKW-------------
GAE1_ARATH      SARNEFGYKPTTDLETGLKKFVRWYL-----------
ARAE3_ARATH     KILRDLNWSAYTNLQESLEVAWKWQKTHPHGYA----
HLDD_AZOSB      -------------------------------------
GMDS_MOUSE      KAQQKLNWKPRVAFDELVREMVQADVELMRT------
FCL2_ORYSJ      RMRK-LGWEPRVALRDGIQDLYRFYL-----------
GMDS_CRIGR      KAQQKLNWKPRVAFDELVREMVQADVELMRT------
GALE1_ARATH     KAEKELGWKAKYGVDEMCRDQWKWANNNPWGYQNKL-
GAE6_ARATH      LAYKDFGYKPTTDLAAGLRKFVKWYV-----------
GMD1_ARATH      KAKEMLGWKPKVGFEKLVKMMVDEDLE----------
FCL_HUMAN       KLRTYL-------------------------------
HLDD_SHEFN      -------------------------------------
HLDD_CHRVO      KLREAGYAEAMLSVAEGVDRYVDWLIGRQ--------
GMD2_ARATH      KAKEVLGWKPQVGFEKLVKMMVDEDLE----------
FCL_ECOLI       RLHQ-LGWYHEISLEAGLASTYQWFLENQ--------
NOEL_RHISN      KARQVLGW-----------------------------
HSDD2_ARATH     KAKDRLGYAPVVPLQEGIRRTID--------------
HLDD_CHRSD      RLRE---------------------------------
EXOB_RHILT      KARDVLGWVPQYDLSEIIRSAWDWHAKSNQ-------
ARAE2_ARATH     KIKEELNWTAKTNLQESLKMAWRWQ------------
GAL10_KLULA     RATNELEWKTELDVNKACVDLWKW-------------
NSDHL_MOUSE     -------------------------------------
HLDD_POLNS      KLRAAGYAEPFLTVEQGVGRYIEW-------------
HLDD_MARAV      -------------------------------------
NOEL_RHIFR      KARQVLGW-----------------------------
HLDD_RALEH      KLRSAGYSEPFLSVEEGVARYCRWLIE----------
HLDD_PSEA7      -------------------------------------
NSDHL_RAT       -------------------------------------
FCL_MOUSE       KLRSYLPDFRFTPFKQAVKETCTW-------------
ARAE3_ORYSJ     KINTELNWAQYTDLKESLSVAWRWQKSHPRGY-----
NSDHL_BOVIN     -------------------------------------
GAL10_YEAST     RAKRELKWQTELQVEDSCKDLWKWTTENPFGY-----
GALE_CORGL      KAKQELGWTP---------------------------
FCL_PONAB       KLRTYL-------------------------------
ARAE1_ORYSJ     KINSELNW-----------------------------
HLDD_EDWI9      QLRAAGYSRPFKTVAQGVREYMEW-------------
GALE_MYCGE      KAKQ---------------------------------
HLDD_CUPTR      KLRGAGYSERFLSVEEGVARYCRWLLE----------
HLDD_VIBVY      -------------------------------------
HLDD_VIBVU      -------------------------------------
HLDD_THIDA      -------------------------------------
HLDD_RHOFD      ALRATGCDHPFADVQTGVSNYVQW-------------
HLDD_PASMU      -------------------------------------
GM4D1_VIBCH     LAKKELGWVPEITLQQMVSEMVASDLEQAQSHA----
GAL10_SCHPO     RANSELKWKAELSITDACRDLWKWTIE----------
FCL_CRIGR       KLRAYL-------------------------------
NSDHL_HUMAN     -------------------------------------
HLDD_HAMD5      KLRTIGYDKPFKPLDEGVTHYLDW-------------
GMDS_DICDI      -------------------------------------
GAE5_ARATH      LAQAELGYKPAVDLETGLKKFVKW-------------
HLDD_VIBF1      -------------------------------------
HLDD_BORA1      -------------------------------------
GMDS_DROME      KANRELNWTPKVTFVELVSDMMKADIELMR-------
HLDD_POLNA      -------------------------------------
HLDD_NEIMA      KLREAGYKEEFFDVKAGIDRYVKWMLE----------
HLDD_VIBFM      -------------------------------------
HLDD_NEIM0      KLREAGYTEEFFDVKSGVERYVKWMLE----------
HLDD_SALPC      NLRNAGYDKPFKTVAEGVTEYMAW-------------
HLDD_SALCH      NLRNAGYDKPFKTVAEGVTEYMAW-------------
GM4D2_VIBCH     KAKQKLGWTPEITVQEMCAEMVMEDLKVAQRHA----
HLDD_SODGM      QLRAAGYTQPFKTVAEGVAEYLRW-------------
HLDD_RALEJ      RLREAGYTAPFVAMEEGVARYCQWLLE----------
HLDD_NEIMB      KLREAGYKEEFFDVKSGVDRYVKWMLE----------
HLDD_NEIMF      KLREAGYKEEFFDVKSGVDRYVKWMLE----------
GM4D_PSEAE      KAQRVLGWKPRTSLDELIRMMV---------------
HLDD_SALG2      NLRNAGYDKPFKTVAEGVTEYMAW-------------
HLDD_SALEP      NLRNAGYDKPFKTVAEGVTEYMAW-------------
HLDD_SALDC      NLRNAGYDKPFKTVAEGVTEYMAW-------------
HLDD_RALPJ      -------------------------------------
HLDD_PSYIN      -------------------------------------
HLDD_PHOLL      KLRAAGYDKPFKTVAEGVTEYMHW-------------
GALE_KLEPN      -------------------------------------
HLDD_PROMH      -------------------------------------
HLDD_HAEIG      KLRSTGYDKPFKTVAEGVAEYMAW-------------
HLDD_HAEI8      KLRSTGYDKPFKTVAEGVTEYMAW-------------
GALE2_ARATH     RAESELNWKAKYGIEEMCRDLWNW-------------
HLDD_HAEIN      KLRSTGYDKPFKTVAEGVTEYMAW-------------
HLDD_BURP8      KLRAAGYDAPFLTVQEGVDRYVRW-------------
HLDD_SALTY      NLRNAGYDKPFKTVAEGVTEYMAW-------------
HLDD_SALTI      NLRNAGYDKPFKTVAEGVTEYMAW-------------
HLDD_SALSV      NLRNAGYDKPFKTVAEGVTEYMAW-------------
HLDD_SALPK      NLRNAGYDKPFKTVAEGVTEYMAW-------------
HLDD_SALPB      NLRNAGYDKPFKTVAEGVTEYMAW-------------
HLDD_SALPA      NLRNAGYDKPFKTVAEGVTEYMAW-------------
HLDD_SALNS      NLRNAGYDKPFKTVAEGVTEYMAW-------------
HLDD_SALHS      NLRNAGYDKPFKTVAEGVTEYMAW-------------
HLDD_SALAR      NLRNAGYDKPFKTVAEGVTEYMAW-------------
HLDD_SALA4      NLRNAGYDKPFKTVAEGVTEYMAW-------------
HLDD_PSEAE      -------------------------------------
HLDD_BURVG      -------------------------------------
HLDD_BURM1      -------------------------------------
HLDD_BURCM      -------------------------------------
HLDD_BURA4      -------------------------------------
TGDS_MIMIV      KIKS-LGWE----------------------------
SPSK_BACSU      -------------------------------------
HLDD_ECOSM      -------------------------------------
FCL_DROME       KLRSFLPDYAFTDLETAINASVKWYIE----------
YFHF_BACSU      -------------------------------------
HLDD_VIBCM      -------------------------------------
HLDD_VIBCH      -------------------------------------
HLDD_VIBC3      -------------------------------------
HLDD_PSEAB      -------------------------------------
HLDD_RALME      -------------------------------------
HLDD_ENTS8      -------------------------------------
Y4AF_RHISN      ERLVSMGWRPKTSLELGL-------------------
HLDD_SHISS      -------------------------------------
HLDD_SHIFL      -------------------------------------
HLDD_SHIF8      -------------------------------------
HLDD_SHIDS      -------------------------------------
HLDD_SHIBS      -------------------------------------
HLDD_SHIB3      -------------------------------------
HLDD_RALSO      -------------------------------------
HLDD_MANSM      -------------------------------------
HLDD_KLEP7      NLRKAGYDKPFKTVAEGVTEYMAW-------------
HLDD_KLEP3      NLRKAGYDKPFKTVAEGVTEYMAW-------------
HLDD_ESCF3      -------------------------------------
HLDD_ECOUT      -------------------------------------
HLDD_ECOSE      -------------------------------------
HLDD_ECOLU      -------------------------------------
HLDD_ECOLI      -------------------------------------
HLDD_ECOL6      -------------------------------------
HLDD_ECOL5      -------------------------------------
HLDD_ECOK1      -------------------------------------
HLDD_ECODH      -------------------------------------
HLDD_ECOBW      -------------------------------------
HLDD_ECO8A      -------------------------------------
HLDD_ECO81      -------------------------------------
HLDD_ECO7I      -------------------------------------
HLDD_ECO5E      -------------------------------------
HLDD_ECO57      -------------------------------------
HLDD_ECO55      -------------------------------------
HLDD_ECO45      -------------------------------------
HLDD_ECO27      -------------------------------------
HLDD_ECO24      -------------------------------------
HLDD_BURS3      -------------------------------------
HLDD_BURCH      -------------------------------------
HLDD_BURCC      -------------------------------------
HLDD_BURCA      -------------------------------------
GMD2_CAEEL      KARKTLGWEPKITVPELVKEMV---------------
YGAE_ERWAM      -------------------------------------
HLDD_ENT38      -------------------------------------
HLDD_CITK8      -------------------------------------
HLDD_BURCJ      -------------------------------------
HLDD_YERE8      NLRAAGYDKPFKTVAEGVKEYLTW-------------
HLDD_KLEPN      NLRKAGYDKPFKTVAEGVTEYMAW-------------
GALE_MYCPN      KAKRLLNFQP---------------------------
HLDD_YERPY      KLRAAGYGKPFKTVAEGVKEYLAW-------------
HLDD_YERPS      KLRAAGYGKPFKTVAEGVKEYLAW-------------
HLDD_YERPP      KLRAAGYGKPFKTVAEGVKEYLAW-------------
HLDD_YERPN      KLRAAGYGKPFKTVAEGVKEYLAW-------------
HLDD_YERPG      KLRAAGYGKPFKTVAEGVKEYLAW-------------
HLDD_YERPE      KLRAAGYGKPFKTVAEGVKEYLAW-------------
HLDD_YERPB      KLRAAGYGKPFKTVAEGVKEYLAW-------------
HLDD_YERPA      KLRAAGYGKPFKTVAEGVKEYLAW-------------
HLDD_YERP3      KLRAAGYGKPFKTVAEGVKEYLAW-------------
HLDD_RHILO      RLRAAGYNGQFRTVETGVRDYVEW-LKAQRS------
Y2119_STAHJ     -------------------------------------
HLDD_HAEDU      -------------------------------------
HLDD_ECOLC      -------------------------------------
HLDD_ECOHS      -------------------------------------
Y4NG_RHISN      KAQKELGYAPRYSNSQMMIETYNW-------------
YFCH_ECOLI      -------------------------------------
Y1061_METJA     -------------------------------------
HLDD_FUSNN      KLREIGYTKEMHSLEEGVKDYVQNYLAKEDSY-----
Y1223_SYNY3     -------------------------------------
GAL10_CANMA     -------------------------------------
HLDD_PECCP      -------------------------------------
Y2567_STAAR     -------------------------------------
STRL_STRGR      -------------------------------------
Y2778_STAA8     -------------------------------------
Y2488_STAAC     -------------------------------------
Y2422_STAA3     -------------------------------------
HLDD_BURPP      KLRAAGYDAPFLSVQEGVDRYVRW-------------
D39U1_BOVIN     -------------------------------------
YQJ9_SCHPO      -------------------------------------
YL056_YEAST     -------------------------------------
Y2478_STAAM     -------------------------------------
Y2266_STAAN     -------------------------------------
Y1014_HAEIN     -------------------------------------
YGI2_SCHPO      -------------------------------------
RCP_VIBCH       -------------------------------------
Y2403_STAAW     -------------------------------------
Y2370_STAAS     -------------------------------------
Y2073_MYCBO     -------------------------------------
Y2047_MYCTU     -------------------------------------
SQD1_SPIOL      -------------------------------------