[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF53909.1

[Show Plain Result]


## Summary of Sequence Search
    1::175
   33::147     1e-06  32%  162 aa  Y899_MYCBO RecName: Full=Uncharacterized protein Mb0899c;Flags:
   33::147     1e-06  32%  162 aa  Y875_MYCTU RecName: Full=Uncharacterized protein
    1::175

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPQEISISASSPAGEIEVFPFSMCEPGVE
Y899_MYCBO      ------------------------------------------PQQPEISAYSHGHLTRVGPYLYCNV-VD
Y875_MYCTU      ------------------------------------------PQQPEISAYSHGHLTRVGPYLYCNV-VD


                         .         .         *         .         .         .         .:140
query           CEENEVPTLEVGADEELHLTIPEAIHDHDWYLLTIYDDPAANDEFYHTSYDATEATVPGSVDPTEEGAER
Y899_MYCBO      LDDCQTPQLPVSERYPVQLSVPEVISRAPWRLLQVYQDPANTTSTLFRPDTRLAVTIP-TVDP-----QR
Y875_MYCTU      LDDCQTPQLPVSERYPVQLSVPEVISRAPWRLLQVYQDPANTTSTLFRPDTRLAVTIP-TVDP-----QR


                         +         .         .         .         .         *         .:210
query           PRLVVVEVSAVMIGEDENGExxxxxxxxxxxxxxx
Y899_MYCBO      GRLTGIVVQLLTLVVDHSGE---------------
Y875_MYCTU      GRLTGIVVQLLTLVVDHSGE---------------