[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF53786.1

[Show Plain Result]


## Summary of Sequence Search
    1::498
    1::498       0.0  99%  498 aa  PRPD1_CORGL RecName: Full=2-methylcitrate dehydratase 1;       
    4::489       0.0  72%  504 aa  PRPD2_CORGL RecName: Full=2-methylcitrate dehydratase 2;       
   73::427     2e-20  30%  483 aa  PRPD_ECO57 RecName: Full=2-methylcitrate dehydratase;       
   73::427     4e-20  30%  483 aa  PRPD_ECOLI RecName: Full=2-methylcitrate dehydratase;       
   73::460     8e-20  28%  483 aa  PRPD_SALTY RecName: Full=2-methylcitrate dehydratase;       
   98::467     1e-19  29%  516 aa  PRPD_YEAST RecName: Full=Probable 2-methylcitrate dehydratase;     
   73::460     1e-19  28%  483 aa  PRPD_SALTI RecName: Full=2-methylcitrate dehydratase;       
   65::427     7e-19  30%  472 aa  PRPD_BACSU RecName: Full=2-methylcitrate dehydratase;       
   72::429     3e-12  29%  492 aa  PRPD_DICDI RecName: Full=Probable 2-methylcitrate dehydratase;     
   78::444     2e-10  28%  488 aa  IRG1_MOUSE RecName: Full=Immune-responsive gene 1 protein;
   78::444     5e-10  28%  481 aa  IRG1_HUMAN RecName: Full=Immune-responsive gene 1 protein homolog;
    1::498

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRIHDVYTHLSADNFPKAEHLAWKISELATDPVEVTPDVSEMIINRIIDNAAVSAASVLRRPVTVARQQA
PRPD1_CORGL     MRIHDVYTHLSADNFPKAEHLAWKFSELATDPVEVTPDVSEMIINRIIDNAAVSAASVLRRPVTVARQQA
PRPD2_CORGL     ---HEVRTHRSAEEFPYEEHLAHKIARVAADPVEVAADTQEMIINRIIDNASVQAASVLRRPVSSARAMA
PRPD_ECO57      ----------------------------------------------------------------------
PRPD_ECOLI      ----------------------------------------------------------------------
PRPD_SALTY      ----------------------------------------------------------------------
PRPD_YEAST      ----------------------------------------------------------------------
PRPD_SALTI      ----------------------------------------------------------------------
PRPD_BACSU      ----------------------------------------------------------------------
PRPD_DICDI      ----------------------------------------------------------------------
IRG1_MOUSE      ----------------------------------------------------------------------
IRG1_HUMAN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QSHPREKGGKVFGISGSYSPEWAAFANGVAVRELDFHDTFLAAEYSHPGDNIPPLLAVAQAQRSSGRDLI
PRPD1_CORGL     QSHPREKGGKVFGISGSYSPEWAAFANGVAVRELDFHDTFLAAEYSHPGDNIPPLLAVAQAQRSSGRDLI
PRPD2_CORGL     QVRPVTRGASVFGLPGRYAAEWAALANGTAVRELDFHDTFLAAEYSHPGDNIPPILXXXXXXXXXXXDLI
PRPD_ECO57      -------GVRVPGTQFQLDPVQAAFNIGAMIRWLDFNDTWLAAEWGHPSDNLGGILATARNAVASGKQVL
PRPD_ECOLI      -------GVRVPGTQFQLDPVQAAFNIGAMIRWLDFNDTWLAAEWGHPSDNLGGILATARNAVASGKQVL
PRPD_SALTY      -------GARVPGTQFQLDPVQAAFNIGAMIRWLDFNDTWLAAEWGHPSDNLGGILATADWLSRNAKQVL
PRPD_YEAST      -------GTKILGTSYVMDPVKGAFAIGTLIRWLDYNDCWLAAEWGHPSDNLGGILAVANGKQFLVKDVL
PRPD_SALTI      -------GARVPGTQFQLDPVQAAFNISAMIRWLDFNDTWLAAEWGHPSDNLGGILATADWLSRNAKQVL
PRPD_BACSU      -------GSKVPGTSYVLDPVRAAFNIGCMIRWLDYNDTWLAAEWGHPSDNLGGILAVSRVRLSEGRDVL
PRPD_DICDI      -------GCRVPGTDYQLNPIEAAFNIGCMNRWLDFNDCWLANEWGHPSDNXXXXXXXXXXXXNDNKDIL
IRG1_MOUSE      -------------------PTYAAFVNGVAVHSMDFDDTWHPA--THPSGAVLPVLALPQIPKFSGLDLL
IRG1_HUMAN      -------------------PTYAAFVNGVAIHSMDFDDTWHPA--THPSGAVLPVLALPRSPKFSGLDLL


                         +         .         .         .         .         *         .:210
query           RGIATAYEVQVELVKGICLHEHKIDHVAHLGPSAAAGLGTLLHVDEETIYQAIGQALHTTTATRQSRKGE
PRPD1_CORGL     RGIATAYEVQVELVRGICLHEHKIDHVAHLGPSAAAGLGTLLHVDEETIYQAIGQALHTTTATRQSRKGE
PRPD2_CORGL     RGIATGYEIQVNLVRGMCLHEHKIDHVAHLGPSAAAGIGTLLDLDVDTIYQAIGQALHTTTATRQSRKGA
PRPD_ECO57      TGMIKAHEIQGCIALENSFNRVGLDHVLLVKVASTAVVAEMLGLTREEILNAVSLAWVDGQSLRTYRHAN
PRPD_ECOLI      TAMIKAHEIQGCIALENSFNRVGLDHVLLVKVASTAVVAEMLGLTREEILNAVSLAWVDGQSLRTYRHAN
PRPD_SALTY      SGMIKAHEIQGCIALENAFNRVGLDHVLLVKVASTAVVAEMLGLTRDEILNAVSLAWVDGQSLRTYRHAN
PRPD_YEAST      EAMIKAHEIQGIIALENSFNKVGLDHXXXXXXXXXXXXSKMLGLSQEQTIEALSQAFVDGQSLRTYR---
PRPD_SALTI      SGMIKAHEIQGCIALENAFNRVGLDHVLLVKVASTAVVAEMLGLTRDEILNAVSLAWVDGQSLRTYRHAN
PRPD_BACSU      EMMIKAHEIQGVLALENSLNRVGLDHVLFXXXXXXXXXXXXXXXXREEIKNALSNAWIDNAALRTYRHSN
PRPD_DICDI      CAMVKCYEIQGVLALDNSFNKIGLDHVILVKIASTAVTCHLLGGSRIQILNALSNAFIDGHPLRTYRHSN
IRG1_MOUSE      LAFNVGIEVQGRLMKDIPKRFHPPSVVGTLGSAAAASLGLSLTKCREALAIAVSHAAPIANAATQTKPLH
IRG1_HUMAN      LAFNVGIEVQGRLLNDMPKRFHPPSVVGTLGSAAAASLGLSSTKCREALAIAVSHAAPMANAATQTKPLH


                         .         .         .         +         .         .         .:280
query           ISSWKAFAPAFAGKMAIEAMDRAMRGEGSPAPIWEGEDGVIAWLLSGKDHVYHVPLPEHGEPKLGILETY
PRPD1_CORGL     ISSWKAFAPAFAGKMAIEAMDRAMRGEGSPAPIWEGEDGVIAWLLSGKDHVYHVPLPEHGEPKLGILETY
PRPD2_CORGL     ISSWKAFAPAFAGKMSIEAVDRAMRGEGAPSPIWEGEDGVIAWLLSGLDHIYTIPLPAEGEAKRAILDTY
PRPD_ECO57      TGTRKSWAAGDATSRAVRLALMAKTGEGYPAPVWGFYD------VSFKGESFRFQRPYGSYVMENVL--F
PRPD_ECOLI      TGTRKSWAAGDATSRAVRLALMAKTGEGYPAPVWGFYD------VSFKGESFRFQRPYGSYVMENVL--F
PRPD_SALTY      TGTRKSWAAGDATSRAVRLALMAKTGEGYPSALTAKTWGFYDVSFKGETFRFQRPYGSY------VMENF
PRPD_YEAST      ------HAPNTGSRKSWAAGDAVSRAVNLAYLVKNANVGTIPSVLTARTWGFYDVLFK-GKPQRSKYDSY
PRPD_SALTI      TGTRKSWAAGDATSRAVRLALMAKTGEGYPSALTAKTWGFYDVSFKGETFRFQRPYGSY------VMENF
PRPD_BACSU      TGSRKSWAAGDATSRGVHLALMSLKGEGYPAPGWGFQD----VLFNKKEIKLARPLDAYVMENVLFKVSY
PRPD_DICDI      TGSRKGWAAGDAASRAVQLSLMAMAGEGYPAPKW------------GFYHVYMSDKPFQFNQRSN-YSTY
IRG1_MOUSE      IGN--------AAKHGMEATFLAMLGLQGNKQILDLGSGFGAFLPSLDSHIWLLDQQDVA------FKSF
IRG1_HUMAN      IGN--------AAKHGIEAAFLAMLGLQGNKQVLDLEAGFGAFYANYSPKV--LPSIASYSWLLDQQDVA


                         .         *         .         .         .         .         +:350
query           TKEHSAEYQSQAPIDLARRMKPLVDAAGGTEHIAEIVLRTSHHTHYVIGTGANDPQKMDPQASRETLDHS
PRPD1_CORGL     TKEHSAEYQSQAPIDLARRMKPLVDAAGGTEHIAEIVLRTSHHTHYVIGTGANDPQKMDPQASRETLDHS
PRPD2_CORGL     TKEHSAEYQSQAPIDLARSMGEKLAAQGDLRDVDSIVLHTSHHTHYVIGTGSNDPQKFDPDASRETLDHS
PRPD_ECO57      KISFPAEFHSQTAVEAAMTLYEQMQAAGKTADIEKVSIRTHEACIRII-------DKKGPLNNPADRDHC
PRPD_ECOLI      KISFPAEFHSQTAVEAAMTLYEQMQAAGKTADIEKVTIRTHEACIRII-------DKKGPLNNPADRDHC
PRPD_SALTY      KISFPAEFHSQTAVEAAMTLYEQMQAAGKTADIEKVTIRTHEACLRII-------DKKGPLNNPADRDHC
PRPD_YEAST      VMENPAEFHAQTAVEAAVKAYRILAKQGKTKDIKSIRIRTQEAAMRII-------DKSGPLYNYADRDHC
PRPD_SALTI      KISFPAEFHSQTAVEAAMTLYEQMQAAGKTADIEKVTIRTHEACLRII-------DKKGPLNNPADRDHC
PRPD_BACSU      PAEFHAQTAAESAVILHPQVKNRID------EIDRVVIRTHESAIRII-------DKKGPLHNPADRDHC
PRPD_DICDI      VMEYPAEFHGQTAIECAIQLHPIFQDKGGLNSVESITIETTEPAIRII-------DKRGILRNPSDRDHC
IRG1_MOUSE      PXXXXXXXXXXXXXXXRKHLVTPERALFPADHIERIVLRIP-DVQYV--------NRPFPDSEHEA-RHS
IRG1_HUMAN      FKRFPAHLSTHWVADAAASVRKHLVAERATDYIKRIVLRIP-NVQYV-----NRPFPVSEHEAR----HS


                         .         .         .         .         *         .         .:420
query           IMYIFAVALQDGVWHHEFSYTRKRSTRPETVELWHKIRTVEDPEWTRRYHSDDPAKKAFGAKAVITMADG
PRPD1_CORGL     IMYIFAVALQDGVWHHEFSYTRKRSTRPETVELWHKIRTVEDPEWTRRYHSDDPAKKAFGAKAVITMADG
PRPD2_CORGL     IMYIFAVALEDRAWHHERSYAPERAHRRETIELWNKISTVEDPEWTRRYHSVDPAEKAFGARAVITFKDG
PRPD_ECO57      IQYMVAIPLLFGLTAADYEDNVAQDKRIDA--LREKINCFEDPVFTADYH--DPEKRAIANAITLEFTDG
PRPD_ECOLI      IQYMVAIPLLFGLTAADYEDNVAQDKRIDA--LREKINCFEDPAFTADYH--DPEKRAIANAITLEFTDG
PRPD_SALTY      IQYMVAVPLLFGRL-TAADYEDEVAQDKRIDALREKIVCYEDPAFTADYH--DPEKRAIGNAITVEFTDG
PRPD_YEAST      IQYMIAVPLITGNL-TATDYSDEVARNPEIDNLRSKMYCIEDTHLTQNYH--DPDKRSIGNALLIELNDG
PRPD_SALTI      IQYMVAVPLLFGRL-TAADYEDEVAQDKRIDALREKIVCYEDPAFTADYH--DPEKRAIGNAITVEFTDG
PRPD_BACSU      LQYITAIGLLFGDITAQ-HYEAETANDPRIDKLRDKMEVTENKTYTEDYLK--PDKRSISNAVQVHFKDG
PRPD_DICDI      LQFIVSVALIFGELHYEDQVAIK-DTRIDL--LREKITCIENLQFSLDYL--NPDKRSIANSITILFKDG
IRG1_MOUSE      FQYVACASLLDGSITVP-SFHSQQVNRPQVRELLKKVKLEHPPD-------NPPSFDTLYCEISITLKDG
IRG1_HUMAN      FQYVACAMLLDGGITVP-SFHECQINRPQVRELLSKVELEYPPD-------NLPSFNILYCEISVTLKDG


                         .         .         +         .         .         .         .:490
query           TLIEDELAVADAHPLGARPFARENYIEKFRTLAQGIVIDSEQERFLHAVQSXXXXXXXXXXNIEVDISNQ
PRPD1_CORGL     TVIEDELAVADAHPLGARPFARENYIEKFRTLAQGIVIDSEQERFLHAVQSXXXXXXXXXXNIEVDISNQ
PRPD2_CORGL     TVVEDELAVADAHPLGARPFAREQYIQKFRTLAEGVVSEKEQDRFLDAAQRTHELEDLSELNIELD----
PRPD_ECO57      TRFEE---VVVEYPIG------------------------------------------------------
PRPD_ECOLI      TRFEE---VVVEYPIG------------------------------------------------------
PRPD_SALTY      SRFGE---VVVEYPIGRRADGIPKLIEKFKINLARQFPTRQQQRIL------------------------
PRPD_YEAST      TQL-DEIFV--EYPVGHK-FRREEGI--------------------------------------------
PRPD_SALTI      SRFGE---VVVEYPIGRRADGIPKLIEKFKINLARQFLTRQQQRIL------------------------
PRPD_BACSU      TSTE---MVECEFPLGHR-FRREEAVPK------------------------------------------
PRPD_DICDI      ETHKHQI----DYPIGHR----------------------------------------------------
IRG1_MOUSE      TTFTERSDTFYGH--WRKPLSQEDLRNKFRANASKMLCRDTVESLITVVE--------------------
IRG1_HUMAN      ATFTDRSDTFYGH--WRKPLSQEDLEEKFRANASKMLSWDTVESLIKIVKN-------------------


                         *         .         .         .         .         +         .:560
query           AATKAGLL
PRPD1_CORGL     AATKAGLL
PRPD2_CORGL     --------
PRPD_ECO57      --------
PRPD_ECOLI      --------
PRPD_SALTY      --------
PRPD_YEAST      --------
PRPD_SALTI      --------
PRPD_BACSU      --------
PRPD_DICDI      --------
IRG1_MOUSE      --------
IRG1_HUMAN      --------