[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF53991.1

[Show Plain Result]


## Summary of Sequence Search
    1::160
  394::529     6e-09  29%  695 aa  DIPZ_MYCTU RecName: Full=Protein dipZ;
  394::529     6e-09  29%  695 aa  DIPZ_MYCBO RecName: Full=Protein dipZ;
   57::158     3e-08  32%  173 aa  RESA_BACCR RecName: Full=Thiol-disulfide oxidoreductase resA;
   57::158     3e-08  32%  173 aa  RESA_BACAN RecName: Full=Thiol-disulfide oxidoreductase resA;
   57::158     3e-08  32%  173 aa  RESA_BACAH RecName: Full=Thiol-disulfide oxidoreductase resA;
   57::158     2e-06  30%  173 aa  RESA_BACCZ RecName: Full=Thiol-disulfide oxidoreductase resA;
   57::153     4e-06  30%  173 aa  RESA_BACHK RecName: Full=Thiol-disulfide oxidoreductase resA;
   57::153     4e-06  30%  173 aa  RESA_BACC1 RecName: Full=Thiol-disulfide oxidoreductase resA;
   46::158     5e-06  28%  176 aa  RESA_BACHD RecName: Full=Thiol-disulfide oxidoreductase resA;
   50::143     6e-06  33%  727 aa  NHLC2_CHICK RecName: Full=NHL repeat-containing protein 2;
   62::148     1e-05  36%  725 aa  NHLC2_MOUSE RecName: Full=NHL repeat-containing protein 2;
    3::70      3e-05  36%  221 aa  FIXW_RHILE RecName: Full=Protein fixW;
   62::148     4e-05  33%  726 aa  NHLC2_HUMAN RecName: Full=NHL repeat-containing protein 2;
   62::148     5e-05  31%  726 aa  NHLC2_BOVIN RecName: Full=NHL repeat-containing protein 2;
   59::158     7e-05  25%  174 aa  RESA_GEOKA RecName: Full=Thiol-disulfide oxidoreductase resA;
   63::163     2e-04  29%  177 aa  RESA_BACSK RecName: Full=Probable thiol-disulfide oxidoreductase
   52::152     3e-04  24%  165 aa  STOA_BACSU RecName: Full=Sporulation thiol-disulfide oxidoreductase
   59::158     3e-04  24%  174 aa  RESA_GEOTN RecName: Full=Thiol-disulfide oxidoreductase resA;
   53::160     3e-04  31%  165 aa  DSBE_CHRVI RecName: Full=Thiol:disulfide interchange protein
    1::160

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSSLDNAPLLELDVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGL
DIPZ_MYCTU      LESCGTAPDLK-GITGWLNTPGIDLKSLRGKVVLIDFWAYSCINC-QRAIPHVVGWYQAYKDSGLAVIGV
DIPZ_MYCBO      LESCGTAPDLK-GITGWLNTPGIDLKSLRGKVVLIDFWAYSCINC-QRAIPHVVGWYQAYKDSGLAVIGV
RESA_BACCR      -------------------------KDLKGKGVFLNFWGTWCKPCEKE-MPYMNELYPKYKEKGVEIIAL
RESA_BACAN      -------------------------KDLKGKGVFLNFWGTWCKPCEKE-MPYMNELYPKYKEKGVEIIAL
RESA_BACAH      -------------------------KDLKGKGVFLNFWGTWCKPCEKE-MPYMNELYPKYKEKGVEIIAL
RESA_BACCZ      -------------------------KDLKGKGVFLNFWGTWCKPCEKE-MPYMNELYPKYKEKGVEIIAL
RESA_BACHK      -------------------------KDFKGKGVFLNFWGTWCKPCEKE-MPYMNELYPKYKEKGVEIIAL
RESA_BACC1      -------------------------KDFKGKGVFLNFWGTWCKPCEKE-MPYMNELYPKYKEKGVEIIAL
RESA_BACHD      -------------VLEDLEGESIELRELEGKGVFLNFWGTYCPPCERE-MPHMEKLYGEYKEQGVEIIAV
NHLC2_CHICK     -------PELSRDLQ-WLNTEGSLHKDLCGKVVVLDFFTYCCINCXXXXXXXXXXXXQYSDKDGLVIIGV
NHLC2_MOUSE     ---------------EWLNEEPLSYKDLCGKVVVLDFFTYCCINCI-HVLPDLHALERRFDKDGLLIVGV
FIXW_RHILE      -SSLNGSPAPPIKVQNWLRGDPLSNFQL-GKIYVVEFFSIYCGYCAPE-LSDLAKLHKKFIDTRVEFIGI
NHLC2_HUMAN     ---------------EWLNTEEPISKDLCGKIVVLDFFTYCCINCI-HLLPDLHALHTYSDKDGLLIIGV
NHLC2_BOVIN     ---------------EWLNTEEPISKDLCGKVVILDFFTYCCINCI-HLLPDLHALHTYSDKDGLLIVGV
RESA_GEOKA      --------------------------DYRGKGVFLNFWGTWCKPCERE-MPYMNELYPIYKKQGVEILAV
RESA_BACSK      ----------------------------QGKGVFINFWGTFCEPCERE-MPYIENAYEQYKD-EVEMIAV
STOA_BACSU      ----------------------------KGQKTILHFWTSWCPPCKKE-LPQFQSFYDAHPSDSVKLVTV
RESA_GEOTN      --------------------------DYRGKGVFLNFWGTWCKPCERE-MPYMNELYPIYQKQGVEILAV
DSBE_CHRVI      -------------------NQTLTRDILIGQVSLVNVWASWCPSCRQ----EHAELMRIAREHGVRVIG-


                         .         .         *         .         .         .         .:140
query           HSVFEHHDVMTPEALKVFISEFGIKFPVAVDMPREGQRIPSTMKKYRLEGTPSIILADRKGRIRQVQFGQ
DIPZ_MYCTU      HTP-EYAFEKVPGNVAKGAANLGISYPIALDNNY------ATWTNYRNRYWPAEYLIDATGTVRHIKFGE
DIPZ_MYCBO      HTP-EYAFEKVPGNVAKGAANLGISYPIALDNNY------ATWTNYRNRYWPAEYLIDATGTVRHIKFGE
RESA_BACCR      DA--DETDI----AVKNFVNQYGLKFPVAID---KGQKIIGT---YGVGPLPTSFLIDKDGKVVEQIIGE
RESA_BACAN      DA--DETDI----AVKNFVNQYGLKFPVAID---KGQKIIGT---YGVGPLPTSFLIDKDGKVVEQIIGE
RESA_BACAH      DA--DETDI----AVKNFVNQYGLKFPVAID---KGQKIIGT---YGVGPLPTSFLIDKDGKVVEQIIGE
RESA_BACCZ      DAD------ETEIAVKNFVKQYDLKFPVAID---KGTKIIGT---YSVGPLPTSFLIDKDGKVVEKIIGE
RESA_BACHK      DA--DETDI----AVKNFVKQYDLKFPVAIDKGGE------IIKTYGVIPLPTSFLIDKDGKVIQ-----
RESA_BACC1      DA--DETDI----AVKNFVKQYDLKFPVAIDKGGE------IIKTYGVIPLPTSFLIDKDGKVIQ-----
RESA_BACHD      NA-------NEPETVQRFVDRYGLSFPIVID---KGLNV---IDAYGIRPLPTTILINEHGEIVKVHTG-
NHLC2_CHICK     HSAFPNEKVL--DSIKSAVLRYNIVHPVVND---------------------------------------
NHLC2_MOUSE     HSAFPNEKVL--DNIKSAVLRYNITHPVVND---------------------------------------
FIXW_RHILE      ----------------------------------------------------------------------
NHLC2_HUMAN     HSAFPNEKVL--DNIKSAVLRYNITHPMVND---------------------------------------
NHLC2_BOVIN     HSAFPNEKVL--DNIRSAVLRYNITHPVVND---------------------------------------
RESA_GEOKA      N-------VGEPKSVEKFAERFGLTFPIVID------RQDQVLNAYNVGPLPTTFLIDKNGEVKQIITG-
RESA_BACSK      N-VDE-----APLTVQSFINRHGLTFPVAIDERRE------VTRAYGIGPLPATILVDEHGIVQKVHTGA
STOA_BACSU      NLV---NSEQNQQVVEDFIKANKLTFPIVLDSKGE------LMKEYHIITIPTSFLLNEKGEIEKTKIG-
RESA_GEOTN      N-------VGEPKLVEKFAERFGLTFPIVID------RQDQVLNAYGVGPLPTTFLIDKNGKVKKIITG-
DSBE_CHRVI      ---FNWKDT-RPEAL-ALLQRYGDPYTVSLYDPDNKAGI-----DWGVYGAPETFIVDAEGIIRHKRVGP


                         +         .         .         .         .         *         .:210
query           VDDxxxxxxxxxxxxxxxxx
DIPZ_MYCTU      GD------------------
DIPZ_MYCBO      GD------------------
RESA_BACCR      --------------------
RESA_BACAN      --------------------
RESA_BACAH      --------------------
RESA_BACCZ      --------------------
RESA_BACHK      --------------------
RESA_BACC1      --------------------
RESA_BACHD      --------------------
NHLC2_CHICK     --------------------
NHLC2_MOUSE     --------------------
FIXW_RHILE      --------------------
NHLC2_HUMAN     --------------------
NHLC2_BOVIN     --------------------
RESA_GEOKA      --------------------
RESA_BACSK      MTE-----------------
STOA_BACSU      --------------------
RESA_GEOTN      --------------------
DSBE_CHRVI      ID------------------