[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF53930.1

[Show Plain Result]


## Summary of Sequence Search
    1::142
  272::333     9e-04  30%  475 aa  FB35_ARATH RecName: Full=Putative F-box protein At1g46840;
    1::142

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxLTACGANDELSSYLTSIETATAQVSLNDIYNDQWSEFAVVCPYTPSDYAKAEL
FB35_ARATH      -----------------VTLINYRGKLGVYLVVYGSPRGEVVLDDTKNDNWSKHNFVCPYSGQENSTWAT


                         .         .         *         .         .         .         .:140
query           DVGDTPWPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FB35_ARATH      GTGELVWP--------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xx
FB35_ARATH      --