[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF54079.1

[Show Plain Result]


## Summary of Sequence Search
    1::188
   13::147     3e-24  44%  200 aa  FMNR_SCHPO RecName: Full=NAD(P)H-dependent FMN reductase C4B3.06c; 
    2::145     1e-16  37%  191 aa  LOT6_YEAST RecName: Full=NAD(P)H-dependent FMN reductase LOT6;     
    8::146     4e-09  33%  194 aa  NQR_SOLTU RecName: Full=NAD(P)H:quinone oxidoreductase;       
    6::134     2e-08  37%  188 aa  YIEF_SHIFL RecName: Full=Uncharacterized protein yieF;
    6::134     2e-08  37%  188 aa  YIEF_ECOLI RecName: Full=Uncharacterized protein yieF;
    6::134     2e-08  37%  188 aa  YIEF_ECO57 RecName: Full=Uncharacterized protein yieF;
   12::150     1e-06  31%  196 aa  NQR_ARATH RecName: Full=NADPH:quinone oxidoreductase;       
   48::179     3e-05  30%  197 aa  NQR1_ORYSJ RecName: Full=Probable NADPH:quinone oxidoreductase 1;  
   11::104     4e-05  32%  203 aa  NQR2_ORYSJ RecName: Full=Probable NADPH:quinone oxidoreductase 2;  
   32::170     6e-05  24%  208 aa  AZOR_STAAB RecName: Full=FMN-dependent NADH-azoreductase;       
   75::176     1e-04  36%  345 aa  MTNA_DESHY RecName: Full=Methylthioribose-1-phosphate isomerase;   
   75::176     1e-04  36%  345 aa  MTNA_DESHD RecName: Full=Methylthioribose-1-phosphate isomerase;   
   32::170     2e-04  24%  208 aa  AZOR_STAAW RecName: Full=FMN-dependent NADH-azoreductase;       
   32::170     2e-04  24%  208 aa  AZOR_STAAT RecName: Full=FMN-dependent NADH-azoreductase;       
   32::170     2e-04  24%  208 aa  AZOR_STAAS RecName: Full=FMN-dependent NADH-azoreductase;       
   32::170     2e-04  24%  208 aa  AZOR_STAAN RecName: Full=FMN-dependent NADH-azoreductase;       
   32::170     2e-04  24%  208 aa  AZOR_STAAC RecName: Full=FMN-dependent NADH-azoreductase;       
   32::170     2e-04  24%  208 aa  AZOR_STAA9 RecName: Full=FMN-dependent NADH-azoreductase;       
   32::170     2e-04  24%  208 aa  AZOR_STAA8 RecName: Full=FMN-dependent NADH-azoreductase;       
   32::170     2e-04  24%  208 aa  AZOR_STAA3 RecName: Full=FMN-dependent NADH-azoreductase;       
   32::170     2e-04  24%  208 aa  AZOR_STAA2 RecName: Full=FMN-dependent NADH-azoreductase;       
   32::170     4e-04  24%  208 aa  AZOR_STAAM RecName: Full=FMN-dependent NADH-azoreductase;       
   32::170     4e-04  24%  208 aa  AZOR_STAA1 RecName: Full=FMN-dependent NADH-azoreductase;       
    1::188

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSKIAIITGSTRPGRVNIDVANWVLERAQERNDAQYELVDIADFNFPVLDEAMPAGYGQYANEHTKAWAA
FMNR_SCHPO      --KILVIMGSVRSKRLCPTIATWVGEMGKRETNFDYEKVDLTDWPLSMSDEGLPIGIDVYTQEHTKAWGS
LOT6_YEAST      --KVGIIMGSVRAKRVCPEIAAYVIENSEELIDQKLKIVDLQQIALPLYDELIPASVDEYADSKTRSWSR
NQR_SOLTU       --KVAGLCGSLRKGSYNRGLLNAAMEICKDSTGMEIEYVDISPLPFLNTDLEVNGTYPPVV----EAFRK
YIEF_SHIFL      --QVVTLLGSLRKGSFNGMVARTLPKIAPASMEVN-ALPSIADI--PLYDADVQQEEGFPAT--VEALAE
YIEF_ECOLI      --QVVTLLGSLRKGSFNGMVARTLPKIAPASMEVN-ALPSIADI--PLYDADVQQEEGFPAT--VEALAE
YIEF_ECO57      --QVVTLLGSLRKGSFNGMVARTLPKIAPASMEVN-ALPSIADI--PLYDADVQQEEGFPAT--VEALAE
NQR_ARATH       --RVAALSGSLRKTSFHTGLLRAAIDLTKESVPGQIEYIDISPL--PLINTDLEVN-GTYPPV-VEAFRQ
NQR1_ORYSJ      --------------------------------------VDIS--GLPLLNTDLETADGGFPPA-VEAFRD
NQR2_ORYSJ      --RVAAISGSLRRGSANTGLIRAAKEICEESIPGMVDHVDIPDL--PLLNTDMEVDDG--FPPAVEAFRA
AZOR_STAAB      ----------------------------QQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETQMKVS
MTNA_DESHY      MEKVQHRLAETRPTAVNLF---WALRRMEDRLRDQHEAKELAEIRQALVAE-----------------AE
MTNA_DESHD      MEKVQHRLAETRPTAVNLF---WALRRMEDRLRDQHEAKELAEIRQALVAE-----------------AE
AZOR_STAAW      ----------------------------QQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETQMKVS
AZOR_STAAT      ----------------------------QQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETQMKVS
AZOR_STAAS      ----------------------------QQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETQMKVS
AZOR_STAAN      ----------------------------QQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETQMKVS
AZOR_STAAC      ----------------------------QQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETQMKVS
AZOR_STAA9      ----------------------------QQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETQMKVS
AZOR_STAA8      ----------------------------QQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETQMKVS
AZOR_STAA3      ----------------------------QQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETQMKVS
AZOR_STAA2      ----------------------------QQHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETQMKVS
AZOR_STAAM      ----------------------------QHHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETQMKVS
AZOR_STAA1      ----------------------------QHHPDDEVKHIDLFETYIPVIDKDVLTGWGKMSNGETQMKVS


                         .         .         *         .         .         .         .:140
query           KIAEFDGFIFVTGEYNHSVPAALTNALSYLSAEWNNKAAGIVSYGSAMGVRAAEHLRGILSELQIAHVQK
FMNR_SCHPO      KIAGADGFVFVTPQYNGGYPAILKNALDHLYHEWNGKPLLIVSYGGHGGGDCASQLKHVAGFLKM-----
LOT6_YEAST      IVNALDIIVFVTPQYNWGYPAALKNAIDRLYHEWHGKPALVVSYGGHGGSKCNDQLQEVLHGLKM-----
NQR_SOLTU       KIEEADCFLFASPEYNYSITGPLKNAIDWASRPWADKAAAMVSXXXXXXXRSQYHLRQIGVFLDLHFINK
YIEF_SHIFL      QIRQADGVVIVTPEYNYSVPGGLKNAIDWLSRLPDQPLAGVLIQTSSMGVRCQYHLRQIL----------
YIEF_ECOLI      QIRQADGVVIVTPEYNYSVPGGLKNAIDWLSRLPDQPLAGVLIQTSSMGVRCQYHLRQIL----------
YIEF_ECO57      QIRQADGVVIVTPEYNYSVPGGLKNAIDWLSRLPDQPLAGVLIQTSSMGVRCQYHLRQIL----------
NQR_ARATH       KILEADSILFASPEYNFSVSAPLKNALDWASRPWADKPAAIISXXXXXXXRSQYHLRQIGVFLDLHFINK
NQR1_ORYSJ      KVRQADCFLFGSPEYNYSIATPLKNALDWASRGWADKPAAIVSXXXXXXXRSQYHLRQVGVFLDLHFINK
NQR2_ORYSJ      SVRAADCFLFASPEYNYSISGPLKNALDW-----------------------------------------
AZOR_STAAB      RLSDIDKYVFVTPMWNLSFPPVVK---AYIDA---------ISIAGKTFKYSAEGPQGLLTDKKVLHIQS
MTNA_DESHY      SIAEDDRRVRLIGEHGNAIVTAEANILTHCNA----GALATVEYGTALGVRAAQ----------------
MTNA_DESHD      NIAEDDRRVRLIGEHGNAIVTAEANILTHCNA----GALATVEYGTALGVRAAQ----------------
AZOR_STAAW      RLSDIDKYVFVTPMWNLSFPPVVK---AYIDA---------ISIAGKTFKYSAEGPQGLLTDKKVLHIQS
AZOR_STAAT      RLSDIDKYVFVTPMWNLSFPPVVK---AYIDA---------ISIAGKTFKYSAEGPQGLLTDKKVLHIQS
AZOR_STAAS      RLSDIDKYVFVTPMWNLSFPPVVK---AYIDA---------ISIAGKTFKYSAEGPQGLLTDKKVLHIQS
AZOR_STAAN      RLSDIDKYVFVTPMWNLSFPPVVK---AYIDA---------ISIAGKTFKYSAEGPQGLLTDKKVLHIQS
AZOR_STAAC      RLSDIDKYVFVTPMWNLSFPPVVK---AYIDA---------ISIAGKTFKYSAEGPQGLLTDKKVLHIQS
AZOR_STAA9      RLSDIDKYVFVTPMWNLSFPPVVK---AYIDA---------ISIAGKTFKYSAEGPQGLLTDKKVLHIQS
AZOR_STAA8      RLSDIDKYVFVTPMWNLSFPPVVK---AYIDA---------ISIAGKTFKYSAEGPQGLLTDKKVLHIQS
AZOR_STAA3      RLSDIDKYVFVTPMWNLSFPPVVK---AYIDA---------ISIAGKTFKYSAEGPQGLLTDKKVLHIQS
AZOR_STAA2      RLSDIDKYVFVTPMWNLSFPPVVK---AYIDA---------ISIAGKTFKYSAEGPQGLLTDKKVLHIQS
AZOR_STAAM      RLSDIDKYVFVTPMWNLSFPPVVK---AYIDA---------ISIAGKTFKYSAEGPQGLLTDKKVLHIQS
AZOR_STAA1      RLSDIDKYVFVTPMWNLSFPPVVK---AYIDA---------ISIAGKTFKYSAEGPQGLLTDKKVLHIQS


                         +         .         .         .         .         *         .:210
query           TGLLSIFTDFEYPNFKPSEQGISSVDAMLEQLVxxxxxxxxxxxxxxx
FMNR_SCHPO      ------------------------------------------------
LOT6_YEAST      ------------------------------------------------
NQR_SOLTU       ------------------------------------------------
YIEF_SHIFL      ------------------------------------------------
YIEF_ECOLI      ------------------------------------------------
YIEF_ECO57      ------------------------------------------------
NQR_ARATH       ------------------------------------------------
NQR1_ORYSJ      PEL--AVKAFEQPPKFDSDGNL--IDAQIRERI---------------
NQR2_ORYSJ      ------------------------------------------------
AZOR_STAAB      RG--GYYTEGPAANFEMGDRYLRTIMTFL-------------------
MTNA_DESHY      ------------------------------------------------
MTNA_DESHD      ------------------------------------------------
AZOR_STAAW      RG--GYYTEGPAADFEMGDRYLRTIMTFL-------------------
AZOR_STAAT      RG--GYYTEGPAADFEMGDRYLRTIMTFL-------------------
AZOR_STAAS      RG--GYYTEGPAADFEMGDRYLRTIMTFL-------------------
AZOR_STAAN      RG--GYYTEGPAADFEMGDRYLRTIMTFL-------------------
AZOR_STAAC      RG--GYYTEGPAADFEMGDRYLRTIMTFL-------------------
AZOR_STAA9      RG--GYYTEGPAADFEMGDRYLRTIMTFL-------------------
AZOR_STAA8      RG--GYYTEGPAADFEMGDRYLRTIMTFL-------------------
AZOR_STAA3      RG--GYYTEGPAADFEMGDRYLRTIMTFL-------------------
AZOR_STAA2      RG--GYYTEGPAADFEMGDRYLRTIMTFL-------------------
AZOR_STAAM      RG--GYYTEGPAADFEMGDRYLRTIMTFL-------------------
AZOR_STAA1      RG--GYYTEGPAADFEMGDRYLRTIMTFL-------------------