[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF53734.1

[Show Plain Result]


## Summary of Sequence Search
    1::157
    2::154     2e-35  46%  160 aa  Y766_HAEIN RecName: Full=Probable tRNA/rRNA methyltransferase
    2::154     4e-35  45%  157 aa  YIBK_ECOLI RecName: Full=Uncharacterized tRNA/rRNA
    2::154     4e-35  45%  157 aa  YIBK_ECOL6 RecName: Full=Uncharacterized tRNA/rRNA
    2::153     9e-24  41%  169 aa  Y934_LISIN RecName: Full=Uncharacterized tRNA/rRNA
    2::153     6e-23  40%  169 aa  Y956_LISMF RecName: Full=Uncharacterized tRNA/rRNA
    3::155     1e-22  41%  157 aa  YGL3_BACST RecName: Full=Uncharacterized tRNA/rRNA
    4::153     1e-18  38%  153 aa  Y992_SYNY3 RecName: Full=Uncharacterized tRNA/rRNA
    1::155     3e-15  32%  166 aa  Y521_MYCPN RecName: Full=Uncharacterized tRNA/rRNA
    6::155     6e-14  30%  166 aa  Y346_MYCGE RecName: Full=Uncharacterized tRNA/rRNA
   30::164     9e-05  28%  229 aa  TRMH_SHIFL RecName: Full=tRNA guanosine-2'-O-methyltransferase;    
   30::164     9e-05  28%  229 aa  TRMH_ECOLI RecName: Full=tRNA guanosine-2'-O-methyltransferase;    
   30::164     9e-05  28%  229 aa  TRMH_ECO57 RecName: Full=tRNA guanosine-2'-O-methyltransferase;    
  191::245     4e-04  38%  248 aa  RLMB_ACIAD RecName: Full=23S rRNA
  217::366     6e-04  27%  384 aa  Y955_SYNY3 RecName: Full=Uncharacterized tRNA/rRNA
  231::285     8e-04  40%  288 aa  Y905_MYCBO RecName: Full=Uncharacterized tRNA/rRNA
  231::285     8e-04  40%  288 aa  Y881_MYCTU RecName: Full=Uncharacterized tRNA/rRNA
    1::157

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPEHPLHVIFDNPVIPPNTGNAIRMCAGTGAHLHLVEPLGFELTEKHLRRAGLDYHDLADVTVHATFDEA
Y766_HAEIN      -----LDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLDYHEFAEIKRHKTFEAF
YIBK_ECOLI      -----LNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDYRAF
YIBK_ECOL6      -----LNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDYRAF
Y934_LISIN      ----PNHIVLYQPEIPANTGNISRTCAGTDTYLHLIRPLGFSTDDKMLKRAGLDYWDNVKLSYYDSLDEF
Y956_LISMF      ----PNHIVLYQPEIPANTGNISRTCAGTDTYLHLIRPLGFSTDDKMLKRAGLDYWDNVKLSYYDSLDEF
YGL3_BACST      -----LHVVLFQPEIPANTGNIARTCAATNTALHLIRPLGFSTDDKMLRRAGLDYWEFVNIHYYDSLDHF
Y992_SYNY3      -------LVLVNPQIPPNTGNIARTCAATGTELHLVGPLGFELGDRYLKRAGLDYWPYVDLHYHNSCEEF
Y521_MYCPN      MYKSAINIVLFCPEIPNNTGNIVRSCTAFKANLHLIKPYGFFLNDKRMVRAGLNCWDKVQMFEHKSWEHF
Y346_MYCGE      -----INIVLFCPEIPNNTGNIVRSCTAFKANLHLIKPYGFFLNDKRMVRAGLNCWDKIQLFEHKSWEHF
TRMH_SHIFL      ---------------PHNVSAIIRTADAVGVHVHAVWP-GSRM--RTMASAAAGSNSWVQVKTHRTIGDA
TRMH_ECOLI      ---------------PHNVSAIIRTADAVGVHVHAVWP-GSRM--RTMASAAAGSNSWVQVKTHRTIGDA
TRMH_ECO57      ---------------PHNVSAIIRTADAVGVHVHAVWP-GSRM--RTMASAAAGSNSWVQVKTHRTIGDA
RLMB_ACIAD      ----------------------------------------------------------------------
Y955_SYNY3      ----PVLIIIDSITDPHNLGAIIRTAEAFGAQ-GMVLPAGITSTVMKVAAGALEHFPVARVVNLSRALET
Y905_MYCBO      ----------------------------------------------------------------------
Y881_MYCTU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MAAVPGRVXXXXXXXXXXXXXXXFEPGDALLFGTEPTGLPQEHVEHSRITSELRIPMLPGRRSMNLSNSA
Y766_HAEIN      LSEKPKRLFALTTKGCPAHSQVKFKLGDYLMFGPETRGIPMSILNEMPMEQKIRIPMTANSRSMNLSNSV
YIBK_ECOLI      LEAEPQRLFALTTKGTPAHSAVSYQDGDYLMFGPETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAV
YIBK_ECOL6      LEAEPQRLFALTTKGTPAHSAVSYQDGDYLMFGPETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAV
Y934_LISIN      FEKNAGYITKFGRHVYSDVDYSDPNKNYFFVFGKETTGLPDELLQANE-ENCLRIPMTDHIRSLNLSNTA
Y956_LISMF      FEKNEGYITKFGRHVYSDIDYSDPNKDYFFVFGKETTGLPDALLQKNE-ENCLRIPMTDHIRSLNLSNTA
YGL3_BACST      FQQQNGDFYYITKFGKRYYTSYDFDPSKEIIFGRETTGLPKELLAENEDRC-LRIPMTENVRALNLSNTA
Y992_SYNY3      ITGQGGNLLGFSVTGTVNFWDYTYQSTDWLMMGSETDGLPQMMRDLS--TQLLCIPMPHSERXXXXXXXX
Y521_MYCPN      IETTPPNIWLLTKSGTTTPDQINMQTDNRFVFGQETKGLPQTLMEQYS-QNQVRIPIWNPVRSINLSNTV
Y346_MYCGE      LQATTENKTIWLLTKSGDKTPDQICMTNKLVFGQETKGLPKTIMDNFK-QNQIRIPIWNSVRSINLANAV
TRMH_SHIFL      VAHLKGQLATHLSDNAVDFREIDYTRPTCILMGQEKTGITQEAL--ALADQDIIIPMIGMVQSLNVSVAS
TRMH_ECOLI      VAHLKGQLATHLSDNAVDFREIDYTRPTCILMGQEKTGITQEAL--ALADQDIIIPMIGMVQSLNVSVAS
TRMH_ECO57      VAHLKGQLATHLSDNAVDFREIDYTRPTCILMGQEKTGITQEAL--ALADQDIIIPMIGMVQSLNVSVAS
RLMB_ACIAD      -----------------------FSGNVAIVMGAEDTGL--RPITQSQCDQTVYIPMSGNLQSLNVSVAA
Y955_SYNY3      LKESGFWIYGTVAGKQTALHQADLREPMGLVIGSEGEGLSQKHCDHL-----ITIPLAGKTPSLNASVAA
Y905_MYCBO      ----------------------------ALLVGAEGPGLTAAALRISDV--RVRIPMSRGTDSLNVATAA
Y881_MYCTU      ----------------------------ALLVGAEGPGLTAAALRISDV--RVRIPMSRGTDSLNVATAA


                         +         .         .         .         .         *         .:210
query           AVATYEAWRQLGFVGGV
Y766_HAEIN      AVTVYEAWRQLGYKGAV
YIBK_ECOLI      SVVVYEAWRQLGYPGAV
YIBK_ECOL6      SVVVYEAWRQLGYPGAV
Y934_LISIN      AVLAYEALRQQSF----
Y956_LISMF      AILAYEALRQQNF----
YGL3_BACST      AILVYEALRQQSFHG--
Y992_SYNY3      XXXXFEAGRQLRSLG--
Y521_MYCPN      ACVLYEYAKQ-------
Y346_MYCGE      VCILYEYSKQ-------
TRMH_SHIFL      ALILYEAQRQ-------
TRMH_ECOLI      ALILYEAQRQ-------
TRMH_ECO57      ALILYEAQRQ-------
RLMB_ACIAD      GMALYEACRQ-------
Y955_SYNY3      AISLYEIFRQRGF----
Y905_MYCBO      ALAFYERTRSGHHIG--
Y881_MYCTU      ALAFYERTRSGHHIG--