[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF54082.1

[Show Plain Result]


## Summary of Sequence Search
    1::408
    7::329     3e-67  41%  389 aa  YDHP_ECOLI RecName: Full=Inner membrane transport protein ydhP;
    7::329     3e-67  41%  389 aa  YDHP_ECO57 RecName: Full=Inner membrane transport protein ydhP;
    7::372     5e-62  36%  397 aa  YFHI_BACSU RecName: Full=Uncharacterized MFS-type transporter yfhI;
    3::374     2e-56  32%  396 aa  YTBD_BACSU RecName: Full=Uncharacterized MFS-type transporter ytbD;
    2::352     1e-53  34%  394 aa  ARAJ_ECOLI RecName: Full=Protein araJ;
    4::371     5e-37  33%  397 aa  SOTB_CITK8 RecName: Full=Probable sugar efflux transporter;
    8::261     4e-36  30%  386 aa  PBUE_BACAM RecName: Full=Purine efflux pump pbuE;
    3::369     1e-35  34%  395 aa  SOTB_ERWCH RecName: Full=Sugar efflux transporter B;
    8::362     1e-34  24%  388 aa  PBUE_BACSU RecName: Full=Purine efflux pump pbuE;
    1::372     4e-33  31%  396 aa  SOTB_HAEIN RecName: Full=Probable sugar efflux transporter;
    7::372     5e-33  31%  396 aa  SOTB_HAEIG RecName: Full=Probable sugar efflux transporter;
    1::372     7e-33  31%  402 aa  SOTB_HAEI8 RecName: Full=Probable sugar efflux transporter;
   10::364     1e-31  25%  390 aa  YBCL_BACSU RecName: Full=Uncharacterized MFS-type transporter ybcL;
    4::371     1e-30  31%  396 aa  SOTB_ECOLU RecName: Full=Probable sugar efflux transporter;
   13::240     2e-30  31%  396 aa  SOTB_PSEA7 RecName: Full=Probable sugar efflux transporter;
    7::363     4e-30  27%  391 aa  SOTB_HELPG RecName: Full=Probable sugar efflux transporter;
    4::371     2e-29  31%  396 aa  SOTB_SALNS RecName: Full=Probable sugar efflux transporter;
    4::371     2e-29  30%  396 aa  SOTB_SHIFL RecName: Full=Probable sugar efflux transporter;
    4::371     2e-29  31%  396 aa  SOTB_SALSV RecName: Full=Probable sugar efflux transporter;
    1::371     3e-29  30%  396 aa  SOTB_SHIF8 RecName: Full=Probable sugar efflux transporter;
   34::379     3e-29  24%  396 aa  NEPI_SHISS RecName: Full=Purine ribonucleoside efflux pump nepI;
    4::371     4e-29  31%  396 aa  SOTB_SALTI RecName: Full=Probable sugar efflux transporter;
    4::371     4e-29  31%  396 aa  SOTB_SALPB RecName: Full=Probable sugar efflux transporter;
    4::371     4e-29  31%  396 aa  SOTB_SALHS RecName: Full=Probable sugar efflux transporter;
    4::371     4e-29  31%  396 aa  SOTB_SALG2 RecName: Full=Probable sugar efflux transporter;
    4::371     4e-29  31%  396 aa  SOTB_SALEP RecName: Full=Probable sugar efflux transporter;
    4::371     4e-29  31%  396 aa  SOTB_SALDC RecName: Full=Probable sugar efflux transporter;
    4::371     4e-29  31%  396 aa  SOTB_SALA4 RecName: Full=Probable sugar efflux transporter;
    4::371     5e-29  31%  396 aa  SOTB_SALPC RecName: Full=Probable sugar efflux transporter;
    4::371     5e-29  31%  396 aa  SOTB_SALCH RecName: Full=Probable sugar efflux transporter;
    4::369     5e-29  30%  396 aa  SOTB_ECO5E RecName: Full=Probable sugar efflux transporter;
    1::280     5e-29  28%  396 aa  NEPI_ECOL5 RecName: Full=Purine ribonucleoside efflux pump nepI;
    4::241     6e-29  32%  396 aa  SOTB_SALAR RecName: Full=Probable sugar efflux transporter;
    1::280     8e-29  27%  396 aa  NEPI_ECOL6 RecName: Full=Purine ribonucleoside efflux pump nepI;
    4::371     1e-28  31%  396 aa  SOTB_SALTY RecName: Full=Probable sugar efflux transporter;
    4::371     1e-28  31%  396 aa  SOTB_SALPK RecName: Full=Probable sugar efflux transporter;
    4::371     1e-28  31%  396 aa  SOTB_SALPA RecName: Full=Probable sugar efflux transporter;
    4::371     1e-28  30%  396 aa  SOTB_ECOL5 RecName: Full=Probable sugar efflux transporter;
   34::280     1e-28  27%  396 aa  NEPI_ECOUT RecName: Full=Purine ribonucleoside efflux pump nepI;
   34::280     1e-28  27%  396 aa  NEPI_ECOK1 RecName: Full=Purine ribonucleoside efflux pump nepI;
   34::280     1e-28  27%  396 aa  NEPI_ECO27 RecName: Full=Purine ribonucleoside efflux pump nepI;
    4::371     1e-28  30%  396 aa  SOTB_ECOUT RecName: Full=Probable sugar efflux transporter;
    4::371     1e-28  30%  396 aa  SOTB_ECOL6 RecName: Full=Probable sugar efflux transporter;
    4::371     1e-28  30%  396 aa  SOTB_ECOK1 RecName: Full=Probable sugar efflux transporter;
    4::371     1e-28  30%  396 aa  SOTB_ECO81 RecName: Full=Probable sugar efflux transporter;
    4::371     1e-28  30%  396 aa  SOTB_ECO45 RecName: Full=Probable sugar efflux transporter;
    4::371     1e-28  30%  396 aa  SOTB_ECO27 RecName: Full=Probable sugar efflux transporter;
    4::371     2e-28  30%  396 aa  SOTB_SHISS RecName: Full=Probable sugar efflux transporter;
    4::371     2e-28  30%  396 aa  SOTB_SHIBS RecName: Full=Probable sugar efflux transporter;
    4::371     2e-28  30%  396 aa  SOTB_SHIB3 RecName: Full=Probable sugar efflux transporter;
    4::371     2e-28  31%  397 aa  SOTB_ESCF3 RecName: Full=Probable sugar efflux transporter;
    4::371     2e-28  30%  396 aa  SOTB_ECOSM RecName: Full=Probable sugar efflux transporter;
    4::371     2e-28  30%  396 aa  SOTB_ECOSE RecName: Full=Probable sugar efflux transporter;
    4::371     2e-28  30%  396 aa  SOTB_ECOLI RecName: Full=Sugar efflux transporter;
    4::371     2e-28  30%  396 aa  SOTB_ECOLC RecName: Full=Probable sugar efflux transporter;
    4::371     2e-28  30%  396 aa  SOTB_ECOHS RecName: Full=Probable sugar efflux transporter;
    4::371     2e-28  30%  396 aa  SOTB_ECODH RecName: Full=Probable sugar efflux transporter;
    4::371     2e-28  30%  396 aa  SOTB_ECOBW RecName: Full=Probable sugar efflux transporter;
    4::371     2e-28  30%  396 aa  SOTB_ECO8A RecName: Full=Probable sugar efflux transporter;
    4::371     2e-28  30%  396 aa  SOTB_ECO7I RecName: Full=Probable sugar efflux transporter;
    4::371     2e-28  30%  396 aa  SOTB_ECO55 RecName: Full=Probable sugar efflux transporter;
    4::371     2e-28  30%  396 aa  SOTB_ECO24 RecName: Full=Probable sugar efflux transporter;
    4::369     2e-28  30%  396 aa  SOTB_ECO57 RecName: Full=Probable sugar efflux transporter;
   34::280     2e-28  27%  394 aa  NEPI_SHIDS RecName: Full=Purine ribonucleoside efflux pump nepI;
   34::280     3e-28  27%  396 aa  NEPI_ECO57 RecName: Full=Purine ribonucleoside efflux pump nepI;
   34::280     4e-28  26%  396 aa  NEPI_SHIFL RecName: Full=Purine ribonucleoside efflux pump nepI;
   34::280     4e-28  26%  396 aa  NEPI_SHIF8 RecName: Full=Purine ribonucleoside efflux pump nepI;
   34::280     4e-28  26%  396 aa  NEPI_ECOLI RecName: Full=Purine ribonucleoside efflux pump nepI;
   34::280     4e-28  26%  396 aa  NEPI_ECOBW RecName: Full=Purine ribonucleoside efflux pump nepI;
    7::363     9e-28  25%  391 aa  SOTB_HELAH RecName: Full=Probable sugar efflux transporter;
    9::370     1e-27  27%  394 aa  SOTB_ERWT9 RecName: Full=Probable sugar efflux transporter;
   34::280     1e-27  26%  396 aa  NEPI_SHIBS RecName: Full=Purine ribonucleoside efflux pump nepI;
    4::371     2e-27  30%  399 aa  SOTB_KLEP7 RecName: Full=Probable sugar efflux transporter;
    7::363     3e-27  25%  391 aa  SOTB_HELPH RecName: Full=Probable sugar efflux transporter;
    4::371     3e-27  30%  398 aa  SOTB_ENT38 RecName: Full=Probable sugar efflux transporter;
    7::363     6e-27  25%  391 aa  SOTB_HELP2 RecName: Full=Probable sugar efflux transporter;
    7::363     7e-27  25%  391 aa  SOTB_HELPY RecName: Full=Probable sugar efflux transporter;
   20::363     2e-26  25%  391 aa  SOTB_HELPJ RecName: Full=Probable sugar efflux transporter;
   18::272     2e-26  26%  402 aa  SOTB_PSE14 RecName: Full=Probable sugar efflux transporter;
    4::371     3e-26  29%  399 aa  SOTB_KLEP3 RecName: Full=Probable sugar efflux transporter;
   13::240     5e-26  29%  396 aa  SOTB_PSEAE RecName: Full=Probable sugar efflux transporter;
   13::240     5e-26  29%  396 aa  SOTB_PSEAB RecName: Full=Probable sugar efflux transporter;
   13::240     5e-26  29%  396 aa  SOTB_PSEA8 RecName: Full=Probable sugar efflux transporter;
    1::371     5e-26  27%  404 aa  SOTB_PASMU RecName: Full=Probable sugar efflux transporter;
    3::330     5e-24  29%  392 aa  CMLR_STRLI RecName: Full=Chloramphenicol resistance protein;
   18::254     1e-23  27%  402 aa  SOTB_PSEU2 RecName: Full=Probable sugar efflux transporter;
   22::276     4e-23  24%  407 aa  SOTB_PSESM RecName: Full=Probable sugar efflux transporter;
   12::246     1e-22  27%  400 aa  SOTB_PSEE4 RecName: Full=Probable sugar efflux transporter;
   18::282     4e-22  27%  412 aa  YWFA_BACSU RecName: Full=Uncharacterized MFS-type transporter ywfA;
   36::280     6e-22  23%  397 aa  NEPI_SALPK RecName: Full=Purine ribonucleoside efflux pump nepI;
   36::280     6e-22  23%  397 aa  NEPI_SALPA RecName: Full=Purine ribonucleoside efflux pump nepI;
   36::380     9e-22  26%  397 aa  NEPI_SALG2 RecName: Full=Purine ribonucleoside efflux pump nepI;
   36::380     9e-22  26%  397 aa  NEPI_SALEP RecName: Full=Purine ribonucleoside efflux pump nepI;
   36::280     1e-21  23%  397 aa  NEPI_SALTY RecName: Full=Purine ribonucleoside efflux pump nepI;
   36::280     1e-21  23%  397 aa  NEPI_SALTI RecName: Full=Purine ribonucleoside efflux pump nepI;
   36::280     1e-21  23%  397 aa  NEPI_SALPC RecName: Full=Purine ribonucleoside efflux pump nepI;
   36::280     1e-21  23%  397 aa  NEPI_SALPB RecName: Full=Purine ribonucleoside efflux pump nepI;
   36::280     1e-21  23%  397 aa  NEPI_SALCH RecName: Full=Purine ribonucleoside efflux pump nepI;
   24::272     4e-20  25%  402 aa  OPDE_PSEAE RecName: Full=Transcription regulatory protein opdE;
   19::246     2e-19  27%  399 aa  SOTB_PSEPK RecName: Full=Probable sugar efflux transporter;
   19::246     2e-19  27%  399 aa  SOTB_PSEPG RecName: Full=Probable sugar efflux transporter;
   19::246     1e-18  26%  399 aa  SOTB_PSEPW RecName: Full=Probable sugar efflux transporter;
   18::256     2e-16  25%  397 aa  SOTB_MANSM RecName: Full=Probable sugar efflux transporter;
   11::187     3e-16  30%  395 aa  SOTB_ERWCT RecName: Full=Probable sugar efflux transporter;
   11::344     7e-15  24%  390 aa  YCEJ_BACSU RecName: Full=Uncharacterized MFS-type transporter yceJ;
   35::195     3e-14  32%  464 aa  GALP_ECOLI RecName: Full=Galactose-proton symporter;AltName:
   35::195     3e-14  32%  464 aa  GALP_ECOL6 RecName: Full=Galactose-proton symporter;AltName:
   14::200     1e-13  23%  472 aa  YCNB_BACSU RecName: Full=Uncharacterized MFS-type transporter ycnB;
    9::200     2e-13  25%  518 aa  YFIU_BACSU RecName: Full=Uncharacterized MFS-type transporter yfiU;
    9::200     2e-13  21%  532 aa  YHCA_BACSU RecName: Full=Uncharacterized MFS-type transporter yhcA;
   11::277     6e-13  28%  422 aa  EXUT_BACSU RecName: Full=Hexuronate transporter;
    3::215     2e-12  24%  458 aa  TCR_STRPN RecName: Full=Tetracycline resistance protein;
    3::215     2e-12  24%  458 aa  TCR_BACSU RecName: Full=Tetracycline resistance protein;
    3::215     2e-12  24%  458 aa  TCR_BACST RecName: Full=Tetracycline resistance protein;
    3::215     2e-12  24%  458 aa  TCR_BACCE RecName: Full=Tetracycline resistance protein;
   41::192     5e-12  25%  510 aa  EMRB_HAEIN RecName: Full=Multidrug resistance protein B homolog;
   13::167     7e-12  26%  394 aa  YGAY_ECOLI RecName: Full=Putative uncharacterized transporter ygaY;
   13::167     7e-12  26%  394 aa  YGAY_ECO57 RecName: Full=Uncharacterized transporter ygaY;
   27::178     9e-12  30%  472 aa  ARAE_KLEOX RecName: Full=Arabinose-proton symporter;AltName:
   46::257     2e-11  24%  543 aa  SGE1_YEAST RecName: Full=Protein SGE1;AltName: Full=Crystal violet
    3::215     3e-11  24%  458 aa  TCR_STRAG RecName: Full=Tetracycline resistance protein;
    3::196     3e-11  24%  458 aa  TCRB_BACSU RecName: Full=Tetracycline resistance protein;
   15::356     4e-11  24%  396 aa  YFMO_BACSU RecName: Full=Multidrug efflux protein yfmO;
    4::186     4e-11  25%  466 aa  MDTD_PECCP RecName: Full=Putative multidrug resistance protein
   27::240     6e-11  25%  457 aa  PCAK_ACIAD RecName: Full=4-hydroxybenzoate transporter;
  134::297     7e-11  28%  572 aa  YB30_YEAST RecName: Full=Uncharacterized transporter YBR180W;
    3::168     7e-11  26%  458 aa  TCR_STAHY RecName: Full=Tetracycline resistance protein;
    7::187     7e-11  25%  465 aa  MDTD_YERPS RecName: Full=Putative multidrug resistance protein
    7::187     1e-10  25%  465 aa  MDTD_YERPY RecName: Full=Putative multidrug resistance protein
    7::187     1e-10  25%  465 aa  MDTD_YERPP RecName: Full=Putative multidrug resistance protein
    7::187     1e-10  25%  465 aa  MDTD_YERPN RecName: Full=Putative multidrug resistance protein
    7::187     1e-10  25%  465 aa  MDTD_YERPG RecName: Full=Putative multidrug resistance protein
    7::187     1e-10  25%  465 aa  MDTD_YERPE RecName: Full=Putative multidrug resistance protein
    7::187     1e-10  25%  465 aa  MDTD_YERPB RecName: Full=Putative multidrug resistance protein
    7::187     1e-10  25%  465 aa  MDTD_YERPA RecName: Full=Putative multidrug resistance protein
    7::187     1e-10  25%  465 aa  MDTD_YERP3 RecName: Full=Putative multidrug resistance protein
    8::183     1e-10  25%  469 aa  MDTD_YERE8 RecName: Full=Putative multidrug resistance protein
   35::178     1e-10  28%  472 aa  ARAE_ECOLI RecName: Full=Arabinose-proton symporter;AltName:
   35::178     1e-10  28%  472 aa  ARAE_ECO57 RecName: Full=Arabinose-proton symporter;AltName:
   53::150     1e-10  34%  403 aa  MHPT_ECOLI RecName: Full=Putative 3-hydroxyphenylpropionic acid
   86::231     2e-10  25%  503 aa  XYLL1_ARATH RecName: Full=D-xylose-proton symporter-like 1;
   62::332     3e-10  26%  493 aa  YLD2_CAEEL RecName: Full=Uncharacterized transporter C38C10.2;
   48::212     6e-10  24%  510 aa  NANT_YERPY RecName: Full=Putative sialic acid transporter;AltName:
   42::340     8e-10  30%  491 aa  YJA1_SCHPO RecName: Full=Uncharacterized transporter C1529.01;
   77::359     1e-09  23%  404 aa  YYBF_BACSU RecName: Full=Uncharacterized MFS-type transporter yybF;
   39::222     1e-09  22%  457 aa  YEBQ_ECOLI RecName: Full=Uncharacterized transporter yebQ;
    3::207     1e-09  23%  452 aa  YWOD_BACSU RecName: Full=Uncharacterized MFS-type transporter ywoD;
   13::188     1e-09  25%  477 aa  MDTD_SERP5 RecName: Full=Putative multidrug resistance protein
   10::179     1e-09  25%  512 aa  BMR3_BACSU RecName: Full=Multidrug resistance protein 3;AltName:
   41::228     2e-09  28%  478 aa  EDL15_ARATH RecName: Full=Sugar transporter ERD6-like 15;
   48::212     2e-09  24%  510 aa  NANT_YERPS RecName: Full=Putative sialic acid transporter;AltName:
   48::212     2e-09  24%  510 aa  NANT_YERPP RecName: Full=Putative sialic acid transporter;AltName:
   48::212     2e-09  24%  510 aa  NANT_YERPG RecName: Full=Putative sialic acid transporter;AltName:
   48::212     2e-09  24%  510 aa  NANT_YERPE RecName: Full=Putative sialic acid transporter;AltName:
   48::212     2e-09  24%  510 aa  NANT_YERPB RecName: Full=Putative sialic acid transporter;AltName:
   48::212     2e-09  24%  510 aa  NANT_YERPA RecName: Full=Putative sialic acid transporter;AltName:
   48::212     2e-09  24%  510 aa  NANT_YERP3 RecName: Full=Putative sialic acid transporter;AltName:
   35::208     2e-09  22%  496 aa  NANT_SALAR RecName: Full=Putative sialic acid transporter;AltName:
   38::249     3e-09  24%  471 aa  LMRB_LISMO RecName: Full=Lincomycin resistance protein lmrB;
  103::262     4e-09  29%  558 aa  XYLL3_ARATH RecName: Full=D-xylose-proton symporter-like 3;
   66::208     4e-09  25%  496 aa  NANT_CITK8 RecName: Full=Putative sialic acid transporter;AltName:
   30::122     5e-09  37%  518 aa  MFSD8_HUMAN RecName: Full=Major facilitator superfamily
   38::221     5e-09  26%  471 aa  LMRB_LISIN RecName: Full=Lincomycin resistance protein lmrB;
  132::317     7e-09  25%  605 aa  SPIN_DROME RecName: Full=Protein spinster;AltName: Full=Protein
   66::199     7e-09  25%  496 aa  NANT_ESCF3 RecName: Full=Putative sialic acid transporter;AltName:
   70::255     9e-09  22%  498 aa  SPNS3_DANRE RecName: Full=Protein spinster homolog 3;AltName:
   35::199     9e-09  21%  496 aa  NANT_SALTY RecName: Full=Putative sialic acid transporter;AltName:
   35::199     9e-09  21%  496 aa  NANT_SALTI RecName: Full=Putative sialic acid transporter;AltName:
   35::199     9e-09  21%  496 aa  NANT_SALSV RecName: Full=Putative sialic acid transporter;AltName:
   35::199     9e-09  21%  496 aa  NANT_SALPK RecName: Full=Putative sialic acid transporter;AltName:
   35::199     9e-09  21%  496 aa  NANT_SALPC RecName: Full=Putative sialic acid transporter;AltName:
   35::199     9e-09  21%  496 aa  NANT_SALPB RecName: Full=Putative sialic acid transporter;AltName:
   35::199     9e-09  21%  496 aa  NANT_SALPA RecName: Full=Putative sialic acid transporter;AltName:
   35::199     9e-09  21%  496 aa  NANT_SALNS RecName: Full=Putative sialic acid transporter;AltName:
   35::199     9e-09  21%  496 aa  NANT_SALHS RecName: Full=Putative sialic acid transporter;AltName:
   35::199     9e-09  21%  496 aa  NANT_SALG2 RecName: Full=Putative sialic acid transporter;AltName:
   35::199     9e-09  21%  496 aa  NANT_SALEP RecName: Full=Putative sialic acid transporter;AltName:
   35::199     9e-09  21%  496 aa  NANT_SALDC RecName: Full=Putative sialic acid transporter;AltName:
   35::199     9e-09  21%  496 aa  NANT_SALCH RecName: Full=Putative sialic acid transporter;AltName:
   31::148     9e-09  34%  519 aa  MFSD8_MOUSE RecName: Full=Major facilitator superfamily
   64::221     1e-08  29%  482 aa  EDL14_ARATH RecName: Full=Sugar transporter ERD6-like 14;
  114::284     2e-08  24%  534 aa  YMPB_CAEEL RecName: Full=Putative transporter B0361.11;
   74::206     2e-08  23%  582 aa  VBA5_YEAST RecName: Full=Vacuolar basic amino acid transporter 5;
   29::268     2e-08  22%  410 aa  MDTM_ECO57 RecName: Full=Multidrug resistance protein mdtM;
   44::153     3e-08  31%  457 aa  YWTG_BACSU RecName: Full=Putative metabolite transport protein
   66::199     3e-08  25%  496 aa  NANT_SHIFL RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_SHIF8 RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_SHIB3 RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_ECOSM RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_ECOSE RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_ECOLI RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_ECOLC RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_ECOL5 RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_ECOHS RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_ECODH RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_ECOBW RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_ECO8A RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_ECO7I RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_ECO5E RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_ECO57 RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_ECO55 RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_ECO45 RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_ECO27 RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT_ECO24 RecName: Full=Putative sialic acid transporter;AltName:
   66::199     3e-08  25%  496 aa  NANT1_ECOL6 RecName: Full=Putative sialic acid transporter
    6::186     3e-08  24%  466 aa  MDTD_ERWCT RecName: Full=Putative multidrug resistance protein
   32::198     3e-08  28%  451 aa  YYAJ_BACSU RecName: Full=Putative metabolite transport protein
    7::187     3e-08  22%  470 aa  MDTD_SALPB RecName: Full=Putative multidrug resistance protein
    7::187     3e-08  22%  470 aa  MDTD_SALHS RecName: Full=Putative multidrug resistance protein
   90::231     3e-08  23%  613 aa  AZR1_YEAST RecName: Full=Azole resistance protein 1;
  115::242     5e-08  24%  499 aa  YIZG_SCHPO RecName: Full=Uncharacterized transporter C1002.16c;
   47::199     5e-08  28%  555 aa  GHT3_SCHPO RecName: Full=High-affinity gluconate transporter
    7::187     6e-08  22%  470 aa  MDTD_SALSV RecName: Full=Putative multidrug resistance protein
    7::187     6e-08  23%  471 aa  MDTD_KLEP3 RecName: Full=Putative multidrug resistance protein
    7::187     6e-08  23%  471 aa  MDTD_ESCF3 RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_SHISS RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_SHIFL RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_SHIBS RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_SHIB3 RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_KLEP7 RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECOUT RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECOSM RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECOSE RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECOLI RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECOLC RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECOL5 RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECOK1 RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECOHS RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECODH RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECOBW RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECO8A RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECO7I RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECO5E RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECO57 RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECO55 RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECO45 RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECO27 RecName: Full=Putative multidrug resistance protein
    7::187     8e-08  23%  471 aa  MDTD_ECO24 RecName: Full=Putative multidrug resistance protein
   37::196     1e-07  27%  459 aa  TCR_STAES RecName: Full=Tetracycline resistance protein;
   37::196     1e-07  27%  459 aa  TCR_STAAU RecName: Full=Tetracycline resistance protein;AltName:
   44::243     1e-07  24%  513 aa  SPNS2_XENTR RecName: Full=Protein spinster homolog 2;
    7::187     1e-07  22%  470 aa  MDTD_SALTY RecName: Full=Putative multidrug resistance protein
    7::187     1e-07  22%  470 aa  MDTD_SALTI RecName: Full=Putative multidrug resistance protein
    7::187     1e-07  22%  470 aa  MDTD_SALPK RecName: Full=Putative multidrug resistance protein
    7::187     1e-07  22%  470 aa  MDTD_SALPA RecName: Full=Putative multidrug resistance protein
    7::187     1e-07  22%  470 aa  MDTD_SALNS RecName: Full=Putative multidrug resistance protein
    7::187     1e-07  22%  470 aa  MDTD_SALEP RecName: Full=Putative multidrug resistance protein
    7::187     1e-07  22%  470 aa  MDTD_SALA4 RecName: Full=Putative multidrug resistance protein
   12::187     1e-07  22%  471 aa  MDTD_ENT38 RecName: Full=Putative multidrug resistance protein
    7::187     1e-07  23%  471 aa  MDTD_ECO81 RecName: Full=Putative multidrug resistance protein
   14::186     1e-07  25%  518 aa  GHT7_SCHPO RecName: Full=Probable high-affinity hexose transporter
   47::199     1e-07  26%  557 aa  GHT4_SCHPO RecName: Full=High-affinity hexose transporter ght4;    
    7::187     1e-07  22%  471 aa  MDTD_SHIF8 RecName: Full=Putative multidrug resistance protein
   69::214     1e-07  27%  551 aa  HGT1_KLULA RecName: Full=High-affinity glucose transporter;
   30::158     1e-07  32%  461 aa  CSBC_BACSU RecName: Full=Probable metabolite transport protein
   48::219     2e-07  29%  537 aa  QAY_NEUCR RecName: Full=Quinate permease;AltName: Full=Quinate
   29::236     2e-07  22%  410 aa  MDTM_ECOLI RecName: Full=Multidrug resistance protein mdtM;
    7::187     2e-07  22%  470 aa  MDTD_SALDC RecName: Full=Putative multidrug resistance protein
    7::187     2e-07  22%  471 aa  MDTD_ECOLU RecName: Full=Putative multidrug resistance protein
    7::187     2e-07  22%  471 aa  MDTD_CITK8 RecName: Full=Putative multidrug resistance protein
    4::218     2e-07  22%  479 aa  LMRB_BACSU RecName: Full=Lincomycin resistance protein lmrB;
   65::190     3e-07  21%  405 aa  YJHB_ECOLI RecName: Full=Putative metabolite transport protein
  135::256     3e-07  29%  548 aa  ORCT_DROME RecName: Full=Organic cation transporter protein;
   12::187     3e-07  23%  471 aa  MDTD_ENTS8 RecName: Full=Putative multidrug resistance protein
    7::187     3e-07  22%  471 aa  MDTD_ECOL6 RecName: Full=Putative multidrug resistance protein
  104::279     4e-07  26%  395 aa  YDER_BACSU RecName: Full=Uncharacterized MFS-type transporter ydeR;
  135::243     4e-07  30%  567 aa  OCTL_DROME RecName: Full=Organic cation transporter-like protein;
   26::178     4e-07  23%  395 aa  MDTL_SALAR RecName: Full=Multidrug resistance protein mdtL;
  129::249     5e-07  26%  589 aa  YAN6_SCHPO RecName: Full=Uncharacterized transporter C3H1.06c;
  158::344     5e-07  26%  727 aa  SV2C_MOUSE RecName: Full=Synaptic vesicle glycoprotein 2C;       
  158::344     7e-07  26%  727 aa  SV2C_RAT RecName: Full=Synaptic vesicle glycoprotein 2C;       
    3::254     7e-07  20%  395 aa  MDTL_SALHS RecName: Full=Multidrug resistance protein mdtL;
    3::254     7e-07  20%  395 aa  MDTL_SALEP RecName: Full=Multidrug resistance protein mdtL;
    3::254     7e-07  20%  395 aa  MDTL_SALDC RecName: Full=Multidrug resistance protein mdtL;
   47::216     7e-07  26%  557 aa  GHT1_SCHPO RecName: Full=High-affinity glucose transporter
   56::204     7e-07  31%  463 aa  ERDL7_ARATH RecName: Full=Sugar transporter ERD6-like 7;
   83::188     9e-07  33%  506 aa  STP5_ARATH RecName: Full=Sugar transport protein 5;AltName:
    3::254     9e-07  20%  395 aa  MDTL_SALPB RecName: Full=Multidrug resistance protein mdtL;
    3::254     9e-07  20%  395 aa  MDTL_SALNS RecName: Full=Multidrug resistance protein mdtL;
    3::254     9e-07  20%  395 aa  MDTL_SALA4 RecName: Full=Multidrug resistance protein mdtL;
   54::313     9e-07  26%  444 aa  CITH_KLEPN RecName: Full=Citrate-proton symporter;AltName:
   21::137     9e-07  25%  404 aa  BCRH_RICBR RecName: Full=Uncharacterized transporter RBE_0856;
   65::188     1e-06  28%  390 aa  Y466_BUCAI RecName: Full=Uncharacterized transporter BU466;
  158::344     1e-06  26%  727 aa  SV2C_HUMAN RecName: Full=Synaptic vesicle glycoprotein 2C;
  127::261     1e-06  28%  555 aa  S22A2_RAT RecName: Full=Solute carrier family 22 member 2;AltName:
   88::198     1e-06  26%  508 aa  PLT3_ARATH RecName: Full=Probable polyol transporter 3;
    3::254     1e-06  20%  395 aa  MDTL_SALTY RecName: Full=Multidrug resistance protein mdtL;
   70::189     1e-06  22%  547 aa  GTR1_LEIDO RecName: Full=Membrane transporter D1;
   51::220     1e-06  26%  531 aa  GHT2_SCHPO RecName: Full=High-affinity glucose transporter
   20::187     1e-06  30%  327 aa  ERDL9_ARATH RecName: Full=Sugar transporter ERD6-like 9;
   14::144     1e-06  21%  400 aa  BMR2_BACSU RecName: Full=Multidrug resistance protein 2;AltName:
   83::193     2e-06  24%  493 aa  PLT6_ARATH RecName: Full=Probable polyol transporter 6;
    3::254     2e-06  20%  395 aa  MDTL_SALSV RecName: Full=Multidrug resistance protein mdtL;
    3::254     2e-06  20%  395 aa  MDTL_SALPK RecName: Full=Multidrug resistance protein mdtL;
    3::254     2e-06  19%  395 aa  MDTL_SALPC RecName: Full=Multidrug resistance protein mdtL;
    3::254     2e-06  20%  395 aa  MDTL_SALPA RecName: Full=Multidrug resistance protein mdtL;
    3::254     2e-06  19%  395 aa  MDTL_SALCH RecName: Full=Multidrug resistance protein mdtL;
   35::168     2e-06  28%  507 aa  GTR6_HUMAN RecName: Full=Solute carrier family 2, facilitated
   55::203     2e-06  29%  606 aa  ENB1_YEAST RecName: Full=Siderophore iron transporter ENB1;AltName:
  129::249     2e-06  25%  589 aa  YI32_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   72::290     2e-06  30%  457 aa  XYLT_LACBR RecName: Full=D-xylose-proton symporter;AltName:
   76::251     2e-06  23%  400 aa  MDTH_PROMH RecName: Full=Multidrug resistance protein mdtH;
   76::262     2e-06  24%  401 aa  MDTH_BLOFL RecName: Full=Multidrug resistance protein mdtH;
  101::256     2e-06  25%  524 aa  GTR2_HUMAN RecName: Full=Solute carrier family 2, facilitated
   48::213     3e-06  21%  473 aa  PHDK_NOCSK RecName: Full=Probable 1-hydroxy-2-naphthoate
   35::199     3e-06  21%  496 aa  NANT_SALA4 RecName: Full=Putative sialic acid transporter;AltName:
   51::166     3e-06  28%  510 aa  MFSD8_XENLA RecName: Full=Major facilitator superfamily
   47::216     3e-06  26%  546 aa  GHT5_SCHPO RecName: Full=High-affinity glucose transporter
   81::224     3e-06  30%  487 aa  ERDL6_ARATH RecName: Full=Sugar transporter ERD6-like 6;
   82::225     3e-06  31%  488 aa  ERDL4_ARATH RecName: Full=Sugar transporter ERD6-like 4;
   42::223     3e-06  26%  467 aa  EDL11_ARATH RecName: Full=Sugar transporter ERD6-like 11;
   86::376     4e-06  21%  413 aa  Y567_BUCAP RecName: Full=Uncharacterized transporter BUsg_567;
  142::263     4e-06  27%  553 aa  S22A2_MOUSE RecName: Full=Solute carrier family 22 member
  121::239     4e-06  28%  526 aa  PLT4_ARATH RecName: Full=Probable polyol transporter 4;
   66::207     4e-06  25%  496 aa  NANT_ENTS8 RecName: Full=Putative sialic acid transporter;AltName:
    3::178     4e-06  22%  395 aa  MDTL_SALTI RecName: Full=Multidrug resistance protein mdtL;
   67::208     6e-06  25%  502 aa  NANT2_ECOL6 RecName: Full=Putative sialic acid transporter
   47::216     6e-06  25%  547 aa  GHT8_SCHPO RecName: Full=Probable high-affinity hexose transporter
   77::207     7e-06  26%  526 aa  SPNS1_XENLA RecName: Full=Protein spinster homolog 1;
   65::222     7e-06  26%  399 aa  PMRA_STRR6 RecName: Full=Multi-drug resistance efflux pump pmrA;
   65::222     7e-06  26%  399 aa  PMRA_STRPN RecName: Full=Multi-drug resistance efflux pump pmrA;
   33::197     7e-06  30%  458 aa  EDL10_ARATH RecName: Full=Sugar transporter ERD6-like 10;
   48::221     7e-06  21%  477 aa  BAIG_EUBSP RecName: Full=Bile acid transporter;
   10::185     9e-06  22%  541 aa  YUSP_BACSU RecName: Full=Uncharacterized MFS-type transporter yusP;
  143::273     9e-06  27%  538 aa  YN43_SCHPO RecName: Full=Uncharacterized transporter C36.03c;
   77::242     9e-06  21%  526 aa  SPNS1_XENTR RecName: Full=Protein spinster homolog 1;
   48::219     9e-06  27%  536 aa  QAY_NEUTR RecName: Full=Quinate permease;AltName: Full=Quinate
   53::313     9e-06  22%  489 aa  MOT2_RAT RecName: Full=Monocarboxylate transporter 2;       
   41::207     9e-06  29%  474 aa  EDL17_ARATH RecName: Full=Sugar transporter ERD6-like 17;AltName:
  172::309     1e-05  31%  576 aa  YQO5_SCHPO RecName: Full=Uncharacterized transporter C569.05c;
   96::271     1e-05  22%  599 aa  YBIH_SCHPO RecName: Full=Uncharacterized MFS-type transporter
  108::226     1e-05  30%  514 aa  STP4_ARATH RecName: Full=Sugar transport protein 4;AltName:
  288::417     1e-05  24%  418 aa  OXLT_OXAFO RecName: Full=Oxalate:formate antiporter;       
   44::250     1e-05  22%  388 aa  NORA_STAAW RecName: Full=Quinolone resistance protein norA;
   44::250     1e-05  22%  388 aa  NORA_STAAU RecName: Full=Quinolone resistance protein norA;
   44::250     1e-05  22%  388 aa  NORA_STAAN RecName: Full=Quinolone resistance protein norA;
   44::250     1e-05  22%  388 aa  NORA_STAAM RecName: Full=Quinolone resistance protein norA;
   44::250     1e-05  22%  388 aa  NORA_STAAC RecName: Full=Quinolone resistance protein norA;
  149::265     1e-05  28%  557 aa  ITR2_SCHPO RecName: Full=Myo-inositol transporter 2;
   76::211     1e-05  28%  588 aa  GTR12_XENLA RecName: Full=Solute carrier family 2, facilitated
   41::152     1e-05  31%  434 aa  CITA_SALTY RecName: Full=Citrate-proton symporter;AltName:
   41::152     1e-05  31%  434 aa  CITA_SALTI RecName: Full=Citrate-proton symporter;AltName:
   11::180     2e-05  26%  511 aa  YUBD_BACSU RecName: Full=Uncharacterized MFS-type transporter yubD;
  144::250     2e-05  24%  539 aa  YHA8_SCHPO RecName: Full=Uncharacterized MFS-type transporter
   44::250     2e-05  22%  388 aa  NORA_STAAS RecName: Full=Quinolone resistance protein norA;
   75::192     2e-05  30%  396 aa  YWOG_BACSU RecName: Full=Uncharacterized MFS-type transporter ywoG;
    1::144     2e-05  19%  474 aa  VBA2_YEAST RecName: Full=Vacuolar basic amino acid transporter 2;
    2::172     2e-05  24%  394 aa  TSGA_YERE8 RecName: Full=Protein tsgA homolog;
   26::346     2e-05  22%  391 aa  MDTL_ECOLU RecName: Full=Multidrug resistance protein mdtL;
   26::346     2e-05  22%  391 aa  MDTL_ECOL5 RecName: Full=Multidrug resistance protein mdtL;
   26::346     2e-05  22%  391 aa  MDTL_ECO27 RecName: Full=Multidrug resistance protein mdtL;
   13::185     2e-05  27%  473 aa  IOLT_BACSU RecName: Full=Major myo-inositol transporter iolT;
  165::285     2e-05  24%  586 aa  AQR1_YEAST RecName: Full=Probable transporter AQR1;
   96::260     3e-05  24%  544 aa  YRT3_CAEEL RecName: Full=Potential vesicular glutamate transporter
  113::259     3e-05  23%  524 aa  PLST1_ARATH RecName: Full=Probable plastidic glucose transporter 1;
   44::177     3e-05  22%  388 aa  NORA_STAAR RecName: Full=Quinolone resistance protein norA;
    2::176     3e-05  24%  734 aa  MSSP1_ARATH RecName: Full=Monosaccharide-sensing protein 1;AltName:
   26::346     3e-05  22%  391 aa  MDTL_ECOUT RecName: Full=Multidrug resistance protein mdtL;
   26::346     3e-05  22%  391 aa  MDTL_ECOK1 RecName: Full=Multidrug resistance protein mdtL;
   26::346     3e-05  22%  391 aa  MDTL_ECO45 RecName: Full=Multidrug resistance protein mdtL;
   76::251     3e-05  26%  402 aa  MDTH_ENT38 RecName: Full=Multidrug resistance protein mdtH;
   54::225     3e-05  27%  496 aa  GTR3_CHICK RecName: Full=Solute carrier family 2, facilitated
   38::149     3e-05  30%  431 aa  CITA_ECOLX RecName: Full=Citrate-proton symporter;AltName:
   64::236     4e-05  20%  403 aa  YDHC_ECOLI RecName: Full=Inner membrane transport protein ydhC;
  142::263     4e-05  28%  551 aa  S22AD_HUMAN RecName: Full=Solute carrier family 22 member
   96::252     4e-05  20%  495 aa  S17A5_HUMAN RecName: Full=Sialin;AltName: Full=Solute carrier
   72::131     4e-05  32%  729 aa  MSSP2_ARATH RecName: Full=Monosaccharide-sensing protein 2;AltName:
   76::254     4e-05  22%  401 aa  MDTH_ERWCT RecName: Full=Multidrug resistance protein mdtH;
   44::261     5e-05  24%  382 aa  YCAD_SALAR RecName: Full=Uncharacterized MFS-type transporter ycaD;
    2::127     5e-05  30%  401 aa  TCR2_ECOLX RecName: Full=Tetracycline resistance protein, class B; 
   48::219     5e-05  27%  536 aa  QAY_NEUAF RecName: Full=Quinate permease;AltName: Full=Quinate
   26::346     5e-05  21%  391 aa  MDTL_ECOL6 RecName: Full=Multidrug resistance protein mdtL;
   26::346     5e-05  21%  391 aa  MDTL_ECO81 RecName: Full=Multidrug resistance protein mdtL;
  104::277     5e-05  25%  540 aa  GTR9_HUMAN RecName: Full=Solute carrier family 2, facilitated
   31::187     5e-05  21%  553 aa  GTR10_XENLA RecName: Full=Solute carrier family 2, facilitated
   60::208     5e-05  27%  470 aa  ERDL3_ARATH RecName: Full=Sugar transporter ERD6-like 3;AltName:
   33::284     6e-05  22%  407 aa  Y1104_HAEIN RecName: Full=Putative metabolite transport protein
   63::212     6e-05  22%  512 aa  SPNS3_HUMAN RecName: Full=Protein spinster homolog 3;
    2::178     6e-05  22%  392 aa  MDTL_KLEP7 RecName: Full=Multidrug resistance protein mdtL;
    2::188     6e-05  23%  392 aa  MDTL_KLEP3 RecName: Full=Multidrug resistance protein mdtL;
   26::346     6e-05  22%  391 aa  MDTL_ESCF3 RecName: Full=Multidrug resistance protein mdtL;
   26::346     6e-05  21%  391 aa  MDTL_ECOSM RecName: Full=Multidrug resistance protein mdtL;
   52::201     6e-05  26%  462 aa  ERDL2_ARATH RecName: Full=Sugar transporter ERD6-like 2;AltName:
   30::172     8e-05  24%  394 aa  TSGA_YERPY RecName: Full=Protein tsgA homolog;
   30::172     8e-05  24%  394 aa  TSGA_YERPS RecName: Full=Protein tsgA homolog;
   30::172     8e-05  24%  394 aa  TSGA_YERPP RecName: Full=Protein tsgA homolog;
   30::172     8e-05  24%  394 aa  TSGA_YERPN RecName: Full=Protein tsgA homolog;
   30::172     8e-05  24%  394 aa  TSGA_YERPE RecName: Full=Protein tsgA homolog;
   30::172     8e-05  24%  394 aa  TSGA_YERPB RecName: Full=Protein tsgA homolog;
   30::172     8e-05  24%  394 aa  TSGA_YERPA RecName: Full=Protein tsgA homolog;
   30::172     8e-05  24%  394 aa  TSGA_YERP3 RecName: Full=Protein tsgA homolog;
   17::197     8e-05  28%  393 aa  SETB_SALTY RecName: Full=Sugar efflux transporter B;
  107::252     8e-05  21%  495 aa  S17A5_SHEEP RecName: Full=Sialin;AltName: Full=Solute carrier
  354::504     8e-05  22%  512 aa  MOT10_MOUSE RecName: Full=Monocarboxylate transporter 10;       
   45::111     8e-05  33%  504 aa  MFSD8_DANRE RecName: Full=Major facilitator superfamily
   26::346     8e-05  21%  391 aa  MDTL_ECOSE RecName: Full=Multidrug resistance protein mdtL;
   26::346     8e-05  21%  391 aa  MDTL_ECOLI RecName: Full=Multidrug resistance protein mdtL;
   26::346     8e-05  21%  391 aa  MDTL_ECODH RecName: Full=Multidrug resistance protein mdtL;
   26::346     8e-05  21%  391 aa  MDTL_ECOBW RecName: Full=Multidrug resistance protein mdtL;
   26::346     8e-05  21%  391 aa  MDTL_ECO7I RecName: Full=Multidrug resistance protein mdtL;
   26::346     8e-05  21%  391 aa  MDTL_ECO55 RecName: Full=Multidrug resistance protein mdtL;
   76::251     8e-05  22%  402 aa  MDTH_SHIFL RecName: Full=Multidrug resistance protein mdtH;
    1::177     8e-05  27%  451 aa  GTR1_PIG RecName: Full=Solute carrier family 2, facilitated glucose
  141::396     1e-04  23%  435 aa  YYBO_BACSU RecName: Full=Uncharacterized transporter yybO;
    4::194     1e-04  23%  394 aa  TSGA_EDWI9 RecName: Full=Protein tsgA homolog;
   30::175     1e-04  24%  388 aa  TSGA_BUCAT RecName: Full=Protein tsgA homolog;
   30::175     1e-04  24%  388 aa  TSGA_BUCAI RecName: Full=Protein tsgA homolog;
   30::175     1e-04  24%  388 aa  TSGA_BUCA5 RecName: Full=Protein tsgA homolog;
   26::346     1e-04  21%  391 aa  MDTL_SHISS RecName: Full=Multidrug resistance protein mdtL;
   26::346     1e-04  21%  391 aa  MDTL_SHIFL RecName: Full=Multidrug resistance protein mdtL;
   26::346     1e-04  21%  391 aa  MDTL_SHIDS RecName: Full=Multidrug resistance protein mdtL;
   26::346     1e-04  21%  391 aa  MDTL_SHIBS RecName: Full=Multidrug resistance protein mdtL;
   26::346     1e-04  21%  391 aa  MDTL_SHIB3 RecName: Full=Multidrug resistance protein mdtL;
   26::346     1e-04  21%  391 aa  MDTL_ECOLC RecName: Full=Multidrug resistance protein mdtL;
   26::346     1e-04  21%  391 aa  MDTL_ECOHS RecName: Full=Multidrug resistance protein mdtL;
   26::346     1e-04  21%  391 aa  MDTL_ECO8A RecName: Full=Multidrug resistance protein mdtL;
   26::361     1e-04  21%  391 aa  MDTL_ECO5E RecName: Full=Multidrug resistance protein mdtL;
   26::361     1e-04  21%  391 aa  MDTL_ECO57 RecName: Full=Multidrug resistance protein mdtL;
   26::346     1e-04  21%  391 aa  MDTL_ECO24 RecName: Full=Multidrug resistance protein mdtL;
   76::251     1e-04  22%  402 aa  MDTH_SHIB3 RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECOUT RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECOSM RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECOSE RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECOLU RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECOLI RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECOLC RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECOL6 RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECOL5 RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECOK1 RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECOHS RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECODH RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECOBW RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECO8A RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECO81 RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECO7I RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECO5E RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECO57 RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECO55 RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECO45 RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECO27 RecName: Full=Multidrug resistance protein mdtH;
   76::251     1e-04  22%  402 aa  MDTH_ECO24 RecName: Full=Multidrug resistance protein mdtH;
   66::192     1e-04  25%  509 aa  GTR4_HUMAN RecName: Full=Solute carrier family 2, facilitated
   66::202     1e-04  25%  509 aa  GTR4_BOVIN RecName: Full=Solute carrier family 2, facilitated
   16::203     1e-04  27%  464 aa  ERDL1_ARATH RecName: Full=Sugar transporter ERD6-like 1;AltName:
   13::165     1e-04  24%  400 aa  YCEI_BACSU RecName: Full=Putative metabolite transport protein
  253::404     1e-04  22%  428 aa  MOT13_MOUSE RecName: Full=Monocarboxylate transporter 13;       
  104::277     1e-04  24%  566 aa  GTR9_PONAB RecName: Full=Solute carrier family 2, facilitated
   93::203     1e-04  27%  477 aa  GTR8_HUMAN RecName: Full=Solute carrier family 2, facilitated
    4::217     1e-04  23%  493 aa  GTR3_RAT RecName: Full=Solute carrier family 2, facilitated glucose
   61::174     1e-04  28%  490 aa  GTR1_CHICK RecName: Full=Solute carrier family 2, facilitated
   70::201     2e-04  29%  459 aa  YDJK_ECOLI RecName: Full=Putative metabolite transport protein
  235::373     2e-04  29%  389 aa  Y1322_DEIRA RecName: Full=Putative sugar efflux transporter
   66::202     2e-04  21%  506 aa  SPNS1_DANRE RecName: Full=Protein spinster homolog 1;AltName:
   93::226     2e-04  26%  487 aa  S22FL_XENLA RecName: Full=Solute carrier family 22 member 15-like;
  146::281     2e-04  27%  557 aa  S22A5_HUMAN RecName: Full=Solute carrier family 22 member
   42::250     2e-04  23%  514 aa  QACA_STAAU RecName: Full=Antiseptic resistance protein;
   42::250     2e-04  23%  514 aa  QACA_STAAM RecName: Full=Antiseptic resistance protein;
  102::212     2e-04  22%  539 aa  PLT5_ARATH RecName: Full=Polyol transporter 5;AltName:
   92::202     2e-04  24%  511 aa  PLT1_ARATH RecName: Full=Putative polyol transporter 1;
  331::526     2e-04  26%  545 aa  MOT8_RAT RecName: Full=Monocarboxylate transporter 8;       
   45::321     2e-04  25%  466 aa  BENK_ACIAD RecName: Full=Benzoate transport protein;
   96::240     2e-04  26%  516 aa  YN2F_SCHPO RecName: Full=Uncharacterized MFS-type transporter
  143::290     2e-04  28%  547 aa  YCT4_SCHPO RecName: Full=Uncharacterized transporter C794.04c;
   44::261     2e-04  24%  382 aa  YCAD_SALEP RecName: Full=Uncharacterized MFS-type transporter ycaD;
   36::277     2e-04  27%  402 aa  YBJJ_ECOLI RecName: Full=Inner membrane protein ybjJ;
   67::232     2e-04  21%  514 aa  SPNS3_MOUSE RecName: Full=Protein spinster homolog 3;
   26::346     2e-04  21%  391 aa  MDTL_SHIF8 RecName: Full=Multidrug resistance protein mdtL;
   76::249     2e-04  23%  400 aa  MDTH_SHIBS RecName: Full=Multidrug resistance protein mdtH;
   38::217     2e-04  24%  495 aa  GTR3_CANFA RecName: Full=Solute carrier family 2, facilitated
    5::192     2e-04  22%  398 aa  BCR_HAEIN RecName: Full=Bicyclomycin resistance protein homolog;
   22::267     2e-04  18%  409 aa  BCRH_RICTY RecName: Full=Uncharacterized transporter RT0591;
   84::208     3e-04  28%  482 aa  YFIG_BACSU RecName: Full=Putative metabolite transport protein
  190::308     3e-04  27%  687 aa  YD199_YEAST RecName: Full=Putative metabolite transport protein
   44::261     3e-04  26%  382 aa  YCAD_ESCF3 RecName: Full=Uncharacterized MFS-type transporter ycaD;
  141::261     3e-04  29%  382 aa  Y1421_ENT38 RecName: Full=Uncharacterized MFS-type transporter
    4::172     3e-04  24%  394 aa  TSGA_SERP5 RecName: Full=Protein tsgA homolog;
    3::172     3e-04  25%  393 aa  TSGA_SALTI RecName: Full=Protein tsgA;
    3::172     3e-04  25%  393 aa  TSGA_SALSV RecName: Full=Protein tsgA;
    3::172     3e-04  25%  393 aa  TSGA_SALNS RecName: Full=Protein tsgA;
    3::172     3e-04  25%  393 aa  TSGA_SALAR RecName: Full=Protein tsgA;
    3::172     3e-04  25%  393 aa  TSGA_SALA4 RecName: Full=Protein tsgA;
  151::257     3e-04  28%  548 aa  S22A7_HUMAN RecName: Full=Solute carrier family 22 member
  158::286     3e-04  24%  554 aa  S22A1_RABIT RecName: Full=Solute carrier family 22 member
   76::251     3e-04  21%  402 aa  MDTH_SHIF8 RecName: Full=Multidrug resistance protein mdtH;
   76::251     3e-04  24%  402 aa  MDTH_SALTI RecName: Full=Multidrug resistance protein mdtH;
   76::251     3e-04  24%  402 aa  MDTH_SALSV RecName: Full=Multidrug resistance protein mdtH;
   76::251     3e-04  24%  402 aa  MDTH_SALPK RecName: Full=Multidrug resistance protein mdtH;
   76::251     3e-04  24%  402 aa  MDTH_SALPC RecName: Full=Multidrug resistance protein mdtH;
   76::251     3e-04  24%  402 aa  MDTH_SALPB RecName: Full=Multidrug resistance protein mdtH;
   76::251     3e-04  24%  402 aa  MDTH_SALPA RecName: Full=Multidrug resistance protein mdtH;
   76::251     3e-04  24%  402 aa  MDTH_SALNS RecName: Full=Multidrug resistance protein mdtH;
   76::251     3e-04  24%  402 aa  MDTH_SALHS RecName: Full=Multidrug resistance protein mdtH;
   76::251     3e-04  24%  402 aa  MDTH_SALG2 RecName: Full=Multidrug resistance protein mdtH;
   76::251     3e-04  24%  402 aa  MDTH_SALEP RecName: Full=Multidrug resistance protein mdtH;
   76::251     3e-04  24%  402 aa  MDTH_SALDC RecName: Full=Multidrug resistance protein mdtH;
   76::251     3e-04  24%  402 aa  MDTH_SALCH RecName: Full=Multidrug resistance protein mdtH;
   76::251     3e-04  24%  402 aa  MDTH_SALA4 RecName: Full=Multidrug resistance protein mdtH;
   93::203     3e-04  27%  478 aa  GTR8_RAT RecName: Full=Solute carrier family 2, facilitated glucose
   93::203     3e-04  27%  477 aa  GTR8_MOUSE RecName: Full=Solute carrier family 2, facilitated
   70::217     3e-04  26%  494 aa  GTR3_SHEEP RecName: Full=Solute carrier family 2, facilitated
   62::218     3e-04  27%  492 aa  GTR1_BOVIN RecName: Full=Solute carrier family 2, facilitated
   72::220     3e-04  26%  482 aa  EDL16_ARATH RecName: Full=Sugar transporter ERD6-like 16;
   22::183     3e-04  20%  407 aa  BCRH_RICPR RecName: Full=Uncharacterized transporter RP603;
   22::137     3e-04  22%  405 aa  BCRH_RICFE RecName: Full=Uncharacterized transporter RF_0358;
   32::168     4e-04  33%  427 aa  YDFJ_ECOLI RecName: Full=Putative inner membrane metabolite
    3::172     4e-04  25%  393 aa  TSGA_SALPK RecName: Full=Protein tsgA;
    3::172     4e-04  25%  393 aa  TSGA_SALPB RecName: Full=Protein tsgA;
    3::172     4e-04  25%  393 aa  TSGA_SALPA RecName: Full=Protein tsgA;
    3::172     4e-04  25%  393 aa  TSGA_SALHS RecName: Full=Protein tsgA;
    3::172     4e-04  25%  393 aa  TSGA_SALG2 RecName: Full=Protein tsgA;
    3::172     4e-04  25%  393 aa  TSGA_SALEP RecName: Full=Protein tsgA;
    3::172     4e-04  25%  393 aa  TSGA_SALDC RecName: Full=Protein tsgA;
   17::197     4e-04  26%  393 aa  SETB_ECOLI RecName: Full=Sugar efflux transporter B;
  139::246     4e-04  32%  551 aa  S22A6_RABIT RecName: Full=Solute carrier family 22 member
  107::252     4e-04  19%  495 aa  S17A5_MOUSE RecName: Full=Sialin;AltName: Full=Solute carrier
   48::203     4e-04  25%  484 aa  MOT2_MOUSE RecName: Full=Monocarboxylate transporter 2;       
  356::481     4e-04  20%  514 aa  MOT10_RAT RecName: Full=Monocarboxylate transporter 10;       
   76::251     4e-04  22%  401 aa  MDTH_YERE8 RecName: Full=Multidrug resistance protein mdtH;
   76::251     4e-04  21%  404 aa  MDTH_SALAR RecName: Full=Multidrug resistance protein mdtH;
   93::182     4e-04  28%  478 aa  GTR8_BOVIN RecName: Full=Solute carrier family 2, facilitated
   58::217     4e-04  26%  496 aa  GTR3_HUMAN RecName: Full=Solute carrier family 2, facilitated
   69::211     4e-04  25%  492 aa  GTR1_RABIT RecName: Full=Solute carrier family 2, facilitated
  102::185     4e-04  28%  541 aa  GTR10_HUMAN RecName: Full=Solute carrier family 2, facilitated
   75::234     4e-04  25%  496 aa  ERD6_ARATH RecName: Full=Sugar transporter ERD6;AltName:
   19::184     4e-04  20%  512 aa  EMRY_ECOLI RecName: Full=Multidrug resistance protein Y;
   44::261     5e-04  24%  382 aa  YCAD_SALTY RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::261     5e-04  24%  382 aa  YCAD_SALTI RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::261     5e-04  24%  382 aa  YCAD_SALSV RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::261     5e-04  24%  382 aa  YCAD_SALPK RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::261     5e-04  24%  382 aa  YCAD_SALPC RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::261     5e-04  24%  382 aa  YCAD_SALPA RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::261     5e-04  24%  382 aa  YCAD_SALNS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::261     5e-04  24%  382 aa  YCAD_SALHS RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::261     5e-04  24%  382 aa  YCAD_SALCH RecName: Full=Uncharacterized MFS-type transporter ycaD;
   44::261     5e-04  24%  382 aa  YCAD_SALA4 RecName: Full=Uncharacterized MFS-type transporter ycaD;
    9::94      5e-04  29%  399 aa  TCR1_ECOLX RecName: Full=Tetracycline resistance protein, class A; 
  151::257     5e-04  28%  548 aa  S22A7_PONAB RecName: Full=Solute carrier family 22 member
  139::246     5e-04  29%  551 aa  S22A6_RAT RecName: Full=Solute carrier family 22 member 6;AltName:
   92::240     5e-04  31%  545 aa  S22A6_MOUSE RecName: Full=Solute carrier family 22 member
   76::254     5e-04  24%  402 aa  MDTH_ENTS8 RecName: Full=Multidrug resistance protein mdtH;
   58::195     5e-04  27%  455 aa  GUDP_BACSU RecName: Full=Probable glucarate transporter;AltName:
   67::217     5e-04  26%  494 aa  GTR3_BOVIN RecName: Full=Solute carrier family 2, facilitated
   91::241     5e-04  26%  520 aa  GTR14_HUMAN RecName: Full=Solute carrier family 2, facilitated
   83::193     5e-04  23%  555 aa  GTR10_XENTR RecName: Full=Solute carrier family 2, facilitated
   84::211     5e-04  30%  470 aa  ERDL8_ARATH RecName: Full=Sugar transporter ERD6-like 8;
   45::208     5e-04  24%  470 aa  ERDL5_ARATH RecName: Full=Sugar transporter ERD6-like 5;
   79::228     7e-04  21%  525 aa  YQEH_SCHPO RecName: Full=Uncharacterized transporter C576.17c;
   44::261     7e-04  24%  382 aa  YCAD_SALPB RecName: Full=Uncharacterized MFS-type transporter ycaD;
   70::188     7e-04  24%  454 aa  YAJR_ECOLI RecName: Full=Inner membrane transport protein yajR;
    3::172     7e-04  24%  393 aa  TSGA_SHIB3 RecName: Full=Protein tsgA;
    3::172     7e-04  24%  393 aa  TSGA_ECOUT RecName: Full=Protein tsgA;
    3::172     7e-04  24%  393 aa  TSGA_ECOSM RecName: Full=Protein tsgA;
    3::172     7e-04  24%  393 aa  TSGA_ECOSE RecName: Full=Protein tsgA;
    3::172     7e-04  24%  393 aa  TSGA_ECOLI RecName: Full=Protein tsgA;
    3::172     7e-04  24%  393 aa  TSGA_ECOL6 RecName: Full=Protein tsgA;
    3::172     7e-04  24%  393 aa  TSGA_ECOL5 RecName: Full=Protein tsgA;
    3::172     7e-04  24%  393 aa  TSGA_ECOK1 RecName: Full=Protein tsgA;
    3::172     7e-04  24%  393 aa  TSGA_ECODH RecName: Full=Protein tsgA;
    3::172     7e-04  24%  393 aa  TSGA_ECOBW RecName: Full=Protein tsgA;
    3::172     7e-04  24%  393 aa  TSGA_ECO8A RecName: Full=Protein tsgA;
    3::172     7e-04  24%  393 aa  TSGA_ECO81 RecName: Full=Protein tsgA;
    3::172     7e-04  24%  393 aa  TSGA_ECO5E RecName: Full=Protein tsgA;
    3::172     7e-04  24%  393 aa  TSGA_ECO57 RecName: Full=Protein tsgA;
    3::172     7e-04  24%  393 aa  TSGA_ECO55 RecName: Full=Protein tsgA;
    3::172     7e-04  24%  393 aa  TSGA_ECO45 RecName: Full=Protein tsgA;
    3::172     7e-04  24%  393 aa  TSGA_ECO27 RecName: Full=Protein tsgA;
    3::172     7e-04  24%  393 aa  TSGA_ECO24 RecName: Full=Protein tsgA;
  107::191     7e-04  41%  507 aa  STP8_ARATH RecName: Full=Sugar transport protein 8;AltName:
   50::195     7e-04  27%  392 aa  SETA_ECOLI RecName: Full=Sugar efflux transporter A;
   40::192     7e-04  22%  413 aa  MUCK_ACIAD RecName: Full=Cis,cis-muconate transport protein;
  279::393     7e-04  22%  428 aa  MOT13_RAT RecName: Full=Monocarboxylate transporter 13;       
   76::251     7e-04  22%  401 aa  MDTH_YERPY RecName: Full=Multidrug resistance protein mdtH;
   76::251     7e-04  22%  401 aa  MDTH_YERPS RecName: Full=Multidrug resistance protein mdtH;
   76::251     7e-04  22%  401 aa  MDTH_YERPP RecName: Full=Multidrug resistance protein mdtH;
   76::251     7e-04  22%  401 aa  MDTH_YERPN RecName: Full=Multidrug resistance protein mdtH;
   76::251     7e-04  22%  401 aa  MDTH_YERPG RecName: Full=Multidrug resistance protein mdtH;
   76::251     7e-04  22%  401 aa  MDTH_YERPE RecName: Full=Multidrug resistance protein mdtH;
   76::251     7e-04  22%  401 aa  MDTH_YERPB RecName: Full=Multidrug resistance protein mdtH;
   76::251     7e-04  22%  401 aa  MDTH_YERPA RecName: Full=Multidrug resistance protein mdtH;
   76::251     7e-04  22%  401 aa  MDTH_YERP3 RecName: Full=Multidrug resistance protein mdtH;
   76::251     7e-04  19%  405 aa  MDTH_SODGM RecName: Full=Multidrug resistance protein mdtH;
  100::255     7e-04  26%  523 aa  GTR2_MOUSE RecName: Full=Solute carrier family 2, facilitated
  171::220     7e-04  32%  472 aa  EXUT_ECOLI RecName: Full=Hexuronate transporter;
  171::220     7e-04  32%  472 aa  EXUT_ECO57 RecName: Full=Hexuronate transporter;
   45::211     7e-04  27%  478 aa  EDL18_ARATH RecName: Full=Sugar transporter ERD6-like 18;AltName:
   37::261     9e-04  27%  382 aa  Y2171_CITK8 RecName: Full=Uncharacterized MFS-type transporter
    3::172     9e-04  24%  393 aa  TSGA_SHISS RecName: Full=Protein tsgA;
    3::172     9e-04  24%  393 aa  TSGA_SHIFL RecName: Full=Protein tsgA;
    3::172     9e-04  24%  393 aa  TSGA_SHIF8 RecName: Full=Protein tsgA;
    3::172     9e-04  24%  393 aa  TSGA_SHIDS RecName: Full=Protein tsgA;
    3::172     9e-04  24%  393 aa  TSGA_SHIBS RecName: Full=Protein tsgA;
   21::172     9e-04  27%  394 aa  TSGA_ERWT9 RecName: Full=Protein tsgA homolog;
    3::172     9e-04  24%  393 aa  TSGA_ECOLU RecName: Full=Protein tsgA;
    3::172     9e-04  24%  393 aa  TSGA_ECOLC RecName: Full=Protein tsgA;
    3::172     9e-04  24%  393 aa  TSGA_ECOHS RecName: Full=Protein tsgA;
    3::172     9e-04  24%  393 aa  TSGA_ECO7I RecName: Full=Protein tsgA;
    2::97      9e-04  33%  400 aa  TCR8_PASMU RecName: Full=Tetracycline resistance protein, class H; 
   91::229     9e-04  27%  513 aa  STP7_ARATH RecName: Full=Sugar transport protein 7;AltName:
   53::189     9e-04  24%  729 aa  MSSP3_ARATH RecName: Full=Monosaccharide-sensing protein 3;AltName:
  331::526     9e-04  25%  545 aa  MOT8_MOUSE RecName: Full=Monocarboxylate transporter 8;       
  325::498     9e-04  25%  539 aa  MOT8_HUMAN RecName: Full=Monocarboxylate transporter 8;       
  121::254     9e-04  23%  407 aa  MDTH_BLOPB RecName: Full=Multidrug resistance protein mdtH;
   91::244     9e-04  22%  546 aa  HXT10_YEAST RecName: Full=Hexose transporter HXT10;
   89::254     9e-04  24%  510 aa  GTR2_BOVIN RecName: Full=Solute carrier family 2, facilitated
   69::218     9e-04  25%  492 aa  GTR1_RAT RecName: Full=Solute carrier family 2, facilitated glucose
   69::218     9e-04  25%  492 aa  GTR1_MOUSE RecName: Full=Solute carrier family 2, facilitated
    1::408

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSEYNASASKSTKLILTALALGVFGVGVTEFVPVGLLPQIANTFDTSIATTGWVISSYAAGVMVGAPIMT
YDHP_ECOLI      ---------------LLALAIGAFGIGTTEFSPMGLLPVIARGVDVSIPAAGMLISAYAVGVMVGAPLMT
YDHP_ECO57      ---------------LLALAIGAFGIGTTEFSPMGLLPVIARGVDVSIPAAGMLISAYAVGVMVGAPLMT
YFHI_BACSU      ----------SVKFIIFVLMICTFSIGYTEYAVMGILTSIANDFHIQVSSAGLLVTAYAASVCLTGPLVT
YTBD_BACSU      ------SANKSNIPALLALAVSAFAIGTTEFISVGXXXXXXXXXXXXVTTAGLTVSLYALGVTFGAPILT
ARAJ_ECOLI      ------------KKVILSLALGTFGLGMAEFGIMGVLTELAHNVGISIPAAGHMISYYALGVVVGAPIIA
SOTB_CITK8      ----NTVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIARSFAMPTAQVGIMLTIYAWVVALMSLPFM
PBUE_BACAM      ------------------LAASTIAVGLVELIVGGILPQIASDLDISIVSAGQLISVFALGYAVSGPLLL
SOTB_ERWCH      ----SASPSRSTALRVVTLAIAAFIFNTTEFIPVGLLSDIANSFAMKTEDVGLMITIYAWIVAVASLICM
PBUE_BACSU      ------------------LAASTIAVGLVELIVGGILPQIANDLDISIVSAGQLISVFALGYAVSGPLLL
SOTB_HAEIN      MSLYKAEKIQSWRVLIMACAGFIFNT--TEFVPVAMLSDIAQSFDMQTADTGLMMTVYAWTVLIMSLPAM
SOTB_HAEIG      -----AEKIQSWRVLIMACAGFIFNT--TEFVPVAMLSDIAQSFDMQTADTGLMMTVYAWTVLIMSLPAM
SOTB_HAEI8      MSLYKAEKIQSWRVLIMACAGFIFNT--TEFVPVAMLSDIAQSFDMQTADTGLMMTVYAWTVLIMSLPAM
YBCL_BACSU      ------------------LAIVSFLVGTSEYIISGILDQIAHTLGITLAAAGQLITIFSLVYALSTPVLM
SOTB_ECOLU      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_PSEA7      -------------LSVIALALAAFIFNTTEFVPVGLLSDIGHSFDMPTSQVGLMLTIYAWVVSLASLPMM
SOTB_HELPG      ------SYQKFALMRVFVFSLSAFIFNTTEFVPVALLSDIAKSFEMESATVGLMITAYAWVVSLGSLPLM
SOTB_SALNS      ----NPVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFM
SOTB_SHIFL      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_SALSV      ----NPVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFM
SOTB_SHIF8      MTTYTVSRKVAWLRVVT-LAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
NEPI_SHISS      ---------------------------IVEFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFASLFIT
SOTB_SALTI      ----NPVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFM
SOTB_SALPB      ----NPVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFM
SOTB_SALHS      ----NPVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFM
SOTB_SALG2      ----NPVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFM
SOTB_SALEP      ----NPVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFM
SOTB_SALDC      ----NPVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFM
SOTB_SALA4      ----NPVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFM
SOTB_SALPC      ----NPVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFM
SOTB_SALCH      ----NPVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFM
SOTB_ECO5E      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
NEPI_ECOL5      MSEFNRGANAITRPNWSAVFSVAFCVAIVEFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFASLFIT
SOTB_SALAR      ----NPVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFM
NEPI_ECOL6      MSEFNRGANAITRPNWSAVFSVAFCVAIVEFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFASLFIT
SOTB_SALTY      ----NPVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFM
SOTB_SALPK      ----NPVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFM
SOTB_SALPA      ----NPVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAESFHMQTAQVGIMLTIYAWVVAVMSLPFM
SOTB_ECOL5      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAHSFHMQTAQVGIMLTIYAWVVALMSLPFM
NEPI_ECOUT      ---------------------------IVEFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFASLFIT
NEPI_ECOK1      ---------------------------IVEFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFASLFIT
NEPI_ECO27      ---------------------------IVEFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFASLFIT
SOTB_ECOUT      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAHSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_ECOL6      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAHSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_ECOK1      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAHSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_ECO81      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAHSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_ECO45      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAHSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_ECO27      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAHSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_SHISS      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_SHIBS      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_SHIB3      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_ESCF3      ----NTVTRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAASFHMETAQTGIMLTIYAWVVALMSLPFM
SOTB_ECOSM      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_ECOSE      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_ECOLI      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_ECOLC      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_ECOHS      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_ECODH      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_ECOBW      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_ECO8A      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_ECO7I      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_ECO55      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_ECO24      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
SOTB_ECO57      ----NTVSRKVAWLRVVTLAVAAFIFNTTEFVPVGLLSDIAQSFHMQTAQVGIMLTIYAWVVALMSLPFM
NEPI_SHIDS      ---------------------------IVEFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFASLFIT
NEPI_ECO57      ---------------------------IVEFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFASLFIT
NEPI_SHIFL      ---------------------------IVEFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFASLFIT
NEPI_SHIF8      ---------------------------IVEFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFASLFIT
NEPI_ECOLI      ---------------------------IVEFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFASLFIT
NEPI_ECOBW      ---------------------------IVEFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFASLFIT
SOTB_HELAH      ------SYKKLALMRVFVFSLSAFIFNTTEFVPIALLSDIAKSFEMESASVGLMITLYAWIVSLGSLPLM
SOTB_ERWT9      ---------KTAWLRVLMLAIAAFIFNTTEFVPVGLLSDIGSSFSMQTAQVGLMLTIYAWVVALMSLPMM
NEPI_SHIBS      ---------------------------IVEFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFASLFIT
SOTB_KLEP7      ----NTVSRKVAWLRVVTLAIAAFIFNTTEFAPVGLLSDIADSFGMETAQVGMMLTIYAWVVALMSLPFM
SOTB_HELPH      ------SYQKFALMRVFVFSLSAFIFNTTEFVPVALLSDIAKSFEMESATVGLMITAYAWVVSLGSLPLM
SOTB_ENT38      ----NTVSRKVAWLRVVTLAIAAFIFNTTEFVPVGLLSDIAQSFQMETAQVGIMLTIYAWVVALMSLPFM
SOTB_HELP2      ------SYQKFALMRVFVFSLSAFIFNTTEFVPVALLSDIAKSFEMESATVGLMITAYAWVVSLGSLPLM
SOTB_HELPY      ------SYQKFALMRVFVFSLSAFIFNTTEFVPVALLSDIAKSFEMESATVGLMITAYAWVVSLGSLPLM
SOTB_HELPJ      -------------------SLSAFIFNTTEFVPVALLSDIAKSFEMESATVGLMITAYAWVVSLGSLPLM
SOTB_PSE14      -----------------ALALAAFIFNTTEFVPIGLLSNIGQSFEMTPAQVGLMLTIYAWVVSLMSLPMM
SOTB_KLEP3      ----NTVSRKVAWLRVVTLAIAAFIFNTTEFAPVGLLSDIAGSFGMETAQVGMMLTIYAWVVALMSLPFM
SOTB_PSEAE      -------------LSVIALALAAFIFNTTEFVPVGLLSDIGHSFEMPTSQVGLMLTIYAWVVSLASLPMM
SOTB_PSEAB      -------------LSVIALALAAFIFNTTEFVPVGLLSDIGHSFEMPTSQVGLMLTIYAWVVSLASLPMM
SOTB_PSEA8      -------------LSVIALALAAFIFNTTEFVPVGLLSDIGHSFEMPTSQVGLMLTIYAWVVSLASLPMM
SOTB_PASMU      MLPFQAARQRQFARVIT-FALAGFVFNTTEFIPVALLSDIAQSFAMPVSQTGLIITVYAWVVSLMSLPFM
CMLR_STRLI      -------------LPLYLLAVAVCAMGTSEFMLAGLVPDIASDXXXXXXXXXXXXSAFATGMIVGAPLVA
SOTB_PSEU2      -----------------ALALAAFIFNTTEFVPIGLLSNIGQSFEMTPAQVGLMLTIYAWVVSLMSLPMM
SOTB_PSESM      -----------------ALALAAFIFNTTEFVPIGLLSNIGQSFDMTPAQVGLMLTIYAWVVSLMSLPMM
SOTB_PSEE4      ------TAGNGSWLSVIALALAAFIFNTTEFVPVALLSDIGRSFDMTTAQVGLMLTIYAWVVALASLPMM
YWFA_BACSU      -------------LLALALTMGVFAAGSEELVISPLLPDLAKAFSSDVSVLALSISIYGVMIFIGAPLLV
NEPI_SALPK      -----------------------------EFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFSSLFIT
NEPI_SALPA      -----------------------------EFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFSSLFIT
NEPI_SALG2      -----------------------------EFLPVSLLTPMAQDLGISEGIAGQSVTVTAFVAMFSSLFIT
NEPI_SALEP      -----------------------------EFLPVSLLTPMAQDLGISEGIAGQSVTVTAFVAMFSSLFIT
NEPI_SALTY      -----------------------------EFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFSSLFIT
NEPI_SALTI      -----------------------------EFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFSSLFIT
NEPI_SALPC      -----------------------------EFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFSSLFIT
NEPI_SALPB      -----------------------------EFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFSSLFIT
NEPI_SALCH      -----------------------------EFLPVSLLTPMAQDLGISEGVAGQSVTVTAFVAMFSSLFIT
OPDE_PSEAE      -----------------AIAVCAFALVASEFLPVSLLTPIANDLGTTEGMAGQGIAISGAFAVLTSLFIS
SOTB_PSEPK      -------------LSVIALALAAFIFNTTEFVPVALLSDIGRSFDMSTAQVGLMLTIYAWIVALASLPMM
SOTB_PSEPG      -------------LSVIALALAAFIFNTTEFVPVALLSDIGRSFDMSTAQVGLMLTIYAWVVALASLPMM
SOTB_PSEPW      -------------LSVIALALAAFIFNTTEFVPVALLSDIGRSFDMSTAQVGLMLTIYAWVVALASLPMM
SOTB_MANSM      ------------------MAFAAFVFNTTEFVPVALLSDIADSFQMPVSNTGLMITIYAWIVSLCSLPCM
SOTB_ERWCT      -------------LRVVSLSLAAFIFNTAEFAPVALLSDIAASFSMSAAQVGLIITIYAWVVLMSLPCM-
YCEJ_BACSU      ----------------------MFVIGTDTFXXXXXXXXXQDQFHVSTDLSGWMVSAYALGYALFAFIAG
GALP_ECOLI      -------------------------------VIAGALPFIADEFQITSHTQEWVVSSMMFGAAVGAVGSG
GALP_ECOL6      -------------------------------VIAGALPFIADEFQITSHTQEWVVSSMMFGAAVGAVGSG
YCNB_BACSU      -------------VIVGILLAGAFVAILNQTLLITALPHIMRDFNVDANQAQWLTTSFMLTNGILIPITA
YFIU_BACSU      ---------KSQKWAISLFTIGVFMAALDNGIISAALTTINESFSVSPSWGSWGITLYTLGLSVSVPIVG
YHCA_BACSU      --------AKNPMSLLIVLMAGLFLAILNQTLLNVAMPHLMTEFGVSATTIQWLTTGYMLVNGVLIPLSA
EXUT_BACSU      --------------------LFLFLAGVINYLDRSALPFIQDDLTLSATQMGLIFSSFSIGYAIFNFLGG
TCR_STRPN       -TSYSQSNLRHNQILIWLCILSFFSV-LNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTAVYG
TCR_BACSU       -TSYSQSNLRHNQILIWLCILSFFSV-LNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTAVYG
TCR_BACST       -TSYSQSNLRHNQILIWLCILSFFSV-LNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTAVYG
TCR_BACCE       -TSYSQSNLRHNQILIWLCILSFFSV-LNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTAVYG
EMRB_HAEIN      ------------------------------------IPTIAGDLGASFSQGTWVITSFGVANAISIPITG
YGAY_ECOLI      -------------IVLMSIATGL--AVASNYYAQPLLDTIARNFSLSASSAGFIVTAAQLGYAAGLLFLV
YGAY_ECO57      -------------IVLMSIATGL--AVASNYYAQPLLDTIARNFSLSASSAGFIVTAAQLGYAAGLLFLV
ARAE_KLEOX      --------------IAAAVAGLLFGLDIG--VIAGALPFITDHFVLSSRLQEWVVSSMMLGAAIGALFNG
SGE1_YEAST      ---------------------------------------------------GWLVTGYALSNAVFMLLWG
TCR_STRAG       -TSYSQSNLRHNQILIWLCILSFFSV-LNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTAVYG
TCRB_BACSU      -TSYSQSTLRHNQVLIWLCVLSFFSV-LNEMVLNVSLPDIANEFNKLPASANWVNTAFMLTFSIGTALYG
YFMO_BACSU      ------SQPKAVWAVAFACVISFMGIGLVD----PILPAIAAQLHASPSEVSLLFTSYLLVTGFMMFFSG
MDTD_PECCP      --------SASVRWQLWIVAFGFFMQTLDTTIVNTALPSMAASLNESPLHMHSVIVSYVLTVAVMLPASG
PCAK_ACIAD      ----DAPLSRYQWLIAIVCFLIVFVDGIDTAAMGFIAPALAQDWGVDRSQLGPVMSAALGGMIIGALVSG
YB30_YEAST      ------------------------------------LPLLQREYDVSATTINATVSVFMAVFSVGPLFWG
TCR_STAHY       -TSYSQSNLRHNQILIWLCILSFFSV-LNEMVLNVSLPDIANDFNKPPASTNWVNTAFMLTFSIGTAVYG
MDTD_YERPS      ----------SVRWQLWIVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASG
MDTD_YERPY      ----------SVRWQLWIVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASG
MDTD_YERPP      ----------SVRWQLWIVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASG
MDTD_YERPN      ----------SVRWQLWIVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASG
MDTD_YERPG      ----------SVRWQLWIVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASG
MDTD_YERPE      ----------SVRWQLWIVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASG
MDTD_YERPB      ----------SVRWQLWIVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASG
MDTD_YERPA      ----------SVRWQLWIVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASG
MDTD_YERP3      ----------SVRWQLWIVAFGFFMQTLDTTIVNTALPSIAASLGENPLRMQSVIVSYVLTVAVMLPASG
MDTD_YERE8      ---------------LWIVAFGFFMQTLDTTIVNTALPSMAASLGENPLRMQSVIVSYVLTVAVMLPASG
ARAE_ECOLI      ----------------------LFGLDIG--VIAGALPFITDHFVLTSRLQEWVVSSMMLGAAIGALFNG
ARAE_ECO57      ----------------------LFGLDIG--VIAGALPFITDHFVLTSRLQEWVVSSMMLGAAIGALFNG
MHPT_ECOLI      ---------------------------------------------------GWIFSAGILGLLPGALVGG
XYLL1_ARATH     -------------------------------------------YDLSSVDVGIITSGSLYGALIGSIVAF
YLD2_CAEEL      -----------------------------EMTPVESNSSVIGEFDWDKQTTGMVLSSFFYGYIGSQIIGG
NANT_YERPY      -----------------------------DFVLITLLTDIKQEFGLTLIQATSLISAAFISRWFGGLVLG
YJA1_SCHPO      -------ARKWTQLILVS-AFALLGPMASSMV-APCLDQIADRFHIQNSTEKALILSFAISPMISAPLSE
YYBF_BACSU      ----------------------------------------------------------------------
YEBQ_ECOLI      ------------------------------------LPTIATDLHATPASSIWVVNAYQIAIVISLLSFS
YWOD_BACSU      -------SKKSRAVFLTAVASGTMLNPLNSSMISLALHSIQHEFHLSFTTVSWLISSFYLASAVAQPVTG
MDTD_SERP5      ---------------LWIVAFGFFMQTLDTTIVNTALPSMAVSLGENPLRMQSVIVSYVLTVAVMLPASG
BMR3_BACSU      ----------STKFVVLGLLLGILMSAMDNTIVATAMGNIVADLG-SFDKFAWVTASYMVAVMAGMPIYG
EDL15_ARATH     ---------------------GAFAFGCIIGYSAPTQTSIMKDLNLSIADYSLFGSILTVGLILGALICG
NANT_YERPS      -----------------------------DFVLITLLTDIKQEFGLTLIQATSLISAAFISRWFGGLVLG
NANT_YERPP      -----------------------------DFVLITLLTDIKQEFGLTLIQATSLISAAFISRWFGGLVLG
NANT_YERPG      -----------------------------DFVLITLLTDIKQEFGLTLIQATSLISAAFISRWFGGLVLG
NANT_YERPE      -----------------------------DFVLITLLTDIKQEFGLTLIQATSLISAAFISRWFGGLVLG
NANT_YERPB      -----------------------------DFVLITLLTDIKQEFGLTLIQATSLISAAFISRWFGGLVLG
NANT_YERPA      -----------------------------DFVLITLLTDIKQEFGLTLIQATSLISAAFISRWFGGLVLG
NANT_YERP3      -----------------------------DFVLITLLTDIKQEFGLTLIQATSLISAAFISRWFGGLVLG
NANT_SALAR      -----------------------------DFVLIALLTEVQSEFGLTTVQAASLISAAFISRWFGGLLLG
LMRB_LISMO      ------------------------------------LSDLIQVFDISSATVQWXXXXXXXXXXXXVPISG
XYLL3_ARATH     --------------IFPALGGLLFGIGATSGATLSLQPALSGTFNFSPVQLGLVVSGSLYGALLGSISVY
NANT_CITK8      ------------------------------------------------------ISRWFGGLMLGA----
MFSD8_HUMAN     --EHYKSRWRSIRILYLTMFLSSVGFSVVMMSIWPYLQKIDPTADTSFL--GWVIASYSLGQMVASPIFG
LMRB_LISIN      ------------------------------------LSDLIQVFDISSATVQWXXXXXXXXXXXXVPISG
SPIN_DROME      ------------------------------FTIAGVLTDVRNDFDIGNDSAGLLQTVFVISYMVCAPIFG
NANT_ESCF3      ------------------------------------------------------ISRWFGGLMLGA----
SPNS3_DANRE     ----------------------------------GVLLRIQKFFFISDSTSGLLQTVFICSFMFLAPVFG
NANT_SALTY      -----------------------------DFVLIALLTEVQSEFGLTTVQAASLISAAFISRWFGGLLLG
NANT_SALTI      -----------------------------DFVLIALLTEVQSEFGLTTVQAASLISAAFISRWFGGLLLG
NANT_SALSV      -----------------------------DFVLIALLTEVQSEFGLTTVQAASLISAAFISRWFGGLLLG
NANT_SALPK      -----------------------------DFVLIALLTEVQSEFGLTTVQAASLISAAFISRWFGGLLLG
NANT_SALPC      -----------------------------DFVLIALLTEVQSEFGLTTVQAASLISAAFISRWFGGLLLG
NANT_SALPB      -----------------------------DFVLIALLTEVQSEFGLTTVQAASLISAAFISRWFGGLLLG
NANT_SALPA      -----------------------------DFVLIALLTEVQSEFGLTTVQAASLISAAFISRWFGGLLLG
NANT_SALNS      -----------------------------DFVLIALLTEVQSEFGLTTVQAASLISAAFISRWFGGLLLG
NANT_SALHS      -----------------------------DFVLIALLTEVQSEFGLTTVQAASLISAAFISRWFGGLLLG
NANT_SALG2      -----------------------------DFVLIALLTEVQSEFGLTTVQAASLISAAFISRWFGGLLLG
NANT_SALEP      -----------------------------DFVLIALLTEVQSEFGLTTVQAASLISAAFISRWFGGLLLG
NANT_SALDC      -----------------------------DFVLIALLTEVQSEFGLTTVQAASLISAAFISRWFGGLLLG
NANT_SALCH      -----------------------------DFVLIALLTEVQSEFGLTTVQAASLISAAFISRWFGGLLLG
MFSD8_MOUSE     --EHYKSRWKSVRILYLTMFLSSVGFSIVIMSIWPYLQKIDQTADASFL--GWVIASYSLGQMVASPLFG
EDL14_ARATH     ---------------------------------------IMKDLNLSIADFSFFGSILTVGLILGALICG
YMPB_CAEEL      --------------------------GIAENTLVNVTNQKASTVDFDLSCSHWFLTIFTIGAVIAVPFMS
VBA5_YEAST      --------------------------------------------------TGWLVTGYSLPNAILSLIWG
MDTM_ECO57      ----------------------------TDLIQPGII-NVVRDFNADVSLAPAAVSLYLAGGMALQWLLG
YWTG_BACSU      -------------------------------------------------TEGLVVSSLLVGAILGSGAAG
NANT_SHIFL      ------------------------------------------------------ISRWFGGLMLGA----
NANT_SHIF8      ------------------------------------------------------ISRWFGGLMLGA----
NANT_SHIB3      ------------------------------------------------------ISRWFGGLMLGA----
NANT_ECOSM      ------------------------------------------------------ISRWFGGLMLGA----
NANT_ECOSE      ------------------------------------------------------ISRWFGGLMLGA----
NANT_ECOLI      ------------------------------------------------------ISRWFGGLMLGA----
NANT_ECOLC      ------------------------------------------------------ISRWFGGLMLGA----
NANT_ECOL5      ------------------------------------------------------ISRWFGGLMLGA----
NANT_ECOHS      ------------------------------------------------------ISRWFGGLMLGA----
NANT_ECODH      ------------------------------------------------------ISRWFGGLMLGA----
NANT_ECOBW      ------------------------------------------------------ISRWFGGLMLGA----
NANT_ECO8A      ------------------------------------------------------ISRWFGGLMLGA----
NANT_ECO7I      ------------------------------------------------------ISRWFGGLMLGA----
NANT_ECO5E      ------------------------------------------------------ISRWFGGLMLGA----
NANT_ECO57      ------------------------------------------------------ISRWFGGLMLGA----
NANT_ECO55      ------------------------------------------------------ISRWFGGLMLGA----
NANT_ECO45      ------------------------------------------------------ISRWFGGLMLGA----
NANT_ECO27      ------------------------------------------------------ISRWFGGLMLGA----
NANT_ECO24      ------------------------------------------------------ISRWFGGLMLGA----
NANT1_ECOL6     ------------------------------------------------------ISRWFGGLMLGA----
MDTD_ERWCT      ----------SVRWQLWIVAFGFFMQTLDTTIVNTALPSMAASLNESPLHMHSVIVSYVLTVAVMLPASG
YYAJ_BACSU      --------------VLTALGIVYFFDLADLFTLSNVAPALIEHWGIPLSTIANVTAASFLGMFLGASLGG
MDTD_SALPB      ----------NTRWQLWIVALGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLPASG
MDTD_SALHS      ----------NTRWQLWIVALGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLPASG
AZR1_YEAST      -----------------------------------IIEEVAKQFG-SYSEIGWLFTGYSLPNALLALIWG
YIZG_SCHPO      ---------------------------------------------------------------------T
GHT3_SCHPO      ---------------------------------------ISNSYSYSAWRQALLTGTINAGCLFGAMLSS
MDTD_SALSV      ----------NTRWQLWIVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLPASG
MDTD_KLEP3      ----------SVRWQLWIVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMIIVSYVLTVAVMLPASG
MDTD_ESCF3      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_SHISS      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_SHIFL      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_SHIBS      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_SHIB3      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_KLEP7      ----------SVRWQLWIVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMIIVSYVLTVAVMLPASG
MDTD_ECOUT      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECOSM      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECOSE      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECOLI      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECOLC      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECOL5      ----------STRWRLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECOK1      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECOHS      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECODH      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECOBW      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECO8A      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECO7I      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECO5E      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECO57      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECO55      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECO45      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECO27      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECO24      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
TCR_STAES       ------------------------------------LPDIANHFNTTPGITNWVNTAYMLTFSIGTAVYG
TCR_STAAU       ------------------------------------LPDIANHFNTTPGITNWVNTAYMLTFSIGTAVYG
SPNS2_XENTR     --ELESSSSKPDKAYASVAAAGILSVGLDRYTVAGVLLDIQQHFEVKDSGAGLLQTVFICSFMVAAPIFG
MDTD_SALTY      ----------NTRWQLWIVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLPASG
MDTD_SALTI      ----------NTRWQLWIVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLPASG
MDTD_SALPK      ----------NTRWQLWIVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLPASG
MDTD_SALPA      ----------NTRWQLWIVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLPASG
MDTD_SALNS      ----------NTRWQLWIVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLPASG
MDTD_SALEP      ----------NTRWQLWIVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLPASG
MDTD_SALA4      ----------NTRWQLWIVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLPASG
MDTD_ENT38      ---------------LWIVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_ECO81      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
GHT7_SCHPO      --------------------------------------QITNSYSYSSSRQGLITGMVNVGSFFGCLLSS
GHT4_SCHPO      ---------------------------------------ITNSYSYSAWRQALLTGTVNAGCLFGAMLSS
MDTD_SHIF8      ----------STRWQLWIVAFGFFMQSLDTTIVNTAIPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
HGT1_KLULA      -------------------------------------------------TYGGITASMAGGSFLGSLISP
CSBC_BACSU      ----------------------------------GALLFINNDIPLTTLTEGLVVSMLLLGAIFGSALSG
QAY_NEUCR       ------------------------------------LPSFTKEFDFASYTPGAIVSVYQAGAFFGCLFAY
MDTM_ECOLI      ----------------------------TDLIQPGII-NVVRDFNADVSLAPAAVSLYLAGGMALQWLLG
MDTD_SALDC      ----------NTRWQLWIVAFGFFMQSLDTTIVNTALPSMAKSLGESPLHMHMVVVSYVLTVAVMLPASG
MDTD_ECOLU      ----------NTRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
MDTD_CITK8      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMALSLGESPLHMHMVVVSYVLTVAVMLPASG
LMRB_BACSU      --ETTAKASQQYKVMPIMISLLLAGIGMFSETALNILTDLMKELNITAATVQWLTTGYLLVLGILVPVSG
YJHB_ECOLI      ---------------------------------------------------------------IGGGFFG
ORCT_DROME      -------------------------------------------------------SLFMLGVLLGSLIFG
MDTD_ENTS8      ---------------LWIVAFGFFMQALDTTIVNTALPSMAASLGESPLRMHMVIVSYVLTVAVMLPASG
MDTD_ECOL6      ----------STRWQLWIVAFGFFMQSLDTTIVNTALPSMAQSLGESPLHMHMVIVSYVLTVAVMLPASG
YDER_BACSU      ----------------------------------------------------------------------
OCTL_DROME      -------------------------------------------------------SLFMLGVLLGSIVFG
MDTL_SALAR      ------------------------------------LPRIAADLNASEAQLHIAFSVYLAGMATAMLFAG
YAN6_SCHPO      ----------------------------------------------------WIGTAYTLAQTSILPFCG
SV2C_MOUSE      ------------------LGMALMADGVEVFVVGFVLPSAETDLCIPNSGSGWLGSIVYLGMMVGAFFWG
SV2C_RAT        ------------------LGMALMADGVEVFVVGFVLPSAETDLCIPNSGSGWLGSIVYLGMMVGAFFWG
MDTL_SALHS      ------------RFLLCSFALVLLYPAGIDMYLVGL-PRIAADLNASEAQLHIAFSVYLAGMATAMLFAG
MDTL_SALEP      ------------RFLLCSFALVLLYPAGIDMYLVGL-PRIAADLNASEAQLHIAFSVYLAGMATAMLFAG
MDTL_SALDC      ------------RFLLCSFALVLLYPAGIDMYLVGL-PRIAADLNASEAQLHIAFSVYLAGMATAMLFAG
GHT1_SCHPO      ---------------------------------------VTDTYSYSSARQGLITGMVNVGSFFGCLISS
ERDL7_ARATH     ---------------------------------------IRNDLSLTIAEFSLFGSLLTFGAMIGAPIAD
STP5_ARATH      --------------------------------------------------TAFTSSLYVAG-LVASLVAS
MDTL_SALPB      ------------RFLLCSFALVLLYPAGIDMYLVGL-PRIAADLNASEAQLHIAFSVYLAGMATAMLFAG
MDTL_SALNS      ------------RFLLCSFALVLLYPAGIDMYLVGL-PRIAADLNASEAQLHIAFSVYLAGMATAMLFAG
MDTL_SALA4      ------------RFLLCSFALVLLYPAGIDMYLVGL-PRIAADLNASEAQLHIAFSVYLAGMATAMLFAG
CITH_KLEPN      ---------------------------------------IAHTFSSEFASLMMTFAVFGAGFLIGAIVLG
BCRH_RICBR      ---------------------------ITETIYTSGLPSITEYFNTDGSTTQITSSLYYLGFALGILTLG
Y466_BUCAI      ----------------------------------------------------------------------
SV2C_HUMAN      ------------------LGMALMADGVEVFVVGFVLPSAETDLCIPNSGSGWLGSIVYLGMMVGAFFWG
S22A2_RAT       ---------------------------------------VYNTPGSSIVTESWMLDLFQSGFFIGAMMIG
PLT3_ARATH      ----------------------------------------------------------------------
MDTL_SALTY      ------------RFLLCSFALVLLYPAGIDMYLVGL-PRIAADLNASEAQLHIAFSVYLAGMATAMLFAG
GTR1_LEIDO      ----------------------------------------------------------------------
GHT2_SCHPO      ---------------------------------------ITDQYSLSSARQGLLTGMVNVGSLFGCIISS
ERDL9_ARATH     ------SANTTPFLVFTTFIIASFSFGVALGHTAGTMASIMEDLDLSITQFSVFGSLLTFGGMIGALFSA
BMR2_BACSU      -------------ILLSNIFVAFLGIGL--IIPV--MPSFMKIMHLSGSTMGYLVAAFAISQLITSPFAG
PLT6_ARATH      ----------------------------------------------------------------------
MDTL_SALSV      ------------RFLLCSFALVLLYPAGIDMYLVGL-PRIAADLNASEAQLHIAFSVYLAGMATAMLFAG
MDTL_SALPK      ------------RFLLCSFALVLLYPAGIDMYLVGL-PRIAADLNASEAQLHIAFSVYLAGMATAMLFAG
MDTL_SALPC      ------------RFLLCSFALVLLYPAGIDMYLVGL-PRIAVDLNASESQLHIAFSVYLAGMATAMLFAG
MDTL_SALPA      ------------RFLLCSFALVLLYPAGIDMYLVGL-PRIAADLNASEAQLHIAFSVYLAGMATAMLFAG
MDTL_SALCH      ------------RFLLCSFALVLLYPAGIDMYLVGL-PRIAVDLNASESQLHIAFSVYLAGMATAMLFAG
GTR6_HUMAN      --------NKRVFLATFAAVLGNFSFGYALVYTSPVIPALERSLDPDLHLTSWFGSVFTLGAAAGGLSAM
ENB1_YEAST      ---FGVTFSSLKTALLVALFLQGYCTGLGGQISQSIQTYAANSFGKSINTVKSIVAS-----VVAVPYAR
YI32_SCHPO      ----------------------------------------------------WIGTAYSLAETSILPFCG
XYLT_LACBR      ----------------------------------------------------------------------
MDTH_PROMH      ----------------------------------------------------------------------
MDTH_BLOFL      ----------------------------------------------------------------------
GTR2_HUMAN      ------------------------------------------------------VSSFAVGGMTASFFGG
PHDK_NOCSK      -----------------------------------LFPPVIRDWGVPVSAVTLVVSLGVVAMAIGALVSG
NANT_SALA4      -----------------------------DFVLIALLTEVQSEFGLTTVQAASLISAAFISRWFGGLLLG
MFSD8_XENLA     -----------------------FSIVMTSIWPY--LQKVDQSADASFL--GWVIASFSLGQMVASPLFG
GHT5_SCHPO      ---------------------------------------VTDSYSYSSARQGLITGMVNVGSFFGCFLSS
ERDL6_ARATH     ---------------------------------------------------GLTVSEYSVGAMVGAIASG
ERDL4_ARATH     ---------------------------------------------------GLTVSEYSVGAMVGAIASG
EDL11_ARATH     -----------------------FSYGCAAGYTSGAETAIMKELDLSMAQFSAFGSFLNVGGAVGALFSG
Y567_BUCAP      ---------------------------------------------------------------IGTLFIG
S22A2_MOUSE     -----------------------------------------------VCAHSWMLDLFQSGFFIGAVGIG
PLT4_ARATH      ----------------------------------------------------------------------
NANT_ENTS8      ------------------------------------------------------ISRWFGGLMLGA----
MDTL_SALTI      ------------RFLLCSFALVLLYPAGIDMYLVGL-PRIAADLNASEAQLHIAFSVYLAGMATAMLFAG
NANT2_ECOL6     ------------------------------------------TIEAASLISAAFISRWFGGLAIGA----
GHT8_SCHPO      ---------------------------------------VTDTYSYSSARQGLITGMVNVGSMTGCILSS
SPNS1_XENLA     ------------------------------FTVAGVLPDIKKAFNISDSNSGLVQTVFICSYMFLAPVFG
PMRA_STRR6      ------------------------------------------------------------------PIWG
PMRA_STRPN      ------------------------------------------------------------------PIWG
EDL10_ARATH     -----------------------FSYGCANGYTSGAETAIMKELDLSMAQFSAFGSFLNLGGAVGALFSG
BAIG_EUBSP      --------------------------------------------------TTWIXXXXXXXXXXXXPILG
YUSP_BACSU      --------SKRT-LLITGLIIAMFFSALDGTIVGTAMPKIVGDLG-GLSMMTWLTTAYLLTSTTIVPIAG
YN43_SCHPO      ------------------------------------------------------VCGFASGPILWAPISE
SPNS1_XENTR     ------------------------------FTVAGVLSDIKEDYHISDSNSGLVQTVFICSYMFLAPVFG
QAY_NEUTR       ------------------------------------LPSFKKEFDFASYTPGAIVSVYQXXXXXXXXXXX
MOT2_RAT        ---------------------------------------IKDIFKTTSSQIAWISSIMLAVMYAGGPISS
EDL17_ARATH     ---------------------GSFSFGVATGYTSGAETGVMKDLDLSIAQFSAFGSFATLGAAIGALFCG
YQO5_SCHPO      ----------------------------------------------SLLTMTVFLCGYIAGPIVWAPLSE
YBIH_SCHPO      ------------KIVVPALILTLFLAALDNTIVTTALPTIAEDFNDT-SSSSWIGSAYVLASNAVLPAVG
STP4_ARATH      ----------------------------------------------------------------------
OXLT_OXAFO      ----------------------------------------------------------------------
NORA_STAAW      ------------------------------------------------------VAAFALSQMIISPFGG
NORA_STAAU      ------------------------------------------------------VAAFALSQMIISPFGG
NORA_STAAN      ------------------------------------------------------VAAFALSQMIISPFGG
NORA_STAAM      ------------------------------------------------------VAAFALSQMIISPFGG
NORA_STAAC      ------------------------------------------------------VAAFALSQMIISPFGG
ITR2_SCHPO      ----------------------------------------------------------------------
GTR12_XENLA     -----------------------------------------------------VVSALLIGALVASLVGG
CITA_SALTY      ---------------------------------------IARTFESEFASLMLTFAVFGSGFLVGAIVLG
CITA_SALTI      ---------------------------------------IARTFESEFASLMLTFAVFGSGFLVGAIVLG
YUBD_BACSU      --------------LLAVLAVGPGLMSNTALSSVQGLVQ--KTVGTSVFTSPILIGNMAFALLV--PAGP
YHA8_SCHPO      -------------------------------------------------------SLMVVGFGIGPLVIS
NORA_STAAS      ------------------------------------------------------VAAFALSQMIISPFGG
YWOG_BACSU      ----------------------------------------------------------------------
VBA2_YEAST      -----------------------------------------------MSISNWITTAYLITSTSFQPLYG
TSGA_YERE8      --------NNSNRLRLTWISYFSYALGALVIVTGMVMGNIAEYFNLPIASMSNTFTFLNAGILISIFLNA
MDTL_ECOLU      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_ECOL5      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_ECO27      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
IOLT_BACSU      ----------------TIILVSTFGFGYDTGVLNGALPYMGDQLNLNAFTEGLVTSSXXXXXXXXXXXXX
AQR1_YEAST      ----------------------------------------------------------------------
YRT3_CAEEL      ------------------------------------------------AEVGMMESSFFYGYAASQPAGV
PLST1_ARATH     -------------------------------------------FEGNSILEGLVVSIFIAGAFIGSIVAG
NORA_STAAR      ------------------------------------------------------VAAFALSQMIISPFGG
MSSP1_ARATH     ---------KGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTCSG
MDTL_ECOUT      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_ECOK1      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_ECO45      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTH_ENT38      ----------------------------------------------------------------------
GTR3_CHICK      ------------------------------------------TISPELLTSLWSLSVFSVGGMIGSFSVS
CITA_ECOLX      ---------------------------------------IAKTFESEFAALMLTFAVFGSGFLIGAVVLG
YDHC_ECOLI      ----------------------------------------------------------------------
S22AD_HUMAN     -------------------------------------------------------SVFMAGLLVGTLMFG
S17A5_HUMAN     --------------------------------------QTGKKYQWDAETQGWILGSFFYGYIITQIPGG
MSSP2_ARATH     ----------------------------------------------------------------------
MDTH_ERWCT      ----------------------------------------------------------------------
YCAD_SALAR      ---------------------------------------------------GMVSSSYFTGNLVGTLFTG
TCR2_ECOLX      --------NSSTKIALVITLLDAMGIGL--IMPV--LPTLLREFIASIANHGVLLALYALMQVIFAPWLG
QAY_NEUAF       ------------------------------------LPSFTKEFDFASYTPGAIVSVYQXXXXXXXXXXX
MDTL_ECOL6      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_ECO81      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
GTR9_HUMAN      --------------------------------------------DTLTLLWSVTVSIFAIGGLVGTLIVK
GTR10_XENLA     ----------------------------------GALLMLKTVFQLTCFEQEALVSAVLFGALLASLIGG
ERDL3_ARATH     ---------------------------------------IINDLGLSVAQYSMFGSIMTFGGMIGAIFSG
Y1104_HAEIN     -----------------------------------MLSAISADLNLTPAQGGSLVTWTLIGAVFGGILFG
SPNS3_HUMAN     ------------------------------FIIAGVLLDIQEVFQISDNHAGLLQTVFVSCLLLSAPVFG
MDTL_KLEP7      -----------TRFLLCSFALVLLYPSGIDMYLVGL-PRIAQDLGASEAQLHIAFSVYLAGMASAMLFAG
MDTL_KLEP3      -----------TRFLLCSFALVLLYPSGIDMYLVGL-PRIAQDLGASEAQLHIAFSVYLAGMASAMLFAG
MDTL_ESCF3      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_ECOSM      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
ERDL2_ARATH     --------------------------------------KIMEELGLSVADYSFFTSVMTLGGMITAVFSG
TSGA_YERPY      -----------------------------------VMGNIAEYFNLPIASMSNTFTFLNAGILISIFLNA
TSGA_YERPS      -----------------------------------VMGNIAEYFNLPIASMSNTFTFLNAGILISIFLNA
TSGA_YERPP      -----------------------------------VMGNIAEYFNLPIASMSNTFTFLNAGILISIFLNA
TSGA_YERPN      -----------------------------------VMGNIAEYFNLPIASMSNTFTFLNAGILISIFLNA
TSGA_YERPE      -----------------------------------VMGNIAEYFNLPIASMSNTFTFLNAGILISIFLNA
TSGA_YERPB      -----------------------------------VMGNIAEYFNLPIASMSNTFTFLNAGILISIFLNA
TSGA_YERPA      -----------------------------------VMGNIAEYFNLPIASMSNTFTFLNAGILISIFLNA
TSGA_YERP3      -----------------------------------VMGNIAEYFNLPIASMSNTFTFLNAGILISIFLNA
SETB_SALTY      ----------STAFLIVAFLTGIAGALQTPTLSIFLTPGMVGFFFTGSAVIGIIVSQFLAGRS-------
S17A5_SHEEP     -------------------------------------------------TQGWILGSFFYGYIITQIPGG
MOT10_MOUSE     ----------------------------------------------------------------------
MFSD8_DANRE     -----------------------FTIVITSIWPY--LKKIDESADASFL--GWVVAAYSLGQMVASPFFG
MDTL_ECOSE      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_ECOLI      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_ECODH      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_ECOBW      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_ECO7I      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_ECO55      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTH_SHIFL      ----------------------------------------------------------------------
GTR1_PIG        -----------------------------EFYNQTWLHRYGESISPATLTTLWSLSVFSVGGMIGSFSVG
YYBO_BACSU      ----------------------------------------------------------------------
TSGA_EDWI9      ----------SNRIRLTWISFFSYALGALVIVTGMVMGNIAEYFNLPISSMSNTFTFLNTGILVSIFLNA
TSGA_BUCAT      -----------------------------------IMGNISNYFHLSISQMSNIFTFLNAGILVSIFINS
TSGA_BUCAI      -----------------------------------IMGNISNYFHLSISQMSNIFTFLNAGILVSIFINS
TSGA_BUCA5      -----------------------------------IMGNISNYFHLSISQMSNIFTFLNAGILVSIFINS
MDTL_SHISS      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_SHIFL      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_SHIDS      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_SHIBS      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_SHIB3      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_ECOLC      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_ECOHS      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_ECO8A      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_ECO5E      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_ECO57      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTL_ECO24      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTH_SHIB3      ----------------------------------------------------------------------
MDTH_ECOUT      ----------------------------------------------------------------------
MDTH_ECOSM      ----------------------------------------------------------------------
MDTH_ECOSE      ----------------------------------------------------------------------
MDTH_ECOLU      ----------------------------------------------------------------------
MDTH_ECOLI      ----------------------------------------------------------------------
MDTH_ECOLC      ----------------------------------------------------------------------
MDTH_ECOL6      ----------------------------------------------------------------------
MDTH_ECOL5      ----------------------------------------------------------------------
MDTH_ECOK1      ----------------------------------------------------------------------
MDTH_ECOHS      ----------------------------------------------------------------------
MDTH_ECODH      ----------------------------------------------------------------------
MDTH_ECOBW      ----------------------------------------------------------------------
MDTH_ECO8A      ----------------------------------------------------------------------
MDTH_ECO81      ----------------------------------------------------------------------
MDTH_ECO7I      ----------------------------------------------------------------------
MDTH_ECO5E      ----------------------------------------------------------------------
MDTH_ECO57      ----------------------------------------------------------------------
MDTH_ECO55      ----------------------------------------------------------------------
MDTH_ECO45      ----------------------------------------------------------------------
MDTH_ECO27      ----------------------------------------------------------------------
MDTH_ECO24      ----------------------------------------------------------------------
GTR4_HUMAN      -------------------------------------PEGPSSIPPGTLTTLWALSVFSVGGMISSFLIG
GTR4_BOVIN      -------------------------------------PEGPGSIPPGTLTTLWALSVFSVGGMISSFLIG
ERDL1_ARATH     --EARSSSSITCGLLLTSVAVGSFVYGCAMSYSSPAQSKIMEELGLSVADYSFFTSVMTLGGMITAAFSG
YCEI_BACSU      --------------------LGVAGLGLFDAMDVGILSFIIAAWNLSPEEMKWIGSVNSIGMXXXXXXXX
MOT13_MOUSE     -------------------------------------------FLLSVAAVSDLVGRVASGWLGDA----
GTR9_PONAB      --------------------------------------------DTLTLLWSVTVSIFAIGGLVGTLMVK
GTR8_HUMAN      ----------------------------------------------------------------------
GTR3_RAT        -----AKVTPSLVFAVTVATIGSFQFGIKDFLNYTLEERLEDLPREGLLTTLWCVAIFSVGGMIGSFSVG
GTR1_CHICK      -------------------------------------------------TTLWSLSVFSVGGMIGSFSVG
YDJK_ECOLI      ------------------------------------------------------------GMFLGALVGG
Y1322_DEIRA     ---------------------------------------VTETLHGTSAQVGFLVGLCA---LLEIPVML
SPNS1_DANRE     ------------------------------FTVAGVLPDIEHFFGIGDGTSGLLQTVFICSYMFLAPLFG
S22FL_XENLA     -------------------------------------------------------SLFFAGLLIGNVFFG
S22A5_HUMAN     ------------------------------------------------------ISLFFVGVLLGSFISG
QACA_STAAU      ------------------------------------LPELVRELEPSGTQQLWIVDIYSL-VLAGFIILS
QACA_STAAM      ------------------------------------LPELVRELEPSGTQQLWIVDIYSL-VLAGFIILS
PLT5_ARATH      ----------------------------------------------------------------------
PLT1_ARATH      ----------------------------------------------------------------------
MOT8_RAT        -------------------AFGIAAAALGYFVPVHLMKYVEDKFK-EIKETWVLLVCIGATSGLGRLVSG
BENK_ACIAD      ------------------------------------LPLLMKEWAIDPVTAGFIGSIALFGMMFGALIFG
YN2F_SCHPO      ----------------------------------GAVPEVMVKFHVTVALLGLYVLGFASGPVVWAPMCE
YCT4_SCHPO      ------------------------------------------------ATVGDLCSAFLLGFAAGSVLFA
YCAD_SALEP      ---------------------------------------------------GMVSSSYFTGNLVGTLFTG
YBJJ_ECOLI      -------------------------------------PAIRDILSVSIAEMGGVLFGLSIGSMSGILCSA
SPNS3_MOUSE     ------------------------------FIIPGVLLDVQKYFHISDSHAGLLQTVFISCLLVSAPVFG
MDTL_SHIF8      ------------------------------------LPRIAADLNASEAQLHIAFSVYXXXXXXXXXXXX
MDTH_SHIBS      ----------------------------------------------------------------------
GTR3_CANFA      ---------------------------IKDFLNYTLEEKSENLPTEVLLTSLWSLSVFSVGGMIGSFSVG
BCR_HAEIN       ---------KSTFIFI--LTLGILSMGVDMYLPSFL--EIAKDLDVSPEQVQHTLTSFAYGMAFGQLFWG
BCRH_RICTY      ----------------------------TETIYTSGLPSLTKYFSIDGCITQITSTLYFLGFAVGILSLG
YFIG_BACSU      ----------------------------------------------------------------------
YD199_YEAST     ----------------------------------------------------------------------
YCAD_ESCF3      ---------------------------------------------------GMVSSSYFTGNLVGTLLTG
Y1421_ENT38     ----------------------------------------------------------------------
TSGA_SERP5      ----------SNRLRLTWISYFSYALGALVIVTGMVMGNIAEYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_SALTI      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFQLPVSSMSNTFTFLNAGILISIFLNA
TSGA_SALSV      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFQLPVSSMSNTFTFLNAGILISIFLNA
TSGA_SALNS      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFQLPVSSMSNTFTFLNAGILISIFLNA
TSGA_SALAR      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFHLPVSNMSNTFTFLNAGILISIFLNA
TSGA_SALA4      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFQLPVSSMSNTFTFLNAGILISIFLNA
S22A7_HUMAN     ---------------------------------------------------------FFAGVLVGAVAFG
S22A1_RABIT     ------------------------------------------------------------GFFLGSLGVG
MDTH_SHIF8      ----------------------------------------------------------------------
MDTH_SALTI      ----------------------------------------------------------------------
MDTH_SALSV      ----------------------------------------------------------------------
MDTH_SALPK      ----------------------------------------------------------------------
MDTH_SALPC      ----------------------------------------------------------------------
MDTH_SALPB      ----------------------------------------------------------------------
MDTH_SALPA      ----------------------------------------------------------------------
MDTH_SALNS      ----------------------------------------------------------------------
MDTH_SALHS      ----------------------------------------------------------------------
MDTH_SALG2      ----------------------------------------------------------------------
MDTH_SALEP      ----------------------------------------------------------------------
MDTH_SALDC      ----------------------------------------------------------------------
MDTH_SALCH      ----------------------------------------------------------------------
MDTH_SALA4      ----------------------------------------------------------------------
GTR8_RAT        ----------------------------------------------------------------------
GTR8_MOUSE      ----------------------------------------------------------------------
GTR3_SHEEP      ---------------------------------------------------------FSVGGMIGSFSVG
GTR1_BOVIN      -------------------------------------------------TTLWSLSVFSVGGMIGSFSVG
EDL16_ARATH     ---------------------------------------IRQDLNLSLAEFSMFGSILTIGAMLGAVMSG
BCRH_RICPR      ----------------------------TETIYTSGLPSLTRCFSIDGCITQMTSTLYFLGFAVGILSLG
BCRH_RICFE      ----------------------------TETIYTSGLPSLTKYFGIDGGITQTTSTLYFLGFALGILTLG
YDFJ_ECOLI      ------------------------------------------------------MGTYGAGYVVGAFIFG
TSGA_SALPK      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFHLPVSSMSNTFTFLNAGILISIFLNA
TSGA_SALPB      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFHLPVSSMSNTFTFLNAGILISIFLNA
TSGA_SALPA      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFHLPVSSMSNTFTFLNAGILISIFLNA
TSGA_SALHS      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFHLPVSSMSNTFTFLNAGILISIFLNA
TSGA_SALG2      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFHLPVSSMSNTFTFLNAGILISIFLNA
TSGA_SALEP      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFHLPVSSMSNTFTFLNAGILISIFLNA
TSGA_SALDC      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFHLPVSSMSNTFTFLNAGILISIFLNA
SETB_ECOLI      ----------STAFLIVAFLTGIAGALQTPTLSIFLTPAMVGFFFTGSAVIGILVSQFLAGRS-------
S22A6_RABIT     -------------------------------------------------------SLYMAGVLIGAMVFG
S17A5_MOUSE     -------------------------------------------------TQGWILGSFFYGYIVTQIPGG
MOT2_MOUSE      ---------------------------------------IQEIFNTTSSQIAWISSIMLAVMYAGGPISS
MOT10_RAT       ----------------------------------------------------------------------
MDTH_YERE8      ----------------------------------------------------------------------
MDTH_SALAR      ----------------------------------------------------------------------
GTR8_BOVIN      ----------------------------------------------------------------------
GTR3_HUMAN      -----------------------------------------------LLTSLWSLSVFSVGGMIGSFSVG
GTR1_RABIT      ------------------------------------------------------VAIFSVGGMIGSFSVG
GTR10_HUMAN     ----------------------------------------------------------------------
ERD6_ARATH      ------------------------GVGFSSGAQAGITKDLS----LSVAEYSMFGSILTLGGLIGAVFSG
EMRY_ECOLI      --------------VTIALSLATFMQMLDSTISNVAIPTISGFLGASTDEGTWVITSFGVANAIAIPVTG
YCAD_SALTY      ---------------------------------------------------GMVSSSYFTGNLVGTLFTG
YCAD_SALTI      ---------------------------------------------------GMVSSSYFTGNLVGTLFTG
YCAD_SALSV      ---------------------------------------------------GMVSSSYFTGNLVGTLFTG
YCAD_SALPK      ---------------------------------------------------GMVSSSYFTGNLVGTLFTG
YCAD_SALPC      ---------------------------------------------------GMVSSSYFTGNLVGTLFTG
YCAD_SALPA      ---------------------------------------------------GMVSSSYFTGNLVGTLFTG
YCAD_SALNS      ---------------------------------------------------GMVSSSYFTGNLVGTLFTG
YCAD_SALHS      ---------------------------------------------------GMVSSSYFTGNLVGTLFTG
YCAD_SALCH      ---------------------------------------------------GMVSSSYFTGNLVGTLFTG
YCAD_SALA4      ---------------------------------------------------GMVSSSYFTGNLVGTLFTG
TCR1_ECOLX      -------------VILSTVALDAVGIGLIMPVLPGLLRDLVHSNDVT-AHYGILLALYALMQFACAPVLG
S22A7_PONAB     ---------------------------------------------------------FFAGVLVGAVAFG
S22A6_RAT       -------------------------------------------------------SLYMVGVLLGAMVFG
S22A6_MOUSE     ------------------------GTGVTEPCLDGWVYD-NSTFPSTIVTEWNLVCSHRAGVLLGAMMFG
MDTH_ENTS8      ----------------------------------------------------------------------
GUDP_BACSU      ---------------------------------------------------GYVFSAFGWAYVIGQLPGG
GTR3_BOVIN      ------------------------------------------------------VAIFSVGGMIGSFSVG
GTR14_HUMAN     ------------------------------------------------------VAIFSVGGMIGSFSVG
GTR10_XENTR     ----------------------------------------------------------------------
ERDL8_ARATH     ------------------------------------------------------------GAVLGAITSG
ERDL5_ARATH     ----------------------VFGSAIGYSSPVQ--SDLTKELNLSVAEYSLFGSILTIGAMIGAAMSG
YQEH_SCHPO      ---------KKAYIVLLSTSLQMYVFWTPNFYP-GVQDSVMELWHLSSQVSLLGQSMFVLGVALGPLFLG
YCAD_SALPB      ---------------------------------------------------GMVSSSYFTGNLVGTLFTG
YAJR_ECOLI      ----------------------------------------------------------------------
TSGA_SHIB3      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECOUT      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECOSM      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECOSE      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECOLI      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECOL6      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECOL5      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECOK1      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECODH      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECOBW      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECO8A      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECO81      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECO5E      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECO57      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECO55      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECO45      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECO27      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECO24      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
STP8_ARATH      ----------------------------------------------------------------------
SETA_ECOLI      ----------------------------------------------------WIGLFYTVNAIAGIGVSL
MUCK_ACIAD      ------------------------------------LNSIKAEFNLSTVEAGMLGSFTLAGMAIGGIFGG
MOT13_RAT       ----------------------------------------------------------------------
MDTH_YERPY      ----------------------------------------------------------------------
MDTH_YERPS      ----------------------------------------------------------------------
MDTH_YERPP      ----------------------------------------------------------------------
MDTH_YERPN      ----------------------------------------------------------------------
MDTH_YERPG      ----------------------------------------------------------------------
MDTH_YERPE      ----------------------------------------------------------------------
MDTH_YERPB      ----------------------------------------------------------------------
MDTH_YERPA      ----------------------------------------------------------------------
MDTH_YERP3      ----------------------------------------------------------------------
MDTH_SODGM      ----------------------------------------------------------------------
GTR2_MOUSE      ------------------------------------------------------VSSFAVGGMVASFFGG
EXUT_ECOLI      ----------------------------------------------------------------------
EXUT_ECO57      ----------------------------------------------------------------------
EDL18_ARATH     ---------------------GSFSFGVSLGYTSGAEIGIMKDLDLSIAQFSAFASLSTLGAAIGALFSG
Y2171_CITK8     ----------------------------------------------SLATVGMVSSSYFTGNLVGTLLTG
TSGA_SHISS      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_SHIFL      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_SHIF8      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_SHIDS      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_SHIBS      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ERWT9      --------------------------GAVVIVTGMVLENIAAYFQLPVAQMSNTFTFLNAGILLAVFLNA
TSGA_ECOLU      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECOLC      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECOHS      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TSGA_ECO7I      ----NSNRIKLTWISFLSYAL----TGALVIVTGMVMGNIADYFNLPVSSMSNTFTFLNAGILISIFLNA
TCR8_PASMU      --------NKSIIIILLITVLDAIGIGL--IMPV--LPTLLNEFENSLATHGVLLALYATMQVIFAPILG
STP7_ARATH      -------------------------------------------------------SLYLAG-LVSTLVAS
MSSP3_ARATH     --------------------------------------------------------------LIGATLIT
MOT8_MOUSE      -------------------AFGIAAAALGYFVPVHLMKYVEDKFK-EIKETWVLLVCIGATSGLGRLVSG
MOT8_HUMAN      -------------------AFGIAAAALGYFVPVHLMKYVEEEF-SEIKETWVLLVCIGATSGLGRLVSG
MDTH_BLOPB      ----------------------------------------------------------------------
HXT10_YEAST     ------------------------------------------SFQLSDVRTGLIVGIFNIGCALGGLTLG
GTR2_BOVIN      ----------------------------------------------SLITMFWSVSSFAVGGMIASFFGG
GTR1_RAT        ------------------------------------------------------VAIFSVGGMIGSFSVG
GTR1_MOUSE      ------------------------------------------------------VAIFSVGGMIGSFSVG


                         .         .         *         .         .         .         .:140
query           LLSIRRPRKQMLIILMVLFIIGNLLSAVAPNFALLIIGRIVTSFTHGAFFGIGTVVAAELAGPGQRGAAV
YDHP_ECOLI      XXXXXXXXXXXXIFLMAIFTLGNVLSAIAPDYMTLMLSRILTSLNHGAFFGLGSVVAASVVPKHKQASAV
YDHP_ECO57      XXXXXXXXXXXXIFLMAIFTLGNVLSAIAPDYMTLMLSRILTSLNHGAFFGLGSVVAASVVPKHKQASAV
YFHI_BACSU      IISVKLPRKPVLLGLMAIFILSNLMSALAPNFAVLAISRILSASIHGAFFAIAMVFASEMVPPEKRAAAA
YTBD_BACSU      SLTSSMSRKTLLLWIMFIFIAGNTMAATASSIGILLAARVISAFSHGVFMSIGSTIAADIVPEDKRASAI
ARAJ_ECOLI      LFSSRYSLKHILLFLVALCVIGNAMFTLSSSYLMLAIGRLVSGFPHGAFFGVGAIVLSKIIKPGKVTAAV
SOTB_CITK8      LLTSQVERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAVFWSITASLAIRLAPPGKRAQAL
PBUE_BACAM      AVTAKAERKRLYLIALFVFFLSNLVAYFSPNFAVLMVSRVLASMSTGLIVVLSLTIAPKIVAPEYRARAI
SOTB_ERWCH      LLTSGIERRKXXXXXXXXXXXXXXXXAVAWNFTVLVISRAGVALAHSVFWSITASLAIRMAPPGKRAQAL
PBUE_BACSU      ALTAKIERKRLYLIALFVFFLSNLVAYFSPNFATLMVSRVLAAMSTGLIVVLSLTIAPKIVAPEYRARAI
SOTB_HAEIN      LATGNMERKSXXXXXXXXXXVGHILSVIAWNFWILLLARMCIALAHSVFWSITASLVMRISPKHKKTQAL
SOTB_HAEIG      LATGNMERKSXXXXXXXXXXVGHILSVIAWNFWILLLARMCIALAHSVFWSITASLVMRISPKHKKTQAL
SOTB_HAEI8      LATGNMERKSXXXXXXXXXXVGHILLVIAWNFWILLLARMCIALAHSVFWSITASLVMRISPKHKKTQAL
YBCL_BACSU      ALTASMDRRKLMMYALGLFVFGNVLAFVLPGYGWFXXXXXXXXXXXXXXXXXXXXXXXXXXSEGKQGSAI
SOTB_ECOLU      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_PSEA7      LLTRNIERRKLLVGVFLLFIASHVLSGLAWNFPVLMLSRIGIAFAHAVFWAITASLAVRVAPPGQQAKXX
SOTB_HELPG      LLSAKIERKRXXXXXXXXXIASHILSALAWNFWVLLISRIGIAFAHSIFWSITASLVIRVAPRNKKQQXX
SOTB_SALNS      LLTSQMERRKLLIYLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAIRLAPAGKRAQAL
SOTB_SHIFL      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_SALSV      LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAIRLAPAGKRAQAL
SOTB_SHIF8      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
NEPI_SHISS      QTIQATDRRNVVILFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKAL
SOTB_SALTI      LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAIRLAPAGKRAQAL
SOTB_SALPB      LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAIRLAPAGKRAQAL
SOTB_SALHS      LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAIRLAPAGKRAQAL
SOTB_SALG2      LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAIRLAPAGKRAQAL
SOTB_SALEP      LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAIRLAPAGKRAQAL
SOTB_SALDC      LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAIRLAPAGKRAQAL
SOTB_SALA4      LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAIRLAPAGKRAQAL
SOTB_SALPC      LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAIRLAPAGKRAQAL
SOTB_SALCH      LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAIRLAPAGKRAQAL
SOTB_ECO5E      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
NEPI_ECOL5      QTIQATDRRYVVILFAVLLTLSCLLVSFANSFSLLLIGRACLGVALGGFWAISASLTMRLVPPRTVPKAL
SOTB_SALAR      LLTSQIERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFTHAIFWSITASLAIRLAPAGKRAQAL
NEPI_ECOL6      QTIQATDRRYVVILFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKAL
SOTB_SALTY      LLTSQMERRKLLIYLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAIRLAPAGKRAQAL
SOTB_SALPK      LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAIRLAPAGKRAQAL
SOTB_SALPA      LLTSQMERRKLLICLFVLFIASHVLSFLAWNFTVLVISRIGIAFAHAIFWSITASLAIRLAPAGKRAQAL
SOTB_ECOL5      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
NEPI_ECOUT      QTIQATDRRYVVILFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKAL
NEPI_ECOK1      QTIQATDRRYVVILFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKAL
NEPI_ECO27      QTIQATDRRYVVILFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAISASLTMRLVPPRTVPKAL
SOTB_ECOUT      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_ECOL6      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_ECOK1      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_ECO81      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_ECO45      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_ECO27      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_SHISS      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_SHIBS      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_SHIB3      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_ESCF3      LLTSQVERRRLLICLFVLFIASHILSFMAWSFTVLVISRIGVAFAHAIFWSITASLAIRLAPAGKRXXXX
SOTB_ECOSM      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_ECOSE      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_ECOLI      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_ECOLC      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_ECOHS      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_ECODH      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_ECOBW      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_ECO8A      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_ECO7I      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_ECO55      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_ECO24      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
SOTB_ECO57      LMTSQVERRKLLICLFVVFIASHVLSFLSWSFTVLVISRIGVAFAHAIFWSITASLAIRMAPAGKRAQAL
NEPI_SHIDS      QTIQATDRRYVVILFAVLLTISCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKAL
NEPI_ECO57      QTIQATDRRYVVILFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKAL
NEPI_SHIFL      QTIQATDRRYVVILFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKAL
NEPI_SHIF8      QTIQATDRRYVVILFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKAL
NEPI_ECOLI      QTIQATDRRYVVILFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKAL
NEPI_ECOBW      QTIQATDRRYVVILFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKAL
SOTB_HELAH      LLSAKIERKRXXXXXXXXXIVSHILSVVAWDFWVLLISRMGIALAHSVFWSITASLVIRVAPIGRKQQXX
SOTB_ERWT9      LLTRNVERRMLLMIIFVMFVASHALSSVAWDFTTLLISRIGIALSHAIFWSITASLAIRVAPQGKKTQAL
NEPI_SHIBS      QTIQATDRCYVVILFAVLLTLSCLLVSFANSFSLLLIGRACLGLALGGFWAMSASLTMRLVPPRTVPKAL
SOTB_KLEP7      LLTSKVEXXXXXXXXXXXXXASHVLSFFAWNFDVLVISRIGIAFAHAVFWSITSALAIRMAPPGKRAQAL
SOTB_HELPH      LLSAKIERKRXXXXXXXXXXXXXXXXALAWNFWVLLLSRMGIAFTHSIFWSITASLVIRVAPRNKKQQXX
SOTB_ENT38      LLTSQMERRKLLIGLFVLFIASHVLSFLAWNFNVLVISRIGIAFAHAIFWSITASLAIRLAPAGKRXXXX
SOTB_HELP2      LLSAKIERKRXXXXXXXXXXXXXXXXALAWNFWVLLISRMGIAFAHSIFWSITASLVIRVAPRNKKQQXX
SOTB_HELPY      LLSAKIERKRXXXXXXXXXXXXXXXXALAWNFWVLLLSRMGIAFAHSIFWSITASLVIRVAPRNKKQQXX
SOTB_HELPJ      LLSAKIERKRXXXXXXXXXXXXXXXXALAWNFWVLLLSRMGIAFAHSIFWSITASLVIRVAPRNKKQQXX
SOTB_PSE14      LATRNIERRKLLMFVFGLFVVSHVLSAISPSFAILLVSRVGIAFAHAVFWSVTASLAVRIAPPGKQVQXX
SOTB_KLEP3      LLTSKMEXXXXXXXXXXXXXASHVLSFFAWSFDVLVISRIGIAFAHAVFWSITSALAIRMAPPGKRAQAL
SOTB_PSEAE      LLTRNIERRKLLVGVFLLFIASHVLSGLAWSFQVLMLSRIGIAFAHAVFWAITASLAVRVAPPGQQAKXX
SOTB_PSEAB      LLTRNIERRKLLVGVFLLFIASHVLSGLAWSFQVLMLSRIGIAFAHAVFWAITASLAVRVAPPGQQAKXX
SOTB_PSEA8      LLTRNIERRKLLVGVFLLFIASHVLSGLAWSFQVLMLSRIGIAFAHAVFWAITASLAVRVAPPGQQAKXX
SOTB_PASMU      LLTAKAERRGXXXXXXXXXXXXXXXXXXAWDFWVLVLARIGVALTHSIFWAITASLVIRVAPKDKKSQAI
CMLR_STRLI      ALARTWPRRSSXXXXXXXXXXXXXXXXXTTSFPXXXXXXXXXXXXXXXXXXXXXXXXXXXXPADKQGRAL
SOTB_PSEU2      LATRNIERRKLLMFVFGLFVVSHVLSAIAPSFAILLVSRVGIAFAHAVFWSVTASLAVRIAPPGKQVQXX
SOTB_PSESM      LATRNIERRKLLMFVFGLFVVSHVISAMASSFAILLVSRVGIAFAHAVFWSVTASLAVRIAPPGKQVQXX
SOTB_PSEE4      LMTRNIEXXXXXXXXXXXXILSHLMSWLSQSFAMLLVSRIGIALAHAVFWAITASLAVRVAPPGQQAKXX
YWFA_BACSU      PLGDKYSRELSLLAGLMIFIIGTVICALAQNIXXXXXXXXXXXXXXXXXVPTAYAVVGDRVPYTYRGKVM
NEPI_SALPK      QIIQATDRRYIVILFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAISASLTMRLVPARTVPKAL
NEPI_SALPA      QIIQATDRRYIVILFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAISASLTMRLVPARTVPKAL
NEPI_SALG2      QIIQATDRRYIVILFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAMSASLTMRLVPARTVPKAL
NEPI_SALEP      QIIQATDRRYIVILFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAMSASLTMRLVPARTVPKAL
NEPI_SALTY      QIIQATDRRYIVILFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAMSASLTMRLVPARTVPKAL
NEPI_SALTI      QIIQATDRRYIVILFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAMSASLTMRLVPARTVPKAL
NEPI_SALPC      QIIQATDRRYIVILFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAMSASLTMRLVPARTVPKAL
NEPI_SALPB      QIIQATDRRYIVILFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAMSASLTMRLVPARTVPKAL
NEPI_SALCH      QIIQATDRRYIVILFAVLLTASCLMVSFANSFTXXXXXXXXXXXXXXXFWAMSASLTMRLVPARTVPKAL
OPDE_PSEAE      SVAGSLNRKTLLLGLTAAMGMSGAIVALAPNYFVYMLGRALIGIVIGGFWSMSAATAMRLVPANDVPRXX
SOTB_PSEPK      LLTRNIEXXXXXXXXXXXXXXXXXXSWLSQSFAMLLVSRIGIALAHAVFWSITASLAVRVAPPGQQAKXX
SOTB_PSEPG      LLTRNIEXXXXXXXXXXXXXXXXXXSWLSQSFAMLLVSRIGIALAHAVFWAITASLAVRVAPPGQQAKXX
SOTB_PSEPW      LLTRNIEXXXXXXXXXXXXXXXXXXXXXXQSFAMLLLSRIGIALAHAVFWSITASLAVRVAPPGQQAKXX
SOTB_MANSM      LMTXXXXXXXXXXXXXXXXXXXXXXSAFAWNYEVLLIARAGVALTHSIFWSITAALTIRIAPKNKKTQXX
SOTB_ERWCT      LLSSDMERRSLLIKIFILFAISNVLSGLAWNYWVLIMARIGVALSHAVFWSITASLVVRLAPADKKAQXX
YCEJ_BACSU      PISDRLNRKTVMLWGLAGFIVSTFLCGIAPSFAAMCLFRFAAGVS--AAFVTPQIWASVIVQPSQIIKGM
GALP_ECOLI      WLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGVASYTAPLYLSEIAPEKIRGSMI
GALP_ECOL6      WLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGVASYTAPLYLSEIAPEKIRGSMI
YCNB_BACSU      FLIEKFTSRALLITAMSIFTAGTVVGAFAPNFPVLLTARIIQAAGAGIMMPLMQTVFLTIFPIEKRGQAM
YFIU_BACSU      KLSDRYGRKKLFLIEVCLFGLGSLLVALSQSFPLFLISRLIQALXXXXXXXXXSSHILATLPKEKQGKAL
YHCA_BACSU      FLITRFGQRSLFLVAMFCFTLGTLVCGIAPNFSTMLIGRLIQAVGGGILQPLVMTTILLIFPPESRGKGM
EXUT_BACSU      VASDRYGAKLTLFVAMVVWSLFSGAVALAFGFVSLLIIRILFGMGEGPLSATINKMVNNWFPPTQRASVI
TCR_STRPN       KLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFSLLIMARFIQGAGAAAFPALVMVVVARYIPKENRGKAF
TCR_BACSU       KLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFSLLIMARFIQGAGAAAFPALVMVVVARYIPKENRGKAF
TCR_BACST       KLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFSLLIMARFIQGAGAAAFPALVMVVVARYIPKENRGKAF
TCR_BACCE       KLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFSLLIMARFIQGAGAAAFPALVMVVVARYIPKENRGKAF
EMRB_HAEIN      WLAKRFGEVRLFLVSTFLFVVSSWLCGIADSLEALIIFRVIQGAVAGPVIPLSQSLLLNNYPPEKRGMAL
YGAY_ECOLI      PLGDMFERRRLIVSMTLLAAGGMLITASSQSLAMMILGTALT----GLFSVVAQILAATLASPDKRGKVV
YGAY_ECO57      PLGDMFERRRLIVSMTLLAAGGMLITASSQSLAMMILGTALT----GLFSVVAQILAATLASPDKRGKVV
ARAE_KLEOX      WLSFRLGRKYSLMVGAVLFVAGSVGSAFATSVEMLLVARIVLGVAVGIASYTAPLYLSEMASENVRGKMI
SGE1_YEAST      RLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGTSIVRENHRGIMI
TCR_STRAG       KLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFSLLIMARFIQGAGAAAFPALVMVVVARYIPKENRGKAF
TCRB_BACSU      KLSDQLGIKNLLLFGIMVNGLGSIIGFVGHSFPILILARFIQGIGAAAFPALVMVVVARYIPKENRGKAF
YFMO_BACSU      AISSRIGAKWTLILGLIFIIVFAGLGGSSSSIAQLVGYRGGWGLGNALFISTALAVIXXXXXXXXAQAII
MDTD_PECCP      WLADRIGVKNIFFAAILLFTLGSLLCARSETLNELLASRVIQGIGGAMMVPVGRLTVMKIVPRDQYMAAM
PCAK_ACIAD      PTADRFGRKIVLSMSMLVFGGFTLACAYSTNLDSLVIFRFLTGIGLGAAMPNATTLFSEYCPARIRSLLV
YB30_YEAST      ALADFGGRKFLYMVSLSLMLIVNILLAAVPNIAALFVLRIFQAFASSSVISLGAGTVTDVVPPKHRGKAI
TCR_STAHY       KLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFSLLIMARFIQGAGAAAFPALVMVVVARYIPKENRGKAF
MDTD_YERPS      WLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGDAMMVPVGRLTVMKIVPREQYMAAM
MDTD_YERPY      WLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_YERPP      WLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_YERPN      WLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_YERPG      WLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_YERPE      WLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_YERPB      WLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_YERPA      WLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_YERP3      WLADRIGVKWVFFSAIILFTFGSLMCAQSATLNELILSRVLQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_YERE8      WLADRVGVKWVFFSAIILFTLGSLLCAQAETLNELISSRVIQGIGGAMMVPVGRLTVMKIVPREQYMSAM
ARAE_ECOLI      WLSFRLGRKYSLMAGAILFVLGSIGSAFATSVEMLIAARVVLGIAVGIASYTAPLYLSEMASENVRGKMI
ARAE_ECO57      WLSFRLGRKYSLMAGAILFVLGSIGSAFATSVEMLIAARVVLGIAVGIASYTAPLYLSEMASENVRGKMI
MHPT_ECOLI      MLADRYGRKRILIGSVALFGLFSLATAIAWDFPSLVFARLMTGVGLGAALPNLIALTSEAAGPRFRGTAV
XYLL1_ARATH     SVADIIGRRKELILAAFLYLVGAIVTVVAPVFSILIIGRVTYGMGIGLTMHAAPMYIAETAPSQIRGRMI
YLD2_CAEEL      HLASRYGGKRVVFVTILGSALLTLLNPVAARYALAIL-RAAIGFLQGATFPAMHTMWSVWGPPLELSVLT
NANT_YERPY      AMGDRYGRKLAMIISIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKAS
YJA1_SCHPO      VFG----RRMLLQVGNVIFIVFNMACGLARTKAQMYIFRFLAGFGSATPMGLGSGTISDLFTPDERGKAV
YYBF_BACSU      -------RKPIMGISMLAASVLCLASAFSPSFHTLLVLRTIQGVALAGLPSIAMAYLGEEIEPGSLGSAM
YEBQ_ECOLI      FLGDMFGYRRIYKCGLVVFLLSSLFCALSDSLQMLTLARVIQGFGGAALMSVNTALIRLIYPQRFLGRGM
YWOD_BACSU      KLGDLIGRKRLFLFGLILVAVSAIGAPFAPTFMTLLVMRLFQSVGSSAIYPSGVGLIRNHIHERQ-ASAL
MDTD_SERP5      WLADRVGVQRVFFSAIVLFTLGSILCARSETLNELIASRVVQGIGGAMMVPVGRLTVMKIVPREQYMAAM
BMR3_BACSU      KLSDMYGRKRXXXXXXXXXXXXSALCGIAQTMNQLIIFRAIQGIGGGALLPIAFTIIFDLFPPEKRGKMS
EDL15_ARATH     KLTDLVGRVKTIWITNILFVIGWFAIAFAKGVWLLDLGRLLQGISIGISVYLGPVYITEIAPRNLRGAAF
NANT_YERPS      AMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKAS
NANT_YERPP      AMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKAS
NANT_YERPG      AMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKAS
NANT_YERPE      AMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKAS
NANT_YERPB      AMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKAS
NANT_YERPA      AMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKAS
NANT_YERP3      AMGDRYGRKLAMITSIVLFSFGTLACGLAPGYTTLFIARLIIGIGMAGEYGSSSTYVMESWPKNMRNKAS
NANT_SALAR      AMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
LMRB_LISMO      LLLQWFTTRGLFFTAVSFSIAGTLIAALSPTFAMLMIGRVVQAVGTALLLPLMFNTILLIFPEHKRGSAM
XYLL3_ARATH     GVADFLGRRRELIIAAVLYLLGSLITGCAPDLNILLVGRLLYGFGIGLAMHGAPLYIAETCPSQIRGTLI
NANT_CITK8      -MGDRYGRRLAMVTSIILFSMGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
MFSD8_HUMAN     LWSNYRPRKEPLIVSILISVAANCLYA-------------------------------------------
LMRB_LISIN      LLLQWFTTRGLFFTAVSFSIAGTLIAALSPTFAMLMIGRVVQAVGTALLLPLMFNTILLIFPEHKRGSAM
SPIN_DROME      YLGDRYSRPWIMAVGVGLWSTTTLLGSFMKQFGWFIAFRALVGIGEASYSTIAPTIISDLFVHDMRSKML
NANT_ESCF3      -MGDRYGRRLAMVTSIVLFSVGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
SPNS3_DANRE     YLGDRYDRKLIMIVGLVMWIVTTLGSSFVSHFWVLVATRALVGTGEASYSTIAPTIIGDLFAGSKRTLMI
NANT_SALTY      AMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_SALTI      AMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_SALSV      AMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_SALPK      AMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_SALPC      AMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_SALPB      AMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_SALPA      AMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_SALNS      AMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_SALHS      AMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_SALG2      AMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_SALEP      AMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_SALDC      AMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_SALCH      AMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
MFSD8_MOUSE     LWSNYRPRKEPLIVSISISVAANCLYAAAHNKYYMLIARGLVGFGAG-----------------------
EDL14_ARATH     KLADLVGRVYTIWITNILVLIGWLAIAFAKDVRLLDLGRLLQGISVGISSYLGPIYISELAPRNLRGAAS
YMPB_CAEEL      MLADRYGRKPIIVTTAILAFLANMAASFSPNFAIFLILRAFIGACSDSYLSVASVATCEYLSEKAR----
VBA5_YEAST      RFASIIGFQHSLILAILIFEAGSLIAALASSMNMLIFGRVVAGVGGSGLQTLCFVIGCTMVGERSRPLVI
MDTM_ECO57      PLSDRIGRKPVLITGALIFTLACAATMFTTSMTQFLIARAIQGTSICFIATVGYVTVQEAFGQTKGIKLM
YWTG_BACSU      KLTDRFGRKKAIMAAALLFCIGGLGVALAPNTGVMVLFRIILGLAVGTSTTIVPLYLSELAPKHKRGA--
NANT_SHIFL      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_SHIF8      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_SHIB3      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_ECOSM      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_ECOSE      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_ECOLI      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_ECOLC      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_ECOL5      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_ECOHS      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_ECODH      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_ECOBW      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_ECO8A      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_ECO7I      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_ECO5E      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_ECO57      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_ECO55      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_ECO45      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_ECO27      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT_ECO24      -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
NANT1_ECOL6     -MGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
MDTD_ERWCT      WLADRIGVKNIFFAAILLFTLGSLLCARSETLDELLISRVIQGIGGAMMVPVGRLTVMKIVPRDQYMAAM
YYAJ_BACSU      RLSDRIGRKKALNLFVFVFSIASLCNAAAWDIPSLMTFRFLTGFGVAAAMVITNSYLAEFFPSSVRGKYI
MDTD_SALPB      WLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQYMAAM
MDTD_SALHS      WLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQYMAAM
AZR1_YEAST      RIATPIGFKETMLFAIVIFEIGSLISALANSMSMLXXXXXXXXXXXXXXQSLSFVIGSTLVEESQRGILI
YIZG_SCHPO      LLMKKVQPKRMLAFIVISYSLTTIFTGFCHNFGGLLAARLVLGFCEAGLFPCLALYLTMIYSRVELAPRI
GHT3_SCHPO      PFTERIGKKYSICFFSGVYIIAELLLVTAPSWIQVLVGKILAGVGIGALSVLSPGYQSEVAPPQIRGAVV
MDTD_SALSV      WLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQYMAAM
MDTD_KLEP3      WLADRVGVRNIFFTAIVLFTAGSLFCAQASTLDQLVMARVLQGIGGAMMVPVGRLTVMKIVPRDQYMAAM
MDTD_ESCF3      WLADKVGVRNIFFTAIVLFTLGSLFCALSATLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_SHISS      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_SHIFL      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_SHIBS      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_SHIB3      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_KLEP7      WLADRVGVRNIFFTAIVLFTAGSLFCAQASTLDQLVMARVLQGVGGAMMVPVGRLTVMKIVPRDQYMAAM
MDTD_ECOUT      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECOSM      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECOSE      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECOLI      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECOLC      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECOL5      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECOK1      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECOHS      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECODH      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECOBW      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECO8A      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECO7I      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECO5E      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECO57      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECO55      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECO45      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECO27      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECO24      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
TCR_STAES       KLSDYINXXXXXXXXXXXXXXXXXXAFIGHNFFILIFGRLVQGVGSAAFPSLIMVVVARNITRKKQGKAF
TCR_STAAU       KLSDYINXXXXXXXXXXXXXXXXXXAFIGHNFFILIFGRLVQGVGSAAFPSLIMVVVARNITRKKQGKAF
SPNS2_XENTR     YLGDRFNRKVILSSGIFFWSAITFSSSFIPKFWLLVLSRGLVGIGEASYSTIAPTIIGDLFTKNTRTLML
MDTD_SALTY      WLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQYMAAM
MDTD_SALTI      WLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQYMAAM
MDTD_SALPK      WLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQYMAAM
MDTD_SALPA      WLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQYMAAM
MDTD_SALNS      WLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQYMAAM
MDTD_SALEP      WLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQYMAAM
MDTD_SALA4      WLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRAQYMAAM
MDTD_ENT38      WMADKIGVRNIFFTAIVLFTLGSLFCAKADTLNELVMSRVLQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_ECO81      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
GHT7_SCHPO      PVADKIGKRLSIIVWTTVYLIGIIIQVTTPSWVQILVAKIWTGLSIGALSVITPGYQSEVAPAIMRGAIV
GHT4_SCHPO      PFTEAIGKKYSIAFFSGCYIIGQILLVTAPSWVQIMVGKLFTGLTIGALSVLSPGYQSEVAPPQIRGAVV
MDTD_SHIF8      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
HGT1_KLULA      NFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTIS
CSBC_BACSU      TCSDRWGRRKVVFVLSIIFIIGALACAFSQTIGMLIASRVILGLAVGGSTALVPVYLSEMAPTKIRGT--
QAY_NEUCR       ATSYFLGRRKSLIAFSVVFIIGAAIMLAADGQGRIIAGRVLAGIGVGGASNMVPIYISELAPPAVRGRLV
MDTM_ECOLI      PLSDRIGRRPVLITGALIFTLACAATMFTTSMTQFLIARAIQGTSICFIATVGYVTVQEAFGQTKGIKLM
MDTD_SALDC      WLADKIGVRNIFFAAIVLFTLGSLFCALSGTLNQLVLARVLQGVGGAMMVPVGRLTVMKIVPRTQYMAAM
MDTD_ECOLU      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
MDTD_CITK8      WLADKVGVRNIFFTAIVLFTLGSLFCAWSSTLNELVLARVLQGVGGAMMVPVGRLTVMKIVPREQYMAAM
LMRB_BACSU      LLLQWFTTRQLFTVSLIFSILGTFIXXXXXXXXXXXXXRIVQALGTGLLLPLMFNTILVIFPPHKRGAAM
YJHB_ECOLI      AMADKYGRKPMMMWAIFIYSVGTGLSGIATNLYMLAVCRFIVGLGMSGEYACASTYAVESWPKNLQSKAS
ORCT_DROME      QMSDKLGRKPTFFASLVLQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFLVAYVIALEMVGSSYR----
MDTD_ENTS8      WLADRVGVRNIFFTAIVLFTLGSLFCAQSSTLNELVAARVLQGIGGAMMVPVGRLTVMKIVPRDQYMAAM
MDTD_ECOL6      WLADKVGVRNIFFTAIVLFTLGSLFCALSGTLNELLLARALQGVGGAMMVPVGRLTVMKIVPREQYMAAM
YDER_BACSU      -----------------------------------------TLFLAAAFFGLGSIAASYLASDAARGRVV
OCTL_DROME      QLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVFLVAYVVAMEMVGPDKRGIFV
MDTL_SALAR      KIADRSGRKPVAIVGAIVFMMASLLCSQATEGSLFLSGRFLQGVGAGSCYVVAFAILRDTLDERRR-AKV
YAN6_SCHPO      IMSEVVGRKIVLYTSIVLFLFGSAMCGAAQNMLWLVLCRAVQGIGGGGITSLVTIVIADITPLQTRPYYT
SV2C_MOUSE      GLADKVGRKQSLLICMSVNGFFAFLSSFVQGYGFFLVCRLLSGFGIGVFSYFAEVLAREKRGEHLSWLCM
SV2C_RAT        GLADKVGRKQSLLICMSVNGFFAFLSSFVQGYGFFLLCRLLSGFGIGVFSYFAEVLAREKRGEHLSWLCM
MDTL_SALHS      KIADQSGRKPVAIVGALVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR-AKV
MDTL_SALEP      KIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGIGAGGCYVVAFAILRDTLDEHRR-AKV
MDTL_SALDC      KIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGIGAGGCYVVAFAILRDTLDEHRR-AKV
GHT1_SCHPO      PTTDRIGKRNSIIGFCVIYLIGVIIQVTAPSWVQIMVAKIWTGLGIGALSVLAPGYQSEVAPPHIRGTIV
ERDL7_ARATH     LVG----RKGAMRVSSAFCVVGWLAIIFAKGVVALDLGRLATGYGMGAFSYVVPIFIAEIAPKTFRGALT
STP5_ARATH      RLTAAYGRRTTMILGGFTFLFGALINGLAANIAMLISGRILLGFGVGFTNQAAPVYLSEVAPPRWRGAFS
MDTL_SALPB      KIADQSGRKPVAIVGALVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR-AKV
MDTL_SALNS      KIADQSGRKPVAIVGALVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR-AKV
MDTL_SALA4      KIADQSGRKPVAIVGALVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR-AKV
CITH_KLEPN      AYIDKVGRRKGLIVTLSIMATGTFLIVLIPSYQLVLIGRLLQGFSAGAELGGVSVYLAEIATPGRKGFYT
BCRH_RICBR      RLSDIYGRRPVVLFGLCIYAXXXXXXXFAPNIETLMLARFVQAFG----VSVGSVIGQAMARDSYQGSEL
Y466_BUCAI      ILSDKFNRKKIILLGLFMFFIGNIISASIHSIWGLIIGRFFQG--SGAISGVCMAFLSDLIREENRVKSI
SV2C_HUMAN      GLADKVGRKQSLLICMSVNGFFAFLSSFVQGYGFFLFCRLLSGFGIGVFSYFAEVLAREKRGEHLSWLCM
S22A2_RAT       YLADRFGRKFCLLVTILINAISGALMAISPNYAWMLVFRFLQGLVSKAGWLIGYILITEFVGLGYR----
PLT3_ARATH      -------RRYTIALSAVIFLVGSVLMGYGPNYPVLMVGRCIAGVGVGFALMIAPVYSAEISSASHRGFLT
MDTL_SALTY      KIADQSGRKPVAIVGALVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR-AKV
GTR1_LEIDO      -------RRPCIAVADALFVIGSVLMGAAPNVEVVLVSRVIVGLAIGISSATIPVYLAEVTSPKHRGATI
GHT2_SCHPO      PIADRFGKRLSIIGFCAVYIIGIIVQVTAPSWVQIMVAKIWTGIGIGALSVLAPGYQSETAPPSIRGTVV
ERDL9_ARATH     TIADSFGCKMTLWITEVFCISGWLAIALAKNIIWLDLGRFFVGIGVGLLSYVVPVYIAEITPKTVRG---
BMR2_BACSU      RWVDRFGRKKMIILGLLIFSLSELIFGLGTHVSIFYFSRILGGVSAAFIMPAVTAYVADITTLKERSKAM
PLT6_ARATH      -------RRYTIVLASILFMLGSILMGWGPNYPVLLSGRCTAGLGVGFALMVAPVYSAEIATASHRGLLA
MDTL_SALSV      KIADQSGRKPVAIVGALVFMTASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR-AKV
MDTL_SALPK      KIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR-AKV
MDTL_SALPC      KIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGIGAGGCYVVAFAILRDTLDEHRR-AKV
MDTL_SALPA      KIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR-AKV
MDTL_SALCH      KIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGIGAGGCYVVAFAILRDTLDEHRR-AKV
GTR6_HUMAN      ILNDLLGRKLSIMFSAVPSAAGYALMAGAHGLWMLLLGRTLTGFAGGLTAACIPVYVSEIAPPGVRGA--
ENB1_YEAST      I-SDRFGRIECWIFALVLYTIGEIISAATPTFSGLFAGIVIQQFGYSGFRLLATALTGDLSGLRDRTFAM
YI32_SCHPO      IMSEVVGRKIVLYTSIVLFLFGSAMCGAAQNMLWLVLCRAVQGIGGGGIMSLVTIVIADITPLQTRPYYT
XYLT_LACBR      -------RRKLLLLSAIIFFVGALGSAFSPEFWTLIISRIILGMAVGAASALIPTYLAELAPSDKRGTVS
MDTH_PROMH      --------KPMIITGMLLRALGFALMALADKPWILWLSCILSALGGTLFDPPRTALVIKLTRPYERGRFY
MDTH_BLOFL      --------KPMIVSGLFMRTIGFIIMSLAHTPTLLCAACILSALGGTLFDPPRTALVIKLIRPWKLGRFY
GTR2_HUMAN      WLGDTLGRIKAMLVANILSLVGALLSKLGPSHILIIAGRSISGLYCGLISGLVPMYIGEIAPTALRGALG
PHDK_NOCSK      PVADRWGRKGVTVVGFVLFCLATALTGDIHSFAAL---RIISCFGLGAVMPVALTIVADWMPKARRAQMV
NANT_SALA4      AMGDRYGRRLAMVSSIILFSVGTLACGFAPGYTTMFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKAS
MFSD8_XENLA     LWSNHRPRREPLVVSITILVAASCLYAASHNKYYMLLARTFVGFGSGNVAVVRSYVAGATSLSERTGA--
GHT5_SCHPO      PLMDRIGKRTSIMFWTIVYLIGIILQVTAPSWVQIMVAKIWTGLSIGALSVLAPGFQSEVAPADLRGTIV
ERDL6_ARATH     QIAEYIGRKGSLMIAAIPNIIGWLCISFAKDTSFLYMGRLLEGFGVGIISYTVPVYIAEIAPQNMRG---
ERDL4_ARATH     QIAEYVGRKGSLMIAAIPNIIGWLSISFAKDTSFLYMGRLLEGFGVGIISYTVPVYIAEIAPQTMRGA--
EDL11_ARATH     QLAVILGRRRTLWACDFFCVFGWLSIAFAKNVFWLDLGRISLGIGVGLISYVVPVYIAEITPKHVRGAFT
Y567_BUCAP      PLSDRIGRKSIMSSSLLIAAVLTIICSISNNWTVIVFLRALTGLALSGVVAVAMTYIVEEVHPNSVSFCM
S22A2_MOUSE     YLADRFGRKFCLLVTILINAISGVLMAISPNYAWMLVFRFLQGLVSKAGWLIGYILITEFVGLGRRTVGI
PLT4_ARATH      -------RKWTMALAALVFQTGAAVMAVAPSFEVLMIGRTLAGIGIGLGVMIAPVYIAEISPTVARGFFT
NANT_ENTS8      -MGDRYGRRLAMISSIVLFSVGTLACGLAPGYTTLFIARLVIGIGMAGEYGASATYVIESWPKALRNKAS
MDTL_SALTI      KIADQSGRKPVAIVGAIVFMMASLLCSRASEGSLFLSGRFLQGVGAGGCYVVAFAILRDTLDEHRR-AKV
NANT2_ECOL6     -LSDKMGRRMAMVLSIVLFSLGTLACGLAPGYAVMFIARIVIGLGMAGEYGSSVTYVIESWPVHLRNKXX
GHT8_SCHPO      PLMDRIGKRVSIMFWTIVYLIGIILQVTAPSWVQIMVAKIWTGLAIGALSVLAPGFQSEVAPATLRGTIV
SPNS1_XENLA     YLGDRYNRKLIMCVGISFWSLVTLLSSFVSNFWLFLITRGLVGVGEASYSTIAPTIIADLFLADQRTRML
PMRA_STRR6      ILADKYGRKPMMIRLAMTITMGGL--AFVPNIYWLIFLRLLNGVFAG-FVPNATALIASQVPKEKSGSAL
PMRA_STRPN      ILADKYGRKPMMIRLAMTITMGGL--AFVPNIYWLIFLRLLNGVFAG-FVPNATALIASQVPKEKSGSAL
EDL10_ARATH     QLAVILGRRRTLWACDLFCIFGWLSIAFAKNVLWLDLGRISLGIGVGLTSYVVPVYIAEITPKHVRG---
BAIG_EUBSP      KLGDVLGRRTTLLLGIVIFAAGNVLTAVATSLIFMLAARFIVGIGTAAISPIVMAYIVTEYPQEETGKAF
YUSP_BACSU      KLADLLGRRIVYVSGLIIFMAASALCGMANNMTELXXXXXXXXXXXXXXXXXXXXXXXDLFTGKQRAKFQ
YN43_SCHPO      LVG----RKIPLIVGMFMFSIFSIAVAVAKDVQTVMICRFFSGFCASSPLSVVAAAFADMFDNKTRGPAV
SPNS1_XENTR     YLGDRYNRKLIMCIGISFWSLVTLLSSFVSKFWLFLLTRGLVGVGEASYSTIAPTIIADLFLADQRSRML
QAY_NEUTR       XTSYFLGRRKSLIAFSVVFIIGAAIMLAADGIAPIIAGRVLAGIGVGGASNMVPIYISELAPPAVRGRLV
MOT2_RAT        VLVNNYGSRPVLIVGGLLCCTGMILASFSSSVIELY---LTVGFIGGLGLAFNLQPALTIIGKRKRPLAN
EDL17_ARATH     NLAMVIGRRGTMWVSDFLCITGWLSIAFAKEVVLLNFGRIISGIGFGLTSYVVPVYIAEITPKHVRG---
YQO5_SCHPO      LSG----RKLPLLIGMFGFGIFNISVAVAKDIQTIMMCRFFSGFFASAPLTVVAAAFADMYSNKHRGTAI
YBIH_SCHPO      VFCNILGRKIVLYICIFFFMLGSALCGASQNMIWLIVCRAXXXXXXXXXXXXXXXXXXXXTPLRTRPMYS
STP4_ARATH      -------RKWSMFLGGFTFFIGSAFNGFAQNIAMLLIGRILLGFGVGFANQSVPVYLSEMAPPNLRGA--
OXLT_OXAFO      --------------MSVVFGINAVVLALFPTIAALIAMLAIAFFTWGGSYALFPSTNSDIFGTAYSARNY
NORA_STAAW      TLADXXXXXXXXXXXXXXFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNF
NORA_STAAU      TLADXXXXXXXXXXXXXXFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNF
NORA_STAAN      TLADXXXXXXXXXXXXXXFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNF
NORA_STAAM      TLADXXXXXXXXXXXXXXFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNF
NORA_STAAC      TLADXXXXXXXXXXXXXXFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNF
ITR2_SCHPO      -------RKRLLLCADAIFVIGSVIMAASRNVAMMVVGRFIVGYGIGLTSLIVPMYITELAPARLRGRLV
GTR12_XENLA     CLIDLYGRRTTIIFTSILLVFANLLPVVVVSYGSLIAGRIFIGVSISLSAIATCVYIAELSPQDKRGMLV
CITA_SALTY      AYIDRIGRRKGLMVTLAIMGCGTLLIALVPGYALVLLGRLLQGFSAGVELGGVSVYLSEIATPGNKG---
CITA_SALTI      AYIDRIGRRKGLMVTLAIMGCGTLLIALVPGYALVLLGRLLQGFSAGVELGGVSVYLSEIATPGNKG---
YUBD_BACSU      LLRKKFGARPVYLASLPVFILGSLLIACSGDIALMAAGRFLQGAATGXXXXXXXXXXXXSFPIERRNYAL
YHA8_SCHPO      PLSEMIGRRIVYLVTLMIYIVLQIPCALAPNIACLLIVRFFCGCFGCTPLTLAGGVISDVWETRERGLAI
NORA_STAAS      TLADXXXXXXXXXXXXXXFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNF
YWOG_BACSU      -------KKRMAIVSMALFALSSFLYMPIHNFSLLLGLR----FFQGIWFSILTTVAADIIPAKRRGEGL
VBA2_YEAST      SFSDALGRRNCLFFANGAFTIGCLACGFSKNIYMLSFMRAXXXXXXXXXXXXXXXVNSDVIPSSKRGIFQ
TSGA_YERE8      WLMEIIPLKRQLVFGFILMLIAIAGLMVGHNLMIFSISMFILGVVSGITMSIGTFLITHMYEGRQRGSRL
MDTL_ECOLU      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_ECOL5      KVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_ECO27      KVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
IOLT_BACSU      RMSDFNGRRKNILFLAVIFFISTIGCTFAPNVTVMIISRFVLGIAVGGASVTVPAYLAEMSPVESRGRMV
AQR1_YEAST      -------RRPIILAGMLIYVIASIGLACAPSYGVIIFLRCIQSIGISPTIAISSGVVGDFTLKHERGTFV
YRT3_CAEEL      LAAKFAPNKIFMLGILVASFM-NILSAISFNFIFVMVVQAVQGLALGVLYPAMHGVWKFWAPPLERSKLA
PLST1_ARATH     PLVDKFGYRRTFQIFTIPLILGALVSAQAHSLDEILCGRFLVGLGIGVNTVLVPIYISEVAPTKYRGSLG
NORA_STAAR      TLADXXXXXXXXXXXXXXFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADVSPSHQKAKNF
MSSP1_ARATH     PISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYISETAPPGQLNTLP
MDTL_ECOUT      KVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_ECOK1      KVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_ECO45      KVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTH_ENT38      --------KPMIVTGMLLRAAGFATMGIAHDPWLLWFSCFLSGLGGTLFDPPRTALVVKLIRPRQRGRFF
GTR3_CHICK      LFFNRFGRRNSMLLVNVLAFAGGALMAIAKAVEMLIIGRFIIGLFCGLCTGFVPMYISEVSPTSLRGAFG
CITA_ECOLX      AYIDRIGRRKGLMITLAIMGCGTLLIALVPGYVLVLVGRLLQGFSAGVELGGVSVYLSEIATPGNKG---
YDHC_ECOLI      -LSDRYGRKPVLLIGLTIFALGSLGMLWVENAATLLVLRFVQAVGVCAAAVIWQALVTDYYPSQKVNRIF
S22AD_HUMAN     PLCDRIGRKATILAQLLLFTLIGLATAFVPSFELYMALRFAVATAVAGLSFSNVTLLTEWVGPSWRTQAV
S17A5_HUMAN     YVASKIGGKMLLGFGILGTAVLTLFTPIAADLGVLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLL
MSSP2_ARATH     -------RRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIYISETAPPEIRG---
MDTH_ERWCT      --------KPMIITGMLLRASGFVFMAIADEPWLLWLSCALSGLGGTLFDPPRTALVIKLIRPQERGRFY
YCAD_SALAR      YLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIA--------GIGCAMIWVVVESALMCSGT
TCR2_ECOLX      KMSDRFGRRPVLLLSLIGASLDYLLLAFSSALWMLYLGRLLSGIT-GATGAVAASVIADTTSASQR----
QAY_NEUAF       XTSYFLGRRRSLIAFSVVFIIGAAIMLAADGQRRIIAGRVLAGIGVGGASNMVPIYISELAPPAVRGRLV
MDTL_ECOL6      KVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_ECO81      KVADRSGRKPVAIPGAALFIIASVFCSLAETSALFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
GTR9_HUMAN      MIGKVLGRKHTLLANNGFAISAALLMACAGAFEMLIVGRFIMGIDGGVALSVLPMYLSEISPKEIRGSTA
GTR10_XENLA     FIIDRSGRRTSIMGSNLVVLAGSIILIATSSFWWLVVGRVTVGFAISISSMACCIYVSEIVRPHQRGTLV
ERDL3_ARATH     KVADLMGRKGTMWFAQIFCIFGWVAVALAKDSMWLDIGRLSTGFAVGLLSYVIPVYIAEITPKHVRG---
Y1104_HAEIN     ALSDKYGRVRVLTWTILLFAVFTGLCAIAQGYWDLLIYRTXXXXXXXXXXXXXMALAAEAWPARHRAKAA
SPNS3_HUMAN     YLGDRHSRKATMSFGILLWSGAGLSSSISPRYSLFFLSRGIVGTGSASYSTIAPTVLGDLFVRDQRTRVL
MDTL_KLEP7      RIADRSGRKPXXXXXXXXXXXXSLICAQVHTSSHFLIGRFIQGIAAGSCYVVAFAILRDTL-DDRRRAKV
MDTL_KLEP3      RIADRSGRKPXXXXXXXXXXXXSLLCAQAHASSHFLVGRFIQGIGAGSCYVVAFAILRDTL-DDRRRAKV
MDTL_ESCF3      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_ECOSM      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
ERDL2_ARATH     KISALVGRRQTMWISDVCCIFGWLAVAFAHDIIMLNTGRLFLGFGVGLISYVVPVYIAEITPKTFRG---
TSGA_YERPY      WLMEIIPLKRQLVFGFILMLIAIAGLMVGHNLMIFSISMFIFGVVSGITMSIGTFLVTHMYEGRQRGSRL
TSGA_YERPS      WLMEIIPLKRQLVFGFILMLIAIAGLMVGHNLMIFSISMFIFGVVSGITMSIGTFLVTHMYEGRQRGSRL
TSGA_YERPP      WLMEIIPLKRQLVFGFILMLIAIAGLMVGHNLMIFSISMFIFGVVSGITMSIGTFLVTHMYEGRQRGSRL
TSGA_YERPN      WLMEIIPLKRQLVFGFILMLIAIAGLMVGHNLMIFSISMFIFGVVSGITMSIGTFLVTHMYEGRQRGSRL
TSGA_YERPE      WLMEIIPLKRQLVFGFILMLIAIAGLMVGHNLMIFSISMFIFGVVSGITMSIGTFLVTHMYEGRQRGSRL
TSGA_YERPB      WLMEIIPLKRQLVFGFILMLIAIAGLMVGHNLMIFSISMFIFGVVSGITMSIGTFLVTHMYEGRQRGSRL
TSGA_YERPA      WLMEIIPLKRQLVFGFILMLIAIAGLMVGHNLMIFSISMFIFGVVSGITMSIGTFLVTHMYEGRQRGSRL
TSGA_YERP3      WLMEIIPLKRQLVFGFILMLIAIAGLMVGHNLMIFSISMFIFGVVSGITMSIGTFLVTHMYEGRQRGSRL
SETB_SALTY      --DKKGDRKKLIVFCCVLGMLACVLFAWNRNFILLFIGVFLSSFGSTA----NPQMFALAREHADRTGRE
S17A5_SHEEP     YVASRSGGKLLLGFGIFATAIFTLFTPLAADFGVLVALRALEGLGEGVTYPAMHAMWSSWAPPLERSKLL
MOT10_MOUSE     --------KKVYLQVLSFFFIG-LMSMMIPAFGALIAVCLAMGLFDGCFISIMAPIAFELVGPQDASQAI
MFSD8_DANRE     LWSNHRPRREPLVCSIFINVSANI----------------------------------------------
MDTL_ECOSE      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_ECOLI      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_ECODH      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_ECOBW      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_ECO7I      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_ECO55      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTH_SHIFL      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
GTR1_PIG        LFVNRFGRRNSMLMMNLLAFISAVLSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALG
YYBO_BACSU      --------------------------------------------------------------PSERGLAN
TSGA_EDWI9      WLMEIIPLKRQLVFGFILMILAIAGLMVGHNLAIFSACMFVLGVVSGITMSIGTFLITHIYTGRQRGSRL
TSGA_BUCAT      WLIEIISLKKQLIFSFILTIIAVIGIVLCNSIFLFSINMFILGLVSGITMSIGTFIITHLYSGSKRGSLL
TSGA_BUCAI      WLIEIISLKKQLIFSFILTIIAVIGIVLCNSIFLFSINMFILGLVSGITMSIGTFIITHLYSGSKRGSLL
TSGA_BUCA5      WLIEIISLKKQLIFSFILTIIAVIGIVLCNSIFLFSINMFILGLVSGITMSIGTFIITHLYSGSKRGSLL
MDTL_SHISS      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_SHIFL      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_SHIDS      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_SHIBS      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_SHIB3      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_ECOLC      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_ECOHS      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_ECO8A      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_ECO5E      KVADRSGRKPVAIPGAALFIITSVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_ECO57      KVADRSGRKPVAIPGAALFIITSVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTL_ECO24      KVADRSGRKPVAIPGAALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTH_SHIB3      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECOUT      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECOSM      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECOSE      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECOLU      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECOLI      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECOLC      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECOL6      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECOL5      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECOK1      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECOHS      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECODH      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECOBW      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECO8A      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECO81      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECO7I      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECO5E      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECO57      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECO55      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECO45      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECO27      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_ECO24      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
GTR4_HUMAN      IISQWLGRKRAMLVNNVLAVLGGSLMGLAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALG
GTR4_BOVIN      IISQWLGRKRAMLFNNALAVLGGTLMGLAKSYEMLILGRFFIGAYSGLTSGLVPMYVGEIAPTHLRGALG
ERDL1_ARATH     KIAAVIGRRQTMWIADVFCIFGWLAVAFAHDKMLLNIGRGFLGFGVGLISYVVPVYIAEITPKAFRG---
YCEI_BACSU      XXXDRIGRKKVFIITLLCFSIGSGISAFVTSLSAFLILRFVIGMGLGGELPVASTLVSEAVVPEKRGRVI
MOT13_MOUSE     ---VPGPVARLLMLWTTLTGVSLALFPVAQASSTLVVLAVAYGFTSGALTPVAFSVLPELVGTGRIYCGM
GTR9_PONAB      MIGKVLGRKHTLLANNGFAISAALLMACAGAFEMLIVGRFIMGIDGGIALSVLPMYLSEISPKEIRGSTA
GTR8_HUMAN      ----RAGRKLSLLLCSVPFVAGFAVITAAQDVWMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRG---
GTR3_RAT        LFVNRFGRRNSMLLVNLIAILGGCLAKIAESVEMLILGRLIIGIFCGLCTGFVPMYIGEVSPTALRGAFG
GTR1_CHICK      LFVNRFGRRNSMLMSNILAFLAAVLSKMALSFEMLILGRFIIGLYSGLTTGFVPMYVGEVSPTALRGALG
YDJK_ECOLI      IIGDKTGRRNAFILYEAIHIASMVVGAFSPNMDFLIACRFVMG------VGLGALLVTLFAGPGRNRGTW
Y1322_DEIRA     LLSKRLPGVEWLIKALLLFVVHFALIYLAQGMPLLIATQVLRAAVLAVMAGLGMTYFQQLM-PGRFSAAT
SPNS1_DANRE     YLGDRYNRKLIMCVGIFFWSVVTLASSFKDHFWALLLTRGLVGVGEASYSTIAPTIIADLFVKEKRTNML
S22FL_XENLA     PLSDKLGRRPVYLSGLFFDIIFGYFTALAPSYEVFAVSRFFVGVMNGGMALVSFVLTQEYVGK-------
S22A5_HUMAN     QLSDRFGRKNVLFVTMGMQTGFSFLQIFSKNFEMFVVLFVLVGMGQ-----ISNYVAAFVLGTEILGKSV
QACA_STAAU      AFADKWGRKKALLTGFALFGLVSLAIFFAESAEFVIAIRFLLGIA-GALIMPTTLIRVIFENPKERATAL
QACA_STAAM      AFADKWGRKKALLTGFALFGLVSLAIFFAESAEFVIAIRFLLGIA-GALIMPTTLIRVIFENPKERATAL
PLT5_ARATH      -------RRYTIVLAGAIFFAGAILMGLSPNYAFLMFGRFIAGIGVGYALMIAPVYTAEVSPASSRGFPE
PLT1_ARATH      -------RRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAPVYTAEVAPASSRGFLT
MOT8_RAT        HISDSIPGLKKIYXXXXXXXXXXXMSMMIPDFGGLIVVCLFLGLCDGFFITIMAPIAFELVGPMQASQAI
BENK_ACIAD      TIADKLERKKVIAVCIILFSLCTVLCGFSETTTQFSIFRFLAGVGIGGVMPNVIALVSEYAPKKFKSFFV
YN2F_SCHPO      LFGRRRP----MIIAVFIFCIFHIAVATAKDIQTVMICRFFCGFFGSSPITTVAGSFSDMFSARTRGLVI
YCT4_SCHPO      PLSEVYGRLPLYSVTLVIFVVFQIGGGCSKNIWSLVIFR----FFHG-FFGCTPMSASDLFNPIQRTGAL
YCAD_SALEP      YLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIA--------GIGCAMIWVVVESALMCSGT
YBJJ_ECOLI      WLVKRFGTRNVILVTMSCALIGMMIXXXXXXXXXXXXFAVGLG-VFGASFG-SAEVAINVEGAAEMNKTV
SPNS3_MOUSE     YLGDRYNRKAILSFGILLWSGAGLSSSISYQYSLFFLSRGFVGTGAASYSTIAPTVLGDLFVKDQRTCAL
MDTL_SHIF8      XXXDRSGRKPVAIPGSALFIIASVFCSLAETSTLFLAGRFLQGLGAGCCYVVAFAILRDTLDDRRR-AKV
MDTH_SHIBS      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
GTR3_CANFA      LFVNRFGRRNSMLMVNLLAVAGGCLMGIAQSVEMLILGRLIIGLFCGLCTGFVPMYIGEISPTALRGAFG
BCR_HAEIN       PFGDSFGRKPIILLGVIVGALTALVLTEINSVGNFTALRFVQGFFGAAPVVLSGALLRDLFSKDQLSKVM
BCRH_RICTY      RLSDIYGRRPIVLLGLXXXXXXXXXXXXXXXXEMLMIARFIQAFG----VSVGSVIGQSMARDSYQGAEL
YFIG_BACSU      --SDRHGRRKTILYLALLFIAATLGCTFSPNASVMIAFRFLLGLAVGCASVTVPTFLAEISPAERRGRIV
YD199_YEAST     -------RKKMLQISTMIYSLGAIVQVLALNQWCLLLGRFLLGVGMGFAFSMVIIYQFEFPLPCIRKRT-
YCAD_ESCF3      YLIKRLGFNRSYYLASLVFAAGCLGLGLMIGFWSWMAWRFVAGVGCAM---IWVVVESALMCSGNRGRLL
Y1421_ENT38     ----------------------------------------------------------------------
TSGA_SERP5      WLMEIIPLKRQLMVLMVLAIAGLMLGKSLTMFSLCMF---ILGVVSGITMSIGTFLITHMYAGRQRGSRL
TSGA_SALTI      WLMEIVPLKTQLFILMVLAVAGLMFSH---SLALFSAAMFVLGLVSGITMSIGTFLITQLYEGRQRGSRL
TSGA_SALSV      WLMEIIPLKTQLFILMVLAVAGLMFSH---SLALFSAAMFVLGLVSGITMSIGTFLITQLYEGRQRGSRL
TSGA_SALNS      WLMEIIPLKTQLFILMVLAVAGLMFSH---SLALFSAAMFVLGLVSGITMSIGTFLITQLYEGRQRGSRL
TSGA_SALAR      WLMEIVPLKTQLFILMILAVAGLMLSH---SLALFSAAMFVLGLVSGITMSIGTFLITQLYEGRQRGSRL
TSGA_SALA4      WLMEIIPLKTQLFILMVLAVAGLMFSH---SLALFSAAMFVLGLVSGITMSIGTFLITQLYEGRQRGSRL
S22A7_HUMAN     YLSDRFGRRRLLLVAYVSTLVLGLASAASVSYVMFAITRTLTGSALAGFTIIVMPLELEWLDVEHRTVAS
S22A1_RABIT     YIADRFGRKLCLLLTTLINAVSGVLTAVAPDYTSMLLFRLLQGLVSKGSWMSGYTLITEFVGSGRRTVAI
MDTH_SHIF8      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFF
MDTH_SALTI      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCFLSGLGGTLFDPPRSALVVKLIRPEQRGRFF
MDTH_SALSV      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCFLSGLGGTLFDPPRSALVVKLIRPEQRGRFF
MDTH_SALPK      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCFLSGLGGTLFDPPRSALVVKLIRPEQRGRFF
MDTH_SALPC      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCFLSGLGGTLFDPPRSALVVKLIRPEQRGRFF
MDTH_SALPB      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCFLSGLGGTLFDPPRSALVVKLIRPEQRGRFF
MDTH_SALPA      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCFLSGLGGTLFDPPRSALVVKLIRPEQRGRFF
MDTH_SALNS      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCFLSGLGGTLFDPPRSALVVKLIRPEQRGRFF
MDTH_SALHS      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCFLSGLGGTLFDPPRSALVVKLIRPEQRGRFF
MDTH_SALG2      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCFLSGLGGTLFDPPRSALVVKLIRPEQRGRFF
MDTH_SALEP      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCFLSGLGGTLFDPPRSALVVKLIRPEQRGRFF
MDTH_SALDC      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCFLSGLGGTLFDPPRSALVVKLIRPEQRGRFF
MDTH_SALCH      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCFLSGLGGTLFDPPRSALVVKLIRPEQRGRFF
MDTH_SALA4      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCFLSGLGGTLFDPPRSALVVKLIRPEQRGRFF
GTR8_RAT        ----RAGRKLSLLLCTVPFVTGFAVITAARDVWMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRG---
GTR8_MOUSE      ----RSGRKLSLLLCTVPFVTGFAVITAARDVWMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRG---
GTR3_SHEEP      LFVNRFGRRNSMLIVNLLAIAGGCLMGIAESVEMLILGRLIIGLFCGLCTGFVPMYIGEISPTALRGAFG
GTR1_BOVIN      LFVNRFGRRNSMLMMNLLAFVSAVLSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTELRGALG
EDL16_ARATH     KISDFSGRKGAMRTSACFCITGWLAVFFTKGALLLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGGLT
BCRH_RICPR      RLSDIYGRRPIVLLGLXXXXXXXXXXXXXXXXEMLMIARFIQAFG----VSVGSVIGQSMARDSYQGAEL
BCRH_RICFE      RLSDIYGRRPIALLGLFIYVXXXXXXXFAVNIEMLMIARFVQAFG----VSVGSVIGQAMARDSYQGSEL
YDFJ_ECOLI      KMGDRIGRKKVLFITITMMGICTTLIGVLPTYALLVTLRIIQGLGAGAISGAGTML-AEYAPKGKRGIIS
TSGA_SALPK      WLMEIVPLKTQLFILMVLAVAGLMFSH---SLALFSAAMFVLGLVSGITMSIGTFLITQLYEGRQRGSRL
TSGA_SALPB      WLMEIIPLKTQLFILMVLAVAGLMFSH---SLALFSAAMFVLGLVSGITMSIGTFLITQLYEGRQRGSRL
TSGA_SALPA      WLMEIVPLKTQLFILMVLAVAGLMFSH---SLALFSAAMFVLGLVSGITMSIGTFLITQLYEGRQRGSRL
TSGA_SALHS      WLMEIVPLKTQLFILMVLAVAGLMFSH---SLALFSAAMFVLGLVSGITMSIGTFLITQLYEGRQRGSRL
TSGA_SALG2      WLMEIVPLKTQLFILMVLAVAGLMFSH---SLALFSAAMFVLGLVSGITMSIGTFLITQLYEGRQRGSRL
TSGA_SALEP      WLMEIVPLKTQLFILMVLAVAGLMFSH---SLALFSAAMFVLGLVSGITMSIGTFLITQLYEGRQRGSRL
TSGA_SALDC      WLMEIVPLKTQLFILMVLAVAGLMFSH---SLALFSAAMFVLGLVSGITMSIGTFLITQLYEGRQRGSRL
SETB_ECOLI      --DKRGDRKSLIVFCCLLGVLACTLFAWNRNFVLLFVGVFLSSFGSTANPQM-FALAREHADKTGREAVM
S22A6_RABIT     YLADRLGRRKVLILNYLQTAVSGTCAAFSPNFTVYCTFRL-------------------LSGMSLAGIAL
S17A5_MOUSE     YIASRVXXXXXXXXXXXXTSVFTLFTPLAADLGVLVVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLL
MOT2_MOUSE      VLVNNYGSRPVVIVGGLLCCIGMILASYSNSVIELY---LTVGFIGGLGLAFNLQPALTIIGPLANGCAM
MOT10_RAT       --------KKVYLQVLSFFFIGSMMIPLCSVFGALIALCLIMGLFDGCFISIMAPIAFELVGPQDASQAI
MDTH_YERE8      --------KPMIVTGMLMRAAGFALMAMADEPWILWLACALSGLGGTLFDPPRTALVIKLTRPHERGRFY
MDTH_SALAR      --------KPMIVTGMLMRAAGFATMGIAHEPWLLWFSCFLSGLGGTLFDPPRSALVVKLIRPEQRGRFF
GTR8_BOVIN      ----RAGRKLSLVLCALPFVAGFAVITAAQNLWMLLGGRLLTGLACGIASLVAPVYISEIAYPEVRG---
GTR3_HUMAN      LFVNRFGRRNSMLIVNLLAVTGGCLCKVAKSVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFG
GTR1_RABIT      LFVNRFGRRNSMLMMNLLAFVSAVLSKLAKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALG
GTR10_HUMAN     -----------------------------------VLGRAVVGFAISLSSMACCIYVSELVGPRQRGVLV
ERD6_ARATH      KVADVLGRKRTMLFCEFFCITGWLCVALAQNAMWLDCGRLLLGIGVGIFSYVIPVYIAEIAPKHVRG---
EMRY_ECOLI      RLAQRIGEXXXXXXXXXXXXXXXXXXXXXTNLDVLIFFRVVQGLMAGPLIPLSQSLLLRNYPPEKRTFAL
YCAD_SALTY      YLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIA--------GIGCAMIWVVVESALMCSGT
YCAD_SALTI      YLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIA--------GIGCAMIWVVVESALMCSGT
YCAD_SALSV      YLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIA--------GIGCAMIWVVVESALMCSGT
YCAD_SALPK      YLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIA--------GIGCAMIWVVVESALMCSGT
YCAD_SALPC      YLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIA--------GIGCAMIWVVVESALMCSGT
YCAD_SALPA      YLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIA--------GIGCAMIWVVVESALMCSGT
YCAD_SALNS      YLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIA--------GIGCAMIWVVVESALMCSGT
YCAD_SALHS      YLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIA--------GIGCAMIWVVVESALMCSGT
YCAD_SALCH      YLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIA--------GIGCAMIWVVVESALMCSGT
YCAD_SALA4      YLIKRIGFNRSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIA--------GIGCAMIWVVVESALMCSGT
TCR1_ECOLX      ALSDRFGRRPVLLVSLAGAAVDYAIMATAP----------------------------------------
S22A7_PONAB     YLSDRFGRRRLLLVAYVSTLVLGLASAASVSYVMFAITRTLTGSALAGFTIIVMPLELEWLDVEHRTVAS
S22A6_RAT       YLADRLGRRKVLILNYLQTAVSGTCAAYAPNYTVYCVFRLLS------------------------GMSL
S22A6_MOUSE     YLADRLGRRKVLILNYLQTAVSGTCAAYAPNYTVYCIFRLLS------------------------GMSL
MDTH_ENTS8      --------RPMIVTGMLLRAAGFATMAVAHEPWVLWLSCVLSGLGGTLFDPPRSALVVKLVRPQERGRFF
GUDP_BACSU      WLLDRFGSKTIIALSIFFWSFFTLLQGAIGFFSLLFALRFLVGLSEAPSFGNGRVVASWFPS-SERGTAS
GTR3_BOVIN      LFVNRFGRGNSMLIVNLLAIAGGCLMGIAESVEMLILGRLIIGLFCGLCTGFVPMYIGEISPTALRGAFG
GTR14_HUMAN     LFVNRFGRRNSMLIVNLLAATGGCLMGIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFG
GTR10_XENTR     ----------------LVVLAGSIILIATSTFWWLIVGRVTIGFAISISSMACCIYVSEIVRPHQRGMLV
ERDL8_ARATH     KISDFIGRKGAMRLSSVISAIGWLIIYLAKGDVPLDFGRFLTGYGCGTLSFVVPVFIAEISPRKLRGATL
ERDL5_ARATH     RIADMIGRRATMGFSEMFCILGWLAIYLSKVAIWLDVGRFLVGYGMGVFSFVVPVYIAEITPKGLRGGFT
YQEH_SCHPO      PLSDLLGRKLVYIGSLIIYVCFCISCALARNYAQLVISMLIMGVVGSTALGNVAGAVADVLGDEDSNWGM
YCAD_SALPB      YLIKRIGFNHSYYLASLIFAAGCVGLGVMVGFWSWMSWRFIA--------GIGCAMIWVVVESALMCSGT
YAJR_ECOLI      LLSDRIGRKPLIVGGLAVFAAGSVIAALSDSIWGIILGRALQG--SGAIAAAVMALLSDLTREQNRTKAM
TSGA_SHIB3      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSTAMFILGVVSGITMSIGTFLITQMYEGRQRGSRL
TSGA_ECOUT      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLVTQMYEGRQRGSRL
TSGA_ECOSM      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLVTQMYEGRQRGSRL
TSGA_ECOSE      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLVTQMYEGRQRGSRL
TSGA_ECOLI      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLVTQMYEGRQRGSRL
TSGA_ECOL6      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLVTQMYEGRQRGSRL
TSGA_ECOL5      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLVTQMYEGRQRGSRL
TSGA_ECOK1      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLVTQMYEGRQRGSRL
TSGA_ECODH      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLVTQMYEGRQRGSRL
TSGA_ECOBW      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLVTQMYEGRQRGSRL
TSGA_ECO8A      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLVTQMYEGRQRGSRL
TSGA_ECO81      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLVTQMYEGRQRGSRL
TSGA_ECO5E      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLVTQMYEGRQRGSRL
TSGA_ECO57      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLVTQMYEGRQRGSRL
TSGA_ECO55      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLVTQMYEGRQRGSRL
TSGA_ECO45      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLVTQMYEGRQRGSRL
TSGA_ECO27      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLVTQMYEGRQRGSRL
TSGA_ECO24      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLVTQMYEGRQRGSRL
STP8_ARATH      ----RRPTMQLASIF---FLIGVGLAAGAVNIYMLIIGRILLGF--GVGFGNQAVFLSEIAPARLRG---
SETA_ECOLI      WLAKRSDSRRKLIIFCCLMAIGNLLFAFNRHYLTLITGVLLASLANTAMPQL-FALAREYADNSAREVVM
MUCK_ACIAD      WACDRFGRVRIVVISILTFSILTCGLGLTQSFIQFGVLRFFASLGLGSLYIACNTLMAEYVPTKYRTTVL
MOT13_RAT       ------PVARLLMLWTTLTGVSLALFPVAQASTTLVVLAVAYGFTSGALTPVAFSVIPELVGTGRIYCGL
MDTH_YERPY      --------KPMIVTGMLMRAAGFALMAMADEPWILWLACALSGLGGTLFDPPRTALVIKLTRPHERGRFY
MDTH_YERPS      --------KPMIVTGMLMRAAGFALMAMADEPWILWLACALSGLGGTLFDPPRTALVIKLTRPHERGRFY
MDTH_YERPP      --------KPMIVTGMLMRAAGFALMAMADEPWILWLACALSGLGGTLFDPPRTALVIKLTRPHERGRFY
MDTH_YERPN      --------KPMIVTGMLMRAAGFALMAMADEPWILWLACALSGLGGTLFDPPRTALVIKLTRPHERGRFY
MDTH_YERPG      --------KPMIVTGMLMRAAGFALMAMADEPWILWLACALSGLGGTLFDPPRTALVIKLTRPHERGRFY
MDTH_YERPE      --------KPMIVTGMLMRAAGFALMAMADEPWILWLACALSGLGGTLFDPPRTALVIKLTRPHERGRFY
MDTH_YERPB      --------KPMIVTGMLMRAAGFALMAMADEPWILWLACALSGLGGTLFDPPRTALVIKLTRPHERGRFY
MDTH_YERPA      --------KPMIVTGMLMRAAGFALMAMADEPWILWLACALSGLGGTLFDPPRTALVIKLTRPHERGRFY
MDTH_YERP3      --------KPMIVTGMLMRAAGFALMAMADEPWILWLACALSGLGGTLFDPPRTALVIKLTRPHERGRFY
MDTH_SODGM      --------KPMIIAGMLMRALGFVLMGIADEPXXXXXXXXXXXXXXTLFDPPRTALVIKLTRPWERGRFY
GTR2_MOUSE      WLGDKLGRIKAMLAANSLSLTGALLSKFGPAHALIIAGRSVSGLYCGLISGLVPMYIGEIAPTTLRGALG
EXUT_ECOLI      ----------------------------------------------------------------ERSIAV
EXUT_ECO57      ----------------------------------------------------------------ERSIAV
EDL18_ARATH     KMAIILGRRKTMWVSDLLCIIGWFSIAFAKDVMWLNFGRXXXXXXXXXXXYVVPVYIAEISPKHVRG---
Y2171_CITK8     YLIKRLGFNRSYYIASLIFAAGCVGLGMMIGFWSWLAWRFVAGVGCAM---IWVVVESALMCSGNRGRLL
TSGA_SHISS      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSTAMFILGVVSGITMSIGTFLITQMYEGRQRGSRL
TSGA_SHIFL      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSTAMFILGVVSGITMSIGTFLITQMYEGRQRGSRL
TSGA_SHIF8      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSTAMFILGVVSGITMSIGTFLITQMYEGRQRGSRL
TSGA_SHIDS      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLITQMYEGRQRGSRL
TSGA_SHIBS      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSTAMFILGVVSGITMSIGTFLITQMYEGRQRGSRL
TSGA_ERWT9      WLMEIVPLKRQLIVLMVLAVLGLMNSHSLSVFSLCM---FVLGVVSGITMSIGTFLITHLYEGRQRGSRL
TSGA_ECOLU      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLITQMYEGRQRGSRL
TSGA_ECOLC      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSTAMFILGVVSGITMSIGTFLITQMYEGRQRGSRL
TSGA_ECOHS      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSTAMFILGVVSGITMSIGTFLITQMYEGRQRGSRL
TSGA_ECO7I      WLMEIVPLKTQLFLLMVLAVAGLMFSH---SLALFSAAMFILGVVSGITMSIGTFLITQMYEGRQRGSRL
TCR8_PASMU      RLSDKYGRKPILLFSLLGAALDYLLMAFSTTLWML-----------------------------------
STP7_ARATH      PITRNYGRRASIVCGGISFLIGSGLNAGAVNLAMLLAGRIM--------LGVGIGFGNQAVPLYLSEVAP
MSSP3_ARATH     TVSDKVGRRSMLILSSVLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETAPSEIRGLLN
MOT8_MOUSE      HISDSIPGLKKIYXXXXXXXXXXXMSMMIPDFGGLIVVCLFLGLCDGFFITIMAPIAFELVGPMQASQAI
MOT8_HUMAN      HISDSIPGLKKIYXXXXXXXXXXXMSMMIPDFGGLIVVCLFLGLCDGFFITIMAPIAFELVGPMQASQAI
MDTH_BLOPB      -----------------------------------------------------TALVIKLVRPWELGRFY
HXT10_YEAST     RLGDIYGRKIGLMCVILVYVVGIVIQASSDKWYQYFIGRIVSGMGVGGVAVLSPTLISEISPKHLRGTCV
GTR2_BOVIN      LLGDKLGRIKALLVANILSLVGALLSKLGPSHXXXXXXXXXXXXYCGLISGLIPMYIGEIAPTTLRGAIG
GTR1_RAT        LFVNRFGRRNSMLMMNLLAFVSAVLSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALG
GTR1_MOUSE      LFVNRFGRRNSMLMMNLLAFVAAVLSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALG


                         +         .         .         .         .         *         .:210
query           AYMFSGISLANLIGVPIGTWIGTMANWRTTFLVIAALGILTAVAIAYLVPNLPSPKNVRVGREIKALTHP
YDHP_ECOLI      ATMFMGLTLANIGGVPAATWLGETIGWRMSFLATAGLGVISMVSLFFSLPKGGAGARPEVKKELAVLMRP
YDHP_ECO57      ATMFMGLTLANIGGVPAATWLGETIGWRMSFLATAGLGVISMVSLFFSLPKGGAGARPEVKKELAVLMRP
YFHI_BACSU      ASMNGGLTVALMLGVPFGSYLGDVLNWRAVFSIITALGVIGFLGLMAAVPNRKPKVIPMLMNEWGVFKHK
YTBD_BACSU      SIMFTGLTVATVTGVPFGTFIGQQFGWRFAFMVIIAVGIIAFITNGILVPSLRKGTKTTMRDQLKLVTNS
ARAJ_ECOLI      AGMVSGMTVANLLGIPLGTYLSQEFSWRYTFLLIAVFNIAVMASVYFWVPDIRDEAKGNLREQFHFLRSP
SOTB_CITK8      SLIATGTALAMVLGLPIGRIVGQYFGWRTTFFAIGIGALITLVCLIKLLPKLPSEHSGSLKSLPLLFRRP
PBUE_BACAM      GIIFMGFSSAIALGVPVGIIISNAFGWRVLFLGIGVLSLVSMLIISVFFEKIPAEKMIPFREQIKTIGNA
SOTB_ERWCH      GLIATGSSLAMVLGLPLGRVIGQYLGWRVTFLTIAAGATVAMIXXXXXXXXXXSEHSGSLGSVPKLFRRP
PBUE_BACSU      GIIFMGFSSAIALGVPLGILISDSFGWRXXXXXXXXXXXXXXXXXXXFFERIPAEKMIPFREQLKTIGNL
SOTB_HAEIN      GMLAIGTALATILGLPIGRIVGQLVGWRVTFGIIAVLALSIMFLIIRLLPNLPSKNAGSIASXXXXXXXX
SOTB_HAEIG      GMLAIGTALATILGLPIGRIVGQLVGWRVTFGIIAVLALSIMFLIIRLLPNLPSKNAGSIASXXXXXXXX
SOTB_HAEI8      GMLAIGTALATILGLPIGRIVGQLVGWRVTFGIIAVLALSIMFLIIRLLPNLPSKNAGSIASXXXXXXXX
YBCL_BACSU      ATVVMGFTASLIIGVPLGRMIAVALGWKSVFGAIALLGLIAMVVIFFTLPYTEGDKPVPLLQQLALFKKR
SOTB_ECOLU      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAFITXXXXXXXXXXXPSEHSGSLKSLPLLFRRP
SOTB_PSEA7      XXXXXXXXXXXXXXIPLGRVVGEALGWRTTFMAIAGLSVLTLLYLVRSLPPLPSQNSGSLRSLPMLFRRP
SOTB_HELPG      XXXXXXXXXXXXXXXPLGRIIGQMLDWRSTFGVIGGVATLIALLMWKLLPPLPSRNAGTLASVPILMKRP
SOTB_SALNS      SLIATGTALAMVLGLPIGRVVGQYFGWRTTFFAIGMGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_SHIFL      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXPSEHSGSLKSLPLLFRRP
SOTB_SALSV      SLIATGTALAMVLGLPIGRVVGQYFGWRTTFFAIGMGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_SHIF8      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXPSEHSGSLKSLPLLFRRP
NEPI_SHISS      SVIFGAVSIALVIAAPLGSFLGELIGWRNVFNAAAVMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRP
SOTB_SALTI      SLIATGTALAMVLGLPIGRVVGQYFGWRTTFFAIGMGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_SALPB      SLIATGTALAMVLGLPIGRVVGQYFGWRTTFFAIGMGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_SALHS      SLIATGTALAMVLGLPIGRVVGQYFGWRTTFFAIGMGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_SALG2      SLIATGTALAMVLGLPIGRVVGQYFGWRTTFFAIGMGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_SALEP      SLIATGTALAMVLGLPIGRVVGQYFGWRTTFFAIGMGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_SALDC      SLIATGTALAMVLGLPIGRVVGQYFGWRTTFFAIGMGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_SALA4      SLIATGTALAMVLGLPIGRVVGQYFGWRTTFFAIGMGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_SALPC      SLIATGTALAMVLGLPIGRVVGQYFGWRTTFFAIGMGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_SALCH      SLIATGTALAMVLGLPIGRVVGQYFGWRTTFFAIGMGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ECO5E      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
NEPI_ECOL5      SVIFGAVSIALVIAAPLGSFLGELIGWRNVFNAAAAMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRP
SOTB_SALAR      SLIATGTALAMVLGLPIGRVVGQYFGWRTTFFAIGMGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
NEPI_ECOL6      SVIFGAVSIALVIAAPLGSFLGELIGWRNVFNAAAAMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRP
SOTB_SALTY      SLIATGTALAMVLGLPIGRVVGQYFGWRTTFFAIGMGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_SALPK      SLIATGTALAMVLGLPIGRVVGQYFGWRTTFFAIGMGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRCP
SOTB_SALPA      SLIATGTALAMVLGLPIGRVVGQYFGWRTTFFAIGMGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRCP
SOTB_ECOL5      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
NEPI_ECOUT      SVIFGAVSIALVIAAPLGSFLGELIGWRNVFNAAAAMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRP
NEPI_ECOK1      SVIFGAVSIALVIAAPLGSFLGELIGWRNVFNAAAAMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRP
NEPI_ECO27      SVIFGAVSIALVIAAPLGGFLGELIGWRNVFNAAAAMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRP
SOTB_ECOUT      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ECOL6      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ECOK1      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ECO81      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ECO45      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ECO27      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_SHISS      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_SHIBS      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_SHIB3      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ESCF3      XXXXXXXXXXMVLGLPVGRIVGQYFGWRTTFLAIGVGAFXXXXXXXXXXXXXPSEHSGSLKSLPVLFRRP
SOTB_ECOSM      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ECOSE      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ECOLI      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ECOLC      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ECOHS      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ECODH      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ECOBW      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ECO8A      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ECO7I      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ECO55      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ECO24      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_ECO57      SLIATGTALAMVLGLPLGRIVGQYFGWRMTFFAIGIGAXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
NEPI_SHIDS      SVIFGAVSIALVIAAPLGSFLGELIGWRNVFNAAAVMGVLCIFWIIKSLPSLPGKPSHQKQNTFRLLQRP
NEPI_ECO57      SVIFGAVSIALVIAAPLGCFLGELIGWRNVFNAAAAMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRP
NEPI_SHIFL      SVIFGAVSIALVIAAPLGSFLGELIGWRNVFNAAAVMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRP
NEPI_SHIF8      SVIFGAVSIALVIAAPLGSFLGELIGWRNVFNAAAVMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRP
NEPI_ECOLI      SVIFGAVSIALVIAAPLGSFLGELIGWRNVFNAAAVMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRP
NEPI_ECOBW      SVIFGAVSIALVIAAPLGSFLGELIGWRNVFNAAAVMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRP
SOTB_HELAH      XXXXXXXXXXXXXXXPLGRIIGQMLDWRSTFGMIGGXXXXXXXXMYRLLPSLPSRNAGTLSSLPVLMKRP
SOTB_ERWT9      SMMATGTALAMVLGLPIGRMIGQLLGWRITFAVIGAVAFVTMXXXXXXXXXXXSEHTGSLKSVPMLFRRP
NEPI_SHIBS      SVIFGAVSIALVIAAPLGSFLGELIGWRNVFNAAAVMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRP
SOTB_KLEP7      SLIATGTALAMVFGIPIGRIIGQYFGWRMTFXXXXXXXXXXXXXXVKLLPTLPSEHSGSLKSLPVLFRRP
SOTB_HELPH      XXXXXXXXXXXXXXXPLGRIIGQMLDWRSTFGVIGGVATLIALLMWKLLPHLPSRNAGTLASVPILMKRP
SOTB_ENT38      XXXXXXXXXXMVLGLPIGRIVGQYFGWRTTFFXXXXXXXXXXXXXXXXXXXXXSEHSGSLKSLPLLFRRP
SOTB_HELP2      XXXXXXXXXXXXXXXPLGRIIGQILDWRSTFGVIGGVATLIMLLMWKLLPHLPSRNAGTLASVPVLMKRP
SOTB_HELPY      XXXXXXXXXXXXXXXPLGRIIGQILDWRSTFGVIGGVATLIALLMWKLLPHLPSRNAGTLASVPVLMKRP
SOTB_HELPJ      XXXXXXXXXXXXXXXPLGRIIGQILDWRSTFGVIGGVATLIMLLMWKLLPHLPSRNAGTLASVPILMKRP
SOTB_PSE14      XXXXXXXXXXMVLGIPLGRVLGEALGWRTTFLGIAGIXXXXXXXXXXXXXXXXSQNSGSLRSLPILFKRP
SOTB_KLEP3      SLIATGTALAMVFGIPIGRIIGQYFGWRMTFXXXXXXXXXXXXXXVKLLPTLPSEHSGSLKSLPVLFRRP
SOTB_PSEAE      XXXXXXXXXXXXXXIPLGRVVGEALGWRTTFMAIAGLSVXXXXXXXXXXXXXPSQNSGSLRSLPMLFRRP
SOTB_PSEAB      XXXXXXXXXXXXXXIPLGRVVGEALGWRTTFMAIAGLSVXXXXXXXXXXXXXPSQNSGSLRSLPMLFRRP
SOTB_PSEA8      XXXXXXXXXXXXXXIPLGRVVGEALGWRTTFMAIAGLSVXXXXXXXXXXXXXPSQNSGSLRSLPMLFRRP
SOTB_PASMU      GLLAIGCSLAMILGLPLGRLIGQFFGWRATFXXXXXXXXXXXXXFYQLLPHLPS-KNAGSLNSLPTLFKR
CMLR_STRLI      AVLLSGTTVATVAGVPGGSLLGTWLGWRATFWAVAAFGVLKXXXXXXXXXXXXXXXXLRV--ELAALKTP
SOTB_PSEU2      XXXXXXXXXXMVLGIPLGRVLGEALGWRTTXXXXXXXXXXXXXXXXXXXXXXXSQNSGSLRSLPILFKRP
SOTB_PSESM      XXXXXXXXXXMVLGIPLGRVLGEALGWRTTXXXXXXXXXXXXXXXXXXXXXXXSQNSGSLRSLPILFKRP
SOTB_PSEE4      XXXXXXXXXXMVMGIPLGRVVGEALGWRITFLCIAGVALATMLCLMKSLPLLPSQNSGSLRSLPILFKRP
YWFA_BACSU      GLIVSSWSLALIFGVPLGSFIGGVLHWRWTFWIFALMGXXXXXXXXXEMRRHAQHKNEPAGTFRDALKVP
NEPI_SALPK      SVIFGAVSIALVIAAPLGSFLGGIIGWRNVFNAAAVMGVLCVIWVVKSLPSLPGEPSHQKQNMFSLLQRP
NEPI_SALPA      SVIFGAVSIALVIAAPLGSFLGGIIGWRNVFNAAAVMGVLCVIWVVKSLPSLPGEPSHQKQNMFSLLQRP
NEPI_SALG2      SVIFGAVSIALVIAAPLGSFLGGIIGWRNVFNAAAVMGVLCVIWVVKSLPSLPGEPSHQKQNMFSLLQRP
NEPI_SALEP      SVIFGAVSIALVIAAPLGSFLGGIIGWRNVFNAAAVMGVLCVIWVVKSLPSLPGEPSHQKQNMFSLLQRP
NEPI_SALTY      SVIFGAVSIALVIAAPLGSFLGGIIGWRNVFNAAAVMGVLCVIWVVKSLPSLPGEPSHQKQNMFSLLQRP
NEPI_SALTI      SVIFGAVSIALVIAAPLGSFLGGIIGWRNVFNAAAVMGVLCVIWVVKSLPSLPGEPSHQKQNMFSLLQRP
NEPI_SALPC      SVIFGAVSIALVIAAPLGSFLGGIIGWRNVFNAAAVMGVLCVIWVVKSLPSLPGEPSHQKQNMFSLLQRP
NEPI_SALPB      SVIFGAVSIALVIAAPLGSFLGGIIGWRNVFNAAAVMGVLCVIWVVKSLPSLPGEPSHQKQNMFSLLQRP
NEPI_SALCH      SVIFGAVSIALVIAAPLGSFLGGIIGWRNVFNAAAVMGVLCVIWVVKSLPSLPGEPSHQKQNMFSLLQRP
OPDE_PSEAE      XXXXXXXXXXTVVAAPLGAWLGTLIGWRGAFLCXXXXXXXXXXWQWTTLPSMPGPGNVFT--VFALLKRP
SOTB_PSEPK      XXXXXXXXXXXXXXIPLGRVVGEALGWRITFLSIAGVALATMLCLIKSLPLLPSQNSGSLRSLPVLFKRP
SOTB_PSEPG      XXXXXXXXXXXXXXIPLGRVVGEALGWRITFLSIAGVALATMLCLMKSLPLLPSQNSGSLRSLPILFKRP
SOTB_PSEPW      XXXXXXXXXXXXXXIPLGRVVGEALGWRVTFLSIAGVALATMLCLMKSLPLLPSQNSGSLRSLPILFKRP
SOTB_MANSM      XXXXXXXXXXXXXXXPLGRIIGQAFGWRTTFTXXXXXXXXXXXXXXXXXPKIPS-QNAGSLKSLPVLARP
SOTB_ERWCT      XXXXXXXXXXXXXXXXXXXXXXQYLGWRVTFVLIGLIAAVIMVGLMKLLP--------------------
YCEJ_BACSU      GIATAGLAASQMLGLPIGGFLASF-TWHTPFFVXXXXXXXXXXXXXXVMPGLARPSIVNPYRELFSLPKT
GALP_ECOLI      SMYQLMITIGILGAYLSDTAFSYTGAWRWMLGVIIIPAILLLIGVFFL-PDSP-----------------
GALP_ECOL6      SMYQLMITIGILGAYLSDTAFSYTGAWRWMLGVIIIPAILLLIGVFFL-PDSP-----------------
YCNB_BACSU      GMVGLVISFAPAIGPTLSGWAVEAFSWRSLFYIILPFAVIDLILASILMKNVTTLRKTQI----------
YFIU_BACSU      GLLGAMNGMAAVLGPNIGSFLDWTGSWHWLFLINLPIAVLLVVFGACFIAETKAPEAKRL----------
YHCA_BACSU      GIFGLAMMFAPAVGPTLSGWIIEHYTWRIMFYGLVPIGXXXXXXXXXXXKNMVEPQKIKL----------
EXUT_BACSU      GVTNSGTPLGGAISGPIVGMIAVAFSWKVSFVLIMIIGLIWAVLWFKFVKEKPQ-ETIKEAPAIKAETSP
TCR_STRPN       GLIGSIVAMGEGVGPAIGGMIAHYIHWSYLLLI----PMITIITVPFLMKLLKKEVRIKGHFDIKGIILM
TCR_BACSU       GLIGSIVAMGEGVGPAIGGMIAHYIHWSYLLLI----PMITIITVPFLMKLLKKEVRIKGHFDIKGIILM
TCR_BACST       GLIGSIVAMGEGVGPAIGGMIAHYIHWSYLLLI----PMITIITVPFLMKLLKKEVRIKGHFDIKGIILM
TCR_BACCE       GLIGSIVAMGEGVGPAIGGMIAHYIHWSYLLLI----PMITIITVPFLMKLLKKEVRIKGHFDIKGIILM
EMRB_HAEIN      AFWSMTIVVAPIFGPILGGWISDNIHWGWIFFINVPIG-LSVVLISWKI---------------------
YGAY_ECOLI      GTIMSGLLLGILLARTVAGLLANLGGWRTVF---------------------------------------
YGAY_ECO57      GTIMSGLLLGILLARTVAGLLANLGGWRTVF---------------------------------------
ARAE_KLEOX      SMYQLMVTLGIVMAFLSDTAFSYSGNWR------------------------------------------
SGE1_YEAST      TALAISYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAFIILAFCNTSGEPHQKMWLPSKIKKIMNY
TCR_STRAG       GLIGSIVAMGEGVGPAIVGMIAHYIHWSYLLLI----PMITIITVPFLMKLLKKEVRIKGHFDIKGIILM
TCRB_BACSU      GLIGSLVAMGEGVGPAIGGMVAHYIHWSYLLLIPTA----TIITVPFLIKLLKKEERIR-----------
YFMO_BACSU      LYEAAGISVGPLAGGELGS-----ISWRAPFFGVSVLMFIALIAISFMLPKLPKPKRVGVFDAMKALKYK
MDTD_PECCP      TFVTLPGQIGPLMGPALGGFLVEYASWHWIFLINLPVGIIGALATWFLMPN-------------------
PCAK_ACIAD      TCMFCGYNLGMAIGGFISSWLIPAFGWHSLFLLGGWAPLILMLLVIFFLPEIVKGKNTKKVRQILSRIAP
YB30_YEAST      AYFMMGPNMGPIIAPIVAGLILMKGNWRWLF---GFTSIMTGIALILVTALLPETLRCIVG---------
TCR_STAHY       GLIGSIVAMGEGVGPAIGGMIAHYIHW-------------------------------------------
MDTD_YERPS      AFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPN-------------------
MDTD_YERPY      AFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPN-------------------
MDTD_YERPP      AFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPN-------------------
MDTD_YERPN      AFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPN-------------------
MDTD_YERPG      AFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPN-------------------
MDTD_YERPE      AFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPN-------------------
MDTD_YERPB      AFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPN-------------------
MDTD_YERPA      AFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPN-------------------
MDTD_YERP3      AFVTLPGQIGPLVGPALGGFLVEFASWHWIFLINLPVGVIGALATLLLMPN-------------------
MDTD_YERE8      AFVTLPGQIGPLVGPALGGFLVEYASWHWIFLINLPVGVVGALATLWLMPN-------------------
ARAE_ECOLI      SMYQLMVTLGIVLAFLSDTAFSYSGNWR------------------------------------------
ARAE_ECO57      SMYQLMVTLGIVLAFLSDTAFSYSGNWR------------------------------------------
MHPT_ECOLI      SLMYCGVPI-------------------------------------------------------------
XYLL1_ARATH     SLKEFSTVLGMVGGYGIGSWITVISGWRYMYATILPFPVIMGTGMCWL----------------------
YLD2_CAEEL      GVTYAGAQIGNVIVLPLSGFLGFDGGWPSIFYIIGVFGVLWTAVWWYVSSDKPATHEASMGKDIKILTSP
NANT_YERPY      GFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYI----GLLPIIFALWLRKNLPEAED-------------
YJA1_SCHPO      AVM----SLAPLLGPTIGPVVGFIAEYTTYKWIFWSTTIFSGFIFALSLPLLAEPKTL-LGEKARKLTQP
YYBF_BACSU      GLYISGNAIGAVFGRIVSGLLSEYLNWH---MAMGTIGVISLIASVIFFINLPTPRKLKLGKLIGHLRDR
YEBQ_ECOLI      GINSFIVAVSSAAGPTIAAAILSIASWKWLFLINVPLGIIALLAMRFLPPNASKPRFDLPSAVMNALTFG
YWOD_BACSU      AVLSIFASAMTALGPTAGGFLIVWGGWPAIFIV-----NLPFIILSFLLGLYMFPKDQKKGAGIKTIIRQ
MDTD_SERP5      TFVTLPGQIGPLMGPALGGFLVQYASWHWIFLINIPVGIAGAIATLLLMPN-------------------
BMR3_BACSU      GMFGAVFGLSSVLGPLLGAIITDSISWHWVFYINVPIGALS-----------------------------
EDL15_ARATH     AQLFAG------VGISVFYALGTIVAWR-NLAILGCIPSLMVLPLLFFIPESPR-WLAKVGREME-----
NANT_YERPS      GFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYI----GLLPIIFALWLRKNLPEAED-------------
NANT_YERPP      GFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYI----GLLPIIFALWLRKNLPEAED-------------
NANT_YERPG      GFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYI----GLLPIIFALWLRKNLPEAED-------------
NANT_YERPE      GFLISGFSIGAVLAAQAYSYVVLAFGWRMLFYI----GLLPIIFALWLRKNLPEAED-------------
NANT_YERPB      GFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYI----GLLPIIFALWLRKNLPEAED-------------
NANT_YERPA      GFLISGFSIGAVLAAQAYSYVVLAFGWRMLFYI----GLLPIIFALWLRKNLPEAED-------------
NANT_YERP3      GFLISGFSIGAVLAAQAYSYVVPAFGWRMLFYI----GLLPIIFALWLRKNLPEAED-------------
NANT_SALAR      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAEDWKEKHEGKA----
LMRB_LISMO      GMIGLVIMFAPAVGPTISGLILENLTWNWIFWI-----SLPFLIIALLF-------GMKFMQNVSVVTKP
XYLL3_ARATH     SLKELFIVLGILLGFSVGSFIDVVGGWR------------------------------------------
NANT_CITK8      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAEDWKEKHEGKA----
MFSD8_HUMAN     ----------------------------------------------------------------------
LMRB_LISIN      GMIGLVIMFAPAVGPTISGLILENLTWNWIFWI-----SLPFLIIALLF-------GMKFMQNVSVVTKP
SPIN_DROME      ALFYFAIPVGSGLGYIVGSKTAHLANWRWALRVTPILGIV-AVFLILLIKD-PVRGHSEGSHNLEATTYK
NANT_ESCF3      GFLISGFSVGAVVAAQVYSLVVPLWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
SPNS3_DANRE     SFFYIFIPVGSGLGYIIGATVAATGDWRWALRVSPAXXXXXXXXXVFLIPNPPRGASDNGGANMETTSYT
NANT_SALTY      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_SALTI      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_SALSV      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_SALPK      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_SALPC      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_SALPB      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_SALPA      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_SALNS      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_SALHS      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_SALG2      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_SALEP      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_SALDC      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_SALCH      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
MFSD8_MOUSE     ----------------------------------------------------------------------
EDL14_ARATH     SLMFVGVGLSAFYA------LGTAVAWR-SLAILGSIPSLVVLPLLFFIPESPR-WLAKVGRE-------
YMPB_CAEEL      AWITVVYNVAWSLGM-VWTLLVTLMDWRWRYFIVSLPGVY-GFALWYFLPESP-----------------
VBA5_YEAST      SILSCAFAVAAIVGPIIGGAFTTHVTWRWCFYINLPIGGLAII---------------------------
MDTM_ECO57      AIITSIVLIAPIIGPLSGAALMHFVHWKVLFAIIAVMGFISFVGLLLAMPE--TVKRGAVPFSAKSVLR-
YWTG_BACSU      ------LSSLNQLMITVGILLSYIVNY-------------------------------------------
NANT_SHIFL      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_SHIF8      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_SHIB3      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_ECOSM      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_ECOSE      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_ECOLI      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_ECOLC      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_ECOL5      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_ECOHS      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_ECODH      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_ECOBW      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_ECO8A      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_ECO7I      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_ECO5E      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_ECO57      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_ECO55      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_ECO45      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_ECO27      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT_ECO24      GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
NANT1_ECOL6     GFLISGFSVGAVVAAQVYSLVVPVWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
MDTD_ERWCT      TFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINLPVGIIGALATWFLMPN-------------------
YYAJ_BACSU      SFCLIGVPITNIVSIPLGSW-----GWRLVF-VWGAVGLI------------------------------
MDTD_SALPB      TFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPN-------------------
MDTD_SALHS      TFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPN-------------------
AZR1_YEAST      AVLSCSFAIASVVGPFLGGVFTSSVTWRWCFYVNLPIG--------------------------------
YIZG_SCHPO      AYLFASSALSGAFGVLHMDGVGGFAGWRWLFIIEGLIGFVCGVAVYFIIPN-------------------
GHT3_SCHPO      AQIFSTGAALVAACINMGTHLRKTASWRTSFGINMLWGILLMVGVLFL----------------------
MDTD_SALSV      TFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAIATFMLMPN-------------------
MDTD_KLEP3      TFVTXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIVGAIATLCLMPN-------------------
MDTD_ESCF3      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
MDTD_SHISS      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMPN-------------------
MDTD_SHIFL      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
MDTD_SHIBS      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMPN-------------------
MDTD_SHIB3      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMPN-------------------
MDTD_KLEP7      TFVTXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIVGAIATLCLMPN-------------------
MDTD_ECOUT      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
MDTD_ECOSM      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
MDTD_ECOSE      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
MDTD_ECOLI      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMPN-------------------
MDTD_ECOLC      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMPN-------------------
MDTD_ECOL5      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
MDTD_ECOK1      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
MDTD_ECOHS      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMPN-------------------
MDTD_ECODH      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMPN-------------------
MDTD_ECOBW      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLLLMPN-------------------
MDTD_ECO8A      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
MDTD_ECO7I      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
MDTD_ECO5E      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
MDTD_ECO57      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
MDTD_ECO55      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
MDTD_ECO45      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
MDTD_ECO27      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
MDTD_ECO24      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
TCR_STAES       GFIGSIVALGEGLGPSIGGIIAHYIHW--SYLLI--LPMITIVTIPFLIKVMVPGKSTK-----------
TCR_STAAU       GFIGSIVALGEGLGPSIGGIIAHYIHW--SYLLI--LPMITIVTIPFLIKVMVPGKSTK-----------
SPNS2_XENTR     SVFYFAIPLGSGLGYITGSSVKQVADWRWALRVSPVLGVITGTLLLIFVP--------------------
MDTD_SALTY      TFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPN-------------------
MDTD_SALTI      TFVAXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPN-------------------
MDTD_SALPK      TFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPN-------------------
MDTD_SALPA      TFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPN-------------------
MDTD_SALNS      TFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPN-------------------
MDTD_SALEP      TFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPN-------------------
MDTD_SALA4      TFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPN-------------------
MDTD_ENT38      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINLPVGIVGAIATLWLMPN-------------------
MDTD_ECO81      TFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
GHT7_SCHPO      TFITLGIFIAACINMGTHKYSGTTAQWRISIGINLLWGIITLVGIIFL-PESPR-YLIAIGKDDEAL---
GHT4_SCHPO      SQLFQTCGTLIAACINMGTHLRKTASWRTSFGINILWGIFLMVGVLFL----------------------
MDTD_SHIF8      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
HGT1_KLULA      GLFQFSVTVGIMVLFYIGHFIDGAAAFRITWGLQMVPGLILMVGV-FFIPESP-----------------
CSBC_BACSU      --------------------LGTMNN----------LMIVTGILLAYIVNYLFTP---------------
QAY_NEUCR       GIYELGWQIGGLVGFWINYGVNTMAPTRSQWLIPFAVQLIPAGLLSFWIPESP-----------------
MDTM_ECOLI      AIITSIVLIAPIIGPLSGAALMHFMHWKVLFAIIAVMGFISFVGLLLAMPE--TVKRGAVPFSAKSVLR-
MDTD_SALDC      TFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIVGAMATFMLMPN-------------------
MDTD_ECOLU      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIIGAIATLMLMPN-------------------
MDTD_CITK8      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINIPVGIVGAIATLMLMPN-------------------
LMRB_BACSU      GTIGLVIMFAPAIGPTFSGLVLEHLNWHWIFWISLPFLVLALVGIAYM-------------QNVSETTKP
YJHB_ECOLI      AFLVSGFSVGNIIAAQIIPQFAEVYGWRNSFFI----GLLPVLLVLWIRKSAP-----------------
ORCT_DROME      --LFAGVAMQMFFSVGFMLTAGFIHDWRWLQIAITLPGLL------------------------------
MDTD_ENTS8      TFXXXXXXXXXXXXXXXXXXXXEYASWHWIFLINLPVGIAGAAATLWLMPN-------------------
MDTD_ECOL6      TFVTXXXXXXXXXXXXXXXXXVEYASWHWIFLINIPVGIIGAITTLMLMPN-------------------
YDER_BACSU      GNVMSGLLLGIMLSRPISSLVADIWGWNAIFALSAVVSVILAIVLSKVLPARKPTANTNLGSMWKLLTTP
OCTL_DROME      MMFFSGFMLTAVFAYFVHDW--------------------------------------------------
MDTL_SALAR      LSLLNGITCIVPVLAPVGHLIMLRFPWQSLFYTMSAMGIIVCLLSLFIL---------------------
YAN6_SCHPO      GCMGVTWGLASVMGPLIGGAISQKASWRWIFFI-------------------------------------
SV2C_MOUSE      FWMIGGIYASAMAWIPHYGWSFSMGSWR-VFVIVCALPCVSSVVALTFMPESP-----------------
SV2C_RAT        FWMIGGIYASAMAWIPHYGWSFSMGSWR-VFVIVCALPCVSSVVALTFMPESP-----------------
MDTL_SALHS      LSLLNGITIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILPARRAPRDLRSSPAAESLVNR
MDTL_SALEP      LSLLNGITIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILPVRLAPRDLRSSPAAESLINR
MDTL_SALDC      LSLLNGITIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILPVRLAPRDLRSSPAAESLINR
GHT1_SCHPO      VTVTAGIFIAACINMGTHKLYKT-AQWRVSIGINLLWGIITLVGVSFL---SESPRYVSIGKDDEAI---
ERDL7_ARATH     TLN----QILICTGVSVSFIIGTLVTWR----VLALIGIIPCAASLFFIPESP-----------------
STP5_ARATH      CFISMGVVAANLI---------------------------------------------------------
MDTL_SALPB      LSLLNGITIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILPARLAPRDLRSSPAAESLVNR
MDTL_SALNS      LSLLNGITIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILPARLAPRDLRSSPAAESLVNR
MDTL_SALA4      LSLLNGITIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILPARLAPRDLRSSPAAESLVNR
CITH_KLEPN      SWQSGSQQVAIMVAAAMGFALNAVLGWRIPFL----FGVLIVPFIFILRRKLEETQEFTARRHHLAMR--
BCRH_RICBR      SYVYASLS--------------------------------------------------------------
Y466_BUCAI      AAIGVSFAISFLIAVVSGPIIVHYFGFFSIFWISAFLSIVCMIIVCFFVPF--SKKNI------------
SV2C_HUMAN      FWMIGGIYASAMAWIPHYGWSFSMGSWR-VFVIVCALPCVSSVVALTFMPESP-----------------
S22A2_RAT       ----------RMVGI--------------CYQIAFTVGLLILAGVAYVIPN-------------------
PLT3_ARATH      SLPELCISLGILLGYVSNYCFGKLTGWRLMLGIAAFPSLILAFGI-------------------------
MDTL_SALTY      LSLLNGITIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILPVRLAPRDLRSSPAAESLINR
GTR1_LEIDO      VFLTGGQFVAAGFTAIMVVFTSKNIGWRVAIGIGALPAVVQAFCLLFFLPESP-----------------
GHT2_SCHPO      VFVTGGIFIAACINM--GTHLHKTAQWRVSIGINLLWGIITMIGILFL-PESPR-YLIQVGKDEEAV---
ERDL9_ARATH     TFTFSNQLLQN-CGVATAYYLGNFMSWR----IIALIGIL------------------------------
BMR2_BACSU      GYVSAAIS--------------------------------------------------------------
PLT6_ARATH      SLPHLCISIGILLGYIVNYFFSKLIGWRLMLGIAAVPSLVLAFGI-------------------------
MDTL_SALSV      LSLLNGITCIVPVLAPVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILPARLAPRDLRSSPAAESLVNR
MDTL_SALPK      LSLLNGITCIVPVLAPVGHLIMLRFPWQSLFYTMSTMGIIVGLLSLFILPARLAPRDLRSSPAAESLVNR
MDTL_SALPC      LSLLNGITIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILPVRLAPRDLRSSPAAESLINR
MDTL_SALPA      LSLLNGITCIVPVLAPVGHLIMLRFPWQSLFYTMSTMGIIVGLLSLFILPARLAPRDLRSSPAAESLVNR
MDTL_SALCH      LSLLNGITIVPVLAPVVGHLIMLRFPWQSLFYTMSAMGIIVGLLSLFILPVRLAPRDLRSSPAAESLINR
GTR6_HUMAN      ----------------------------------------------------------------------
ENB1_YEAST      NIF--------LIPVIINTWV-------------------------------------------------
YI32_SCHPO      GCMGVTWGVASVMGPLIGGAISQNTTWRWIFFI-------------------------------------
XYLT_LACBR      SMVMTGILLAYITNYSFSGFY-TGWRWMLGFAAIPAAGLILPESPRFLVKSMNKHDQVAVNKEINKMVRP
MDTH_PROMH      SLLLMQDSAGAVIGALIGSWL-LLYDFHLVCWVGAGIFVLAAIFNAWLLPAYRSTTRTPIKEGLKRVILD
MDTH_BLOFL      SILMLEDSICAIIGITLGSWLLQQYNFQLVCLTGAILFFIAGMFNAWRLPAYKSSSHLSLLDGIKQVLHN
GTR2_HUMAN      TFIVTGILISQIIGLEF--ILGNYDLWHILLGLSGVRAILQSL-LLFFCPESPRYLYIKLDEEVKA----
PHDK_NOCSK      SIAFAGVGVGSIIGAYLAAAVIPTLGWQ---VMVXXXXXXXXXXXXFFVALVPEPAIISVRRGI------
NANT_SALA4      GFLISGFXXXXXXXXXXXXXXXXXWGWRALFFI----GILPIIFALWLRKNIPEAED-------------
MFSD8_XENLA     ----------------------------------------------------------------------
GHT5_SCHPO      TTVTGGIFIAACINM--GTHLHKTAQWRVSMGINLLWGIITFIGISFL-PESPR-YLISVGRDEEAL---
ERDL6_ARATH     -----GLGSVNQLSVTIGIMLAYLLGLFVPWRILAVLGILPCTLLLFFIPESP-----------------
ERDL4_ARATH     --LGSVNQLSVTIGIMLAYLLGLFVPWR----ILAVLGVLPCTLLLFFIPESP-----------------
EDL11_ARATH     A----SNQLLQNSGVSLIYFFGTVINWRVMAVIGAIPCILQTIGIFFIPESPRWLAKIRLSKEVESSLH-
Y567_BUCAP      GLYISGNTIGGCSGRILSSILAEYFSWHIAFIVIGFFSLMSSCLFLYFLPSSKNPISIDFNKFLKHLKNP
S22A2_MOUSE     CYQIATVGLLILAGVAY-----ALPNWR------------------------------------------
PLT4_ARATH      SFPEIFINLGILLGY-VSNYAFSGLSVHISWRIMLAVGILPSVFIGFALCVIPSPR--------------
NANT_ENTS8      GFLIXXXXXXXXXXXXXYSLVVPVWGWRALFFI----GILPIVFALWLRKNIPEAHDWEARRSEK-----
MDTL_SALTI      LSLLNGITCIVPVLAPVGHLIMLRFPWQSLFYTMSTMGIMVGLLSLFIL---------------------
NANT2_ECOL6     XXXXXXXXXXXXXXXQVYSIVVPLWGWRSLFFV----GMLPILFAFYLRKNLP-----------------
GHT8_SCHPO      TAVTGGIFIAACIN--MGTHLHKTAQWRVSMGINLLWGIIMFIGISFL-PESPR-YLIAIGKDEEAL---
SPNS1_XENLA     SFFY----FATPVGCGLGYIVGS-----------------------------------------------
PMRA_STRR6      GTLSTGVVAGTLTGPFIGGFIAELFGIRTVFLLVGSFLFLAAILTICFIKEVAKEKAIPTKELFTSVKYP
PMRA_STRPN      GTLSTGVVAGTLTGPFIGGFIAELFGIRTVFLLVGSFLFLAAILTICFIKEVAKEKAIPTKELFTSVKYP
EDL10_ARATH     AFSASTLLLQN-SGISLIYFFGTVINWR-VLAVIGALPCFIPVIGIYFIPESP-----------------
BAIG_EUBSP      GLYMLISSGAVVVGPTCGGLIMNAAGWRVMMWVCVALCVVVFLICTFSIKKTAFEKKSMAGFDKPGAALV
YUSP_BACSU      GVFGAIYGLASVIGPQIGGWIVDSLNWKWVFYINLPVGIIAVIFIA------------------------
YN43_SCHPO      C-IFACITFAGLIGPIAGGFLASYLGWRWTEYITSFMGFFSTLCLLFM----------------------
SPNS1_XENTR     SFFYFATPVGCGLGYIAGSKVSTAGDWHWALRVTPGLGLVAVLLLIFVAKEPP-----------------
QAY_NEUTR       GIYELGWQIGGLVGFWINYGVNTMAPTRSQWLIPFAVQLIPAGLLSFWIPESP-----------------
MOT2_RAT        GFAMAGSPVFLSTLAPFNQFLFNSYGWKGSFLILGAIFLHSCVAGCLMRPVGPSPRAAKSKSKVGSFTHR
EDL17_ARATH     TFTFSNQLLQN-AGLAMIYFCGNFITWRTLAL-LGALPCFIQVIGLFFVPESP-----------------
YQO5_SCHPO      ALVFDGPLVSPIIG---GFLTKSYLGWRWTEYITSFMGFF-ALVIVYL----------------------
YBIH_SCHPO      GILATAWGAALVAGPIIGGAICQRTTWRWIFFILPSGGIATALIVVFL----------------------
STP4_ARATH      --FNNGFQVAIIFGIVVATIINYFTGWRIS-LGLACVPAVMIMIGALILPDTPN----------------
OXLT_OXAFO      GFFWAAKATASIFGGGLGAAIATNFGWNTAFLITAITSFIAFALATFVIPRMPVKKMVKLSPEEKAV---
NORA_STAAW      GYMSAIINSGFILGPGIGGFMAEVSH-RMPFYFAGALGILAFIMSIVLIHD--PKKSTTSGFQLTKINWK
NORA_STAAU      GYMSAIINSGFILGPGIGGFMAEVSH-RMPFYFAGALGILAFIMSIVLIHD--PKKSTTSGFQLTKINWK
NORA_STAAN      GYMSAIINSGFILGPGIGGFMAEVSH-RMPFYFAGALGILAFIMSIVLIHD--PKKSTTSGFQLTKINWK
NORA_STAAM      GYMSAIINSGFILGPGIGGFMAEVSH-RMPFYFAGALGILAFIMSIVLIHD--PKKSTTSGFQLTKINWK
NORA_STAAC      GYMSAIINSGFILGPGIGGFMAEVSH-RMPFYFAGALGILAFIMSIVLIHD--PKKSTTSGFQLTKINWK
ITR2_SCHPO      IIYVVFITGGQLIAYSLAAFEHVHQGWRIMF------GIGAAPALGQLISLFWTPESPR-----------
GTR12_XENLA     SMIVAGILLAYICNY---LFASVNNGWKYMFGLITPLAALQAVAMFFL----------------------
CITA_SALTY      ----------------------------------------------------------------------
CITA_SALTI      ----------------------------------------------------------------------
YUBD_BACSU      LVLIGGFYGSVIIGTILGTIATSCGHWRWLFFIFGTLSLI-GVAVSY-----------------------
YHA8_SCHPO      AFFAAGPYAGPTLGPLVGGWIG------------------------------------------------
NORA_STAAS      GYMSAIINSGFILGPGIGGFMAEVSH-RMPFYFAGALGILAFIMSIVLIHD--PKKSTTSGFQLTKINWK
YWOG_BACSU      GYFAMSMNLAMAIGPFLGLNLMRVVSF-PVFFTAFALFMVAGLLVSFLI-KVPQSKD-------------
VBA2_YEAST      AFQNLLLGFGAICGASFGGTIASSIGWRWCFLIQVPISVISSILMNYYVPN-------------------
TSGA_YERE8      LFTDSFFSMAGMI-FPVAAAI-LLARHIEWYWVYACIGLL------------------------------
MDTL_ECOLU      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWTMATMGIAVLMLSLFILKETAAPTNSDKPRESESLLNR
MDTL_ECOL5      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWTMATMGIAVLMLSLFILPAAPAASD-KPRENSESLLNR
MDTL_ECO27      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWTMATMGIAVLMLSLFILPAAPTTSD-KPRENSESLLNR
IOLT_BACSU      TMIVSGQLLAFVFNAILGTTMGDNSHVWRFMLVIASLPAL------------------------------
AQR1_YEAST      GATSGFVLLGQCFGSLIGAVLTARWDWRAIFWFL-TIGCGSCFLIAFLI--LPETKRTIAG---------
YRT3_CAEEL      TTAFTGSSVGVMTGLPASAYLVSHFSWSTPFYVFGVVGIIWSLIWMYVSSHSPETHGYISDDEKKQVT--
PLST1_ARATH     TLCQIGTCLGIIFSLLLGIPAEDDPHWWRTMLYVASMGFLLALGMQFAV---------------------
NORA_STAAR      GYMSAIINSGFILGPGIGGFMAEVSH-RMPFYFAGALGILAFIMSVVLI---------------------
MSSP1_ARATH     QFLGSGGMFLSYCMV-FTMSLSDSPSWR------AMLGVLSIPSLLYL----------------------
MDTL_ECOUT      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWTMATMGIALLMLSLFILPAAPTTSD-KPRENSESLLNR
MDTL_ECOK1      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWTMATMGIALLMLSLFILPAAPTTSD-KPRENSESLLNR
MDTL_ECO45      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWTMATMGIALLMLSLFILPAAPTTSD-KPRENSESLLNR
MDTH_ENT38      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAALFILCAAFNAWLLPTVKAPVREGLGR----VMAD
GTR3_CHICK      TLNQLGIVVGILVAQIFGLIMGTEALWPLLLGFTIVPAVLQCVALLF-CPESPRFLLINKMEEEKAQT--
CITA_ECOLX      ----------------------------------------------------------------------
YDHC_ECOLI      AAIMPLVGLSPALAPLLGSWLLVHFSWQAIFATLFAITVVLILPIFWLKPTTKARNNSQDGLTFTDLLRS
S22AD_HUMAN     VLAQCNFSLGQMVGLAYG-----FRNWRLLQITGTAPGLL------------------------------
S17A5_HUMAN     SISYAGAQLGTVISLPLSGIICYYMNWTYVFYFFGTIGIFWFLLWIWLVSDTP-----------------
MSSP2_ARATH     ----------------------------------------------------------------------
MDTH_ERWCT      SLLMMQDSAGAVIGALLGSWL-LQYDFEVVCWVGAVIFVLVAGLNAWLLPAYRSTVRTPIKEGLMRVIRD
YCAD_SALAR      SHNRGRLLAAYMMVYYVGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFT-RIVNQQTEARYSTSI
TCR2_ECOLX      ----------------------------------------------------------------------
QAY_NEUAF       GIYELGWQIGGLVGFWINYGVNTMAPTRSQWLIPFAVQLIPAGLLSFWIPESP-----------------
MDTL_ECOL6      LSLLNGITCIIPVLAPVGHLIMLNFPWQSLFWTMAIMGVAVLMLSLFILPAAPAASD-KPRENSESLLNR
MDTL_ECO81      LSLLNGITCIIPVLAPVGHLIMLNFPWQSLFWTMAIMGVAVLMLSLFILPAAPAASD-KPRENSESLLNR
GTR9_HUMAN      IFICIGVFTGQLLGLP--ELLGKESTWPYLFGVIVVPAVVQLLSLPFL-PDSPRYLLLEKHNEARAVKAF
GTR10_XENLA     SLYETGITVGILISYAMNYFLSAVNDWKYMF----GLAIIPAAFQFIVILFLPS----------------
ERDL3_ARATH     AFVFAN-QLMQSCGLSLFYVIGNFVHWRNLAL-IGLIPCALQVVTLFFIPESP-----------------
Y1104_HAEIN     SYVALGWQXXXXXXXXXXXXXXXHIGWRGMFLV----GIFPAFVAWFLRSHLHEPRSFQLLIKDKATSKI
SPNS3_HUMAN     AVFYIFIPVGSGLGYVLGSAVTMLGNWRWALRVMPCL---------------------------------
MDTL_KLEP7      LSLLNGITCIIPVLAPVGHLIMLKYPWQSLFYTMTGMGVMVAVLSVFIL---------------------
MDTL_KLEP3      LSLLNGITCIIPVLAPVGHLIMLKYPWQSLFYTMTGMGVMVGLLSVFIL------------RETRPTAHP
MDTL_ESCF3      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWAMATMGIAVLMLSLFILPAAPAASDPRENRE--SLLNR
MDTL_ECOSM      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWTMATMGIAVLMLSLFILPAAPAASD-KPRENSESLLNR
ERDL2_ARATH     GFSYSN-QLLQCLGISLMFFTGNFFHWRTLAL-LSAIPSAFQVICLFFIPESP-----------------
TSGA_YERPY      LFTDSFFSMAGMI-FPIAAAM-LLARHIEWYWVYACIGLL------------------------------
TSGA_YERPS      LFTDSFFSMAGMI-FPIAAAM-LLARHIEWYWVYACIGLL------------------------------
TSGA_YERPP      LFTDSFFSMAGMI-FPIAAAM-LLARHIEWYWVYACIGLL------------------------------
TSGA_YERPN      LFTDSFFSMAGMI-FPIAAAM-LLARHIEWYWVYACIGLL------------------------------
TSGA_YERPE      LFTDSFFSMAGMI-FPIAAAM-LLARHIEWYWVYACIGLL------------------------------
TSGA_YERPB      LFTDSFFSMAGMI-FPIAAAM-LLARHIEWYWVYACIGLL------------------------------
TSGA_YERPA      LFTDSFFSMAGMI-FPIAAAM-LLARHIEWYWVYACIGLL------------------------------
TSGA_YERP3      LFTDSFFSMAGMI-FPIAAAM-LLARHIEWYWVYACIGLL------------------------------
SETB_SALTY      AVMFSSISLAWVIGPPLAYALAMGFSFTVMYLSAAVAFIVCGVMVWFFLPSM------------------
S17A5_SHEEP     SISYAGAQLGTVVSLPLSGVICYYMNWTYVFYFFGIVGIIWFILWICLVSDTP-----------------
MOT10_MOUSE     GFLLGFMSIPMTVGPPIAGLLHDKLGTYDVAFYLAGIPPFVGGVVLCLIPWIHSKKQRKISKNAGGEKME
MFSD8_DANRE     ----------------------------------------------------------------------
MDTL_ECOSE      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILPAAPAASD-KPRENSESLLNR
MDTL_ECOLI      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILPAAPAASD-KPRENSESLLNR
MDTL_ECODH      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILPAAPAASD-KPRENSESLLNR
MDTL_ECOBW      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILPAAPAASD-KPRENSESLLNR
MDTL_ECO7I      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWTMATMGIAILMLSLFILPAAPAASD-KPRENSESLLNR
MDTL_ECO55      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILPAAPAASD-KPRENSESLLNR
MDTH_SHIFL      SLLMMQDSASAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
GTR1_PIG        TLHQLGIVVGILIAQVFGSIMGNEELWPLLLSVIFIPALLQCV----LLPFCPSPRFLLINR--------
YYBO_BACSU      SLFDSAAKFSNVIGAPLVAFLVTTFDWRVAFLTIGCINVLFTIFFWQYYEQPERHKRIKTGPLLKKLFTN
TSGA_EDWI9      LFTDSFFSMAGMVFPIIAATL--LAQHVAWYWVYACIGVLLAIFILTLCSDFPQLGKQAVG---------
TSGA_BUCAT      LLTDSFFSMSGMI-FPIVTLLEKKIIWYWSYICIGAIYLL------------------------------
TSGA_BUCAI      LLTDSFFSMSGMI-FPIVTLLEKKIIWYWSYICIGAIYLL------------------------------
TSGA_BUCA5      LLTDSFFSMSGMI-FPIVTLLEKKIIWYWSYICIGAIYLL------------------------------
MDTL_SHISS      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILPASPAASD-KPRENSESLLNR
MDTL_SHIFL      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILPASPAASD-KPRENSESLLNR
MDTL_SHIDS      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWTMAIMGIAVLMLSLFILPAAPAASD-KSRENSESLLNR
MDTL_SHIBS      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILPASPAASD-KPRENSESLLNR
MDTL_SHIB3      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILPASPAASD-KPRENSESLLNR
MDTL_ECOLC      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILPASPAASD-KPRENSESLLNR
MDTL_ECOHS      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILPASPAASD-KPRENSESLLNR
MDTL_ECO8A      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWTMAMMGIAVLMLSLFILPASPAASD-KPRENSESLLNR
MDTL_ECO5E      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWTMAIMGIAVLMLSLFILPAAPAASD-KSRENSESLLNR
MDTL_ECO57      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWTMAIMGIAVLMLSLFILPAAPAASD-KSRENSESLLNR
MDTL_ECO24      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWTMAMMGIAVLMLSLFILPASPAASD-KPRENSESLLNR
MDTH_SHIB3      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECOUT      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECOSM      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECOSE      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECOLU      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECOLI      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECOLC      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECOL6      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECOL5      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECOK1      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECOHS      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECODH      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECOBW      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECO8A      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECO81      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECO7I      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECO5E      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECO57      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECO55      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECO45      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECO27      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_ECO24      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
GTR4_HUMAN      TLIVIGILIAQVLGL-------------------------------------------------------
GTR4_BOVIN      TLIVTGILIAQVLG--LESMLGTATLW-------------------------------------------
ERDL1_ARATH     GFSFSN-QLLQSFGISLMFFTGNFFHWRTLAL-LSAIPCGIQMICLFFIPESP-----------------
YCEI_BACSU      VLLESFWAVGWLAAALISYFVIPSFGWQ------------------------------------------
MOT13_MOUSE     GLVQMIESIGGLLGAPLSGYLRDVTGNYTASFVVAGAFLLAGSGVLLTLPHFFSCISVSTSR--------
GTR9_PONAB      IFICIGVFTGQLLGLP--ELLGKESTWPYLFGVIVVPAVVQLLSLPFL-PDSPRYLLLEKRNEARAVKAF
GTR8_HUMAN      -LLGSCVQLMVVVGILLAYLAGWVLEWRW----LAVLGCVPPSLMLLLMCFMP-----------------
GTR3_RAT        TLNQLGIVVGILVAQVFGLILGSEELWPG----LLGLTIIPAILQSAALPFCPSPRFLLINRK-------
GTR1_CHICK      TFHQLGIVLGILIAQVFG----------------------------------------------------
YDJK_ECOLI      SSRVSFIGLCSLIAMGLTPLISAEWNWRVQLLIPAILSLITALAWRY-----------------------
Y1322_DEIRA     T-LYSNTSVVGLSGIVAGAW-AQVFGYRPVFLLCAALSL-------------------------------
SPNS1_DANRE     SIFYFAIPVGSGMGYIVGSKVDTVA---------------------------------------------
S22FL_XENLA     SYWALTGSLTNLIGIAFYALLGYIRNWRTLAFVANSPGIF-FLLLSFVLPESP-----------------
S22A5_HUMAN     RIIFSGVCIFYAFGLPLFAYF--IRDWRMLLVALTMPGVL-CVALWWFIPESP-----------------
QACA_STAAU      AVWSIASSIGAVFGPIIGGALLEQFSWHSAFLINVPFAIIAVVAGLFLLPE---------SKLSKEKSHS
QACA_STAAM      AVWSIASSIGAVFGPIIGGALLEQFSWHSAFLINVPFAIIAVVAGLFLLPE---------SKLSKEKSHS
PLT5_ARATH      VFINAGIMLGYVSNLAFSN-LPLKVGWRLMLGIGAVPSVILAIGV-------------------------
PLT1_ARATH      SFPEIFINIGILLGYVSNYFFSKLLGWRFMLGVGAVPSVFLAIGV-------------------------
MOT8_RAT        GYLLGMMALPMIAGPPIGLLRNCFGNYHVAFYFAGVPPIIGAV-ILFFVPLMHQKKEQRESSKDKMLSH-
BENK_ACIAD      TLMFSGYAIGGMTAAFLGSILVPLYGWKIMFMIAGIXXXXXXXSIDYLVRKVPSPDHVMIFQEQRAFSTM
YN2F_SCHPO      AVYSAIIFNGPLMSPIVGGFIGSYLGWRWTSYITAIMG--------------------------------
YCT4_SCHPO      LVFCAAAFVGPLVGPVMGGYIESKLGWRWDFWINMIWAGLTWVIVCFTMPETHS----------------
YCAD_SALEP      SHNRGRLLAAYMMAYYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFT----RIVNQQTQARHS
YBJJ_ECOLI      LPMMHGFSLGTLAGAGVGMALTAFGVPATVHILLAALVGXXXXXXXXXXXXDGTGKNAADGRDIQLLLIG
SPNS3_MOUSE     AVFYIFIPVGSGLGYVLGSTVAELGNWRWALRLMPCXXXXXXXXXXXXVPDVP-----------------
MDTL_SHIF8      LSLLNGITCIIPVLAPVGHLIMLKFPWQSLFWAMAMMGIAVLMLSLFILPASPAASD-KPRENSESLLNR
MDTH_SHIBS      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
GTR3_CANFA      TLNQLGIVIGILVAQIFGLKVGTEELWP----LLLGFTIIPAVLQSAALPFCPSPRFLLINRK-------
BCR_HAEIN       STITLVFMLAPLVAPIIGGYIVKFFHWHAIFYVISLVGXXXXXXVFFIIPETHKKEN-------------
BCRH_RICTY      SYVYAILSPWLLFIPSLGSYIGEYSSWHYVFVFFSLIGTILLALYYKILPEIDFSQSSKYFEVFNIIIKD
YFIG_BACSU      TMIVIGQLLAYTFNAIIGSTMGESANVWRYMLVIATLPAVVLWFGMLIVPESP-----------------
YD199_YEAST     --LISIQCVSSVIAYSFGIWINCAFRWRYPLSTHVALGIILNLMSFYLILESPS----------------
YCAD_ESCF3      A--------AYMMIYYVGTFLGQLLVSKVSTELMNVLPWVTALILAGILPLLFT-RILSQQTESRKTTSI
Y1421_ENT38     ----------------VGTVLGQLMISKLPTDLMSVLPWVTGMVLAAILPLLFT-RIVNQGSEHHEATQV
TSGA_SERP5      LFTDSFFSMAGMIFPIVAAML--LARQIGWYWVYACIGLL------------------------------
TSGA_SALTI      LFTDSFFSMAGMIFPMVAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_SALSV      LFTDSFFSMAGMIFPMVAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_SALNS      LFTDSFFSMAGMIFPMVAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_SALAR      LFTDSFFSMAGMVFPMVAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_SALA4      LFTDSFFSMAGMIFPMVAAFL--LARSIEWYWVYACIGLV------------------------------
S22A7_HUMAN     TFWTGGVMLLALVGYLIRDW--------------------------------------------------
S22A1_RABIT     LYQVASVGLVALSGVAY-----AIPNWRWLQLTV-SLPTFLCLFYYWCVPESP-----------------
MDTH_SHIF8      SLLMMQDSASAVIGALLGSWL-LQYDFRLVCATGPVLFVLCAAFNAWLLPAWKSTVRTPVREGMTRVMRD
MDTH_SALTI      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAILFILCALFNAWLLPAWKSTARTPVREGMRRVMSN
MDTH_SALSV      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAILFILCALFNAWLLPAWKSTVRTPVREGMRRVMSD
MDTH_SALPK      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAILFILCALFNAWLLPAWKSTVRTPVREGMRRVMSD
MDTH_SALPC      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAILFILCALFNAWLLPAWKSTVRTPVREGMRRVMSD
MDTH_SALPB      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAILFILCALFNAWLLPAWKSTVRTPVREGMRRVMSD
MDTH_SALPA      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAILFILCALFNAWLLPAWKSTVRTPVREGMRRVMSD
MDTH_SALNS      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAILFILCALFNAWLLPAWKSTVRTPVREGMRRVMSD
MDTH_SALHS      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAILFILCALFNAWLLPAWKSTVRTPVREGMRRVMSD
MDTH_SALG2      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAILFILCALFNAWLLPAWKSTVRTPVREGMRRVMSD
MDTH_SALEP      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAILFILCALFNAWLLPAWKSTVRTPVREGMRRVMSD
MDTH_SALDC      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAILFILCALFNAWLLPAWKSTVRTPVREGMRRVMSD
MDTH_SALCH      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAILFILCALFNAWLLPAWKSTVRTPVREGMRRVMSD
MDTH_SALA4      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCATGAILFILCALFNAWLLPAWKSTVRTPVREGMRRVMSD
GTR8_RAT        -LLGSCVQLMVVTGILLAYVAGWVLEWRW----LAVLGCVPPTLMLLLMCYMP-----------------
GTR8_MOUSE      -LLGSCVQLMVVTGILLAYVAGWVLEWRW----LAVLGCVPPTLMLLLMCYMP-----------------
GTR3_SHEEP      TLNQLGIVIGILVAQIFGVILGTEDLWP----LLLGFTILPAIIQCAALPFCPSPRFLLINRK-------
GTR1_BOVIN      TLHQLGIVVGILIAQVFGSIMGNQELWPLLLSVIFIPALLQCI----LLPFCPSPRFLLINR--------
EDL16_ARATH     TLN----QLMIVIGSSVSFLIGSLISWKTLALTGLAPCIVLLFGLCF-IPESP-----------------
BCRH_RICPR      SYVYAILSFIPALGSYIGGYIIEYLSWHYVFIFFSLAGTILLALYYQILP--------------------
BCRH_RICFE      SYVYASLS--------------------------------------------------------------
YDFJ_ECOLI      SFVAMGTNCGTLSATAIWAFMFFILSWRIPFL--------------------------------------
TSGA_SALPK      LFTDSFFSMAGMIFPMVAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_SALPB      LFTDSFFSMAGMIFPMVAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_SALPA      LFTDSFFSMAGMIFPMVAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_SALHS      LFTDSFFSMAGMIFPMVAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_SALG2      LFTDSFFSMAGMIFPMVAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_SALEP      LFTDSFFSMAGMIFPMVAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_SALDC      LFTDSFFSMAGMIFPMVAAFL--LARSIEWYWVYACIGLV------------------------------
SETB_ECOLI      SFLRAQVSLAWVIGPPLAYALAMGFSFTVMYLSAAVAFIVCGVMVWLFLPSM------------------
S22A6_RABIT     NCM-----TLNVEWMPIHTYVGTLAGY------VYSTGQFLLAGVAYAVPH-------------------
S17A5_MOUSE     TISYAGAQLGTVISLPLSGIICYYMNWTYVFYLFGIVGIVWFILWMWIVSDTP-----------------
MOT2_MOUSE      A--GSPVFLSTL--APFNQYLFNNYGWKGSFLILGGIFLHSCVAGCLMRPVGPSP---------------
MOT10_RAT       GFLLGFMSIPMTVGPPVAGLLHDKLGSYDLAFYLAGIPPFIGGAVLCLIPWIHSKKQREISK--------
MDTH_YERE8      SLLMMQDSAGAVIGALIGSWLFHFVCWTGAVIFILAAGWNVWLLPAYRISTVRAPMKMRVLRDRRFVTY-
MDTH_SALAR      SLLMMQDSAGAVIGALLGSWL-LQYDFRLVCAMGAILFIVCAIFNAWLLPAWKSTVRTPVREGMRRVISD
GTR8_BOVIN      -LLGSCVQLMVVTGILLAYLAGWVLEWR------------------------------------------
GTR3_HUMAN      TLNQLGIVVGILVAQIFGLILGSEELWP----LLLGFTILPAILQSAALPFCPSPRFLLINRK-------
GTR1_RABIT      TLHQLGIVVGILIAQVFGSIMGNEDLWPLLLSVIFVPALLQCIVLP-LCPESP-----------------
GTR10_HUMAN     SLYEAGITVGILLSYALNALAGTPWGWRHMFGWATAPAVLQSLSLLFL----------------------
ERD6_ARATH      SFVFANQLMQN-CGISLFFIIGNFIPWR-LLTVVGLVPCVFHVFCLFFIPESP-----------------
EMRY_ECOLI      ALWSMTVIIAPICGPILGGYICDNFSWGWIFLINVPMGII------------------------------
YCAD_SALTY      SHNRGRLLAAYMMVYYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFT----RIVNQQTQARHS
YCAD_SALTI      SHNRGRLLAAYMMVYYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFT----RIVNQQTQARHS
YCAD_SALSV      SHNRGRLLAAYMMVYYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFT----RIVNQQTQARHS
YCAD_SALPK      SHNRGRLLAAYMMVYYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFT----RIVNQQTQTRHS
YCAD_SALPC      SHNRGRLLAAYMMVYYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFT----RIVNQQTQTRHS
YCAD_SALPA      SHNRGRLLAAYMMVYYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFT----RIVNQQTQTRHS
YCAD_SALNS      SHNRGRLLAAYMMVYYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFT----RIVNQQTQARHS
YCAD_SALHS      SHNRGRLLAAYMMVYYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFT----RIVNQQTQTRHS
YCAD_SALCH      SHNRGRLLAAYMMVYYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFT----RIVNQQTQTRHS
YCAD_SALA4      SHNRGRLLAAYMMVYYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFT----RIVNQQTQTRHS
TCR1_ECOLX      ----------------------------------------------------------------------
S22A7_PONAB     TFWTGGMMLLALVGYLIRDW--------------------------------------------------
S22A6_RAT       ASIAINCMTLNVEWMPIHTYVGTLIGY------VYSLGQFLLAGIAYAVPH-------------------
S22A6_MOUSE     ASIAINCMTLNMEWMPIHTYVGTLIGY------VYSLGQFLLAGIAYAVPH-------------------
MDTH_ENTS8      SLLMMQDSAGAVTGALIGSWL-LQYDFRLVCGVGALLFVLCAGFNAWLLPDVRTPLREGMGRVLR----D
GUDP_BACSU      AFFNSAQYFAIVIFSPLMGWLTHSFGWHSVFVVMGIAGILLAV---------------------------
GTR3_BOVIN      TLNQLGIVIGILVAQIFGVILGTEDLWP----LLLGFTILPAIIQCAALPFCPSPRFLLINRK-------
GTR14_HUMAN     TLNQLGIVIGILVAQIFGLILGSEELWP----VLLGFTILPAILQSAALPCCPSPRFLLINRK-------
GTR10_XENTR     SLYETGITVGILISYAMNYFLGVNESWKYMFGLAIVPAAFQFISILFL-PSKPHKLN-------------
ERDL8_ARATH     NQLFIVIGLASMF------LIGAVVNWRT----LALTGVAPCVVLTWFIPESP-----------------
ERDL5_ARATH     TVH----QLLICLGVSVTYLLGSFIGWR----ILALIGMIPCVVQLFVIPESP-----------------
YQEH_SCHPO      -YMFIFMCSVASVGSPMGTGV-------------------------------------------------
YCAD_SALPB      SHNRGRLLAAYMMVYYMGTFLGQLLVSKVSGELLHVLPWVTGMILAGILPLLFT----RIVNQQTQARHS
YAJR_ECOLI      AFIGVSFGITFAIAMVLGPIITHKLGLHALFWMIAILATTGIALTIWVVPN-------------------
TSGA_SHIB3      LFTDSFFSMAGMIFPMIAAFL--LAHSIEWYWVYACIGLV------------------------------
TSGA_ECOUT      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECOSM      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECOSE      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECOLI      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECOL6      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECOL5      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECOK1      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECODH      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECOBW      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECO8A      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECO81      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECO5E      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECO57      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECO55      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECO45      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECO27      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECO24      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
STP8_ARATH      -----GLNIVFQLMVTIGILIANIVNYFTS----------------------------------------
SETA_ECOLI      SVMRAQLSLAWVIGPPLAFMLALNYGFTVMFSIAAGIFTLSLVLIAFMLPSV------------------
MUCK_ACIAD      GTLQAGWTVGYIVATLLAGWLIPDHGWRVLFYV-AIIPVLMAVLMHFFVP--------------------
MOT13_RAT       GLVQMIESVGGLLGAPLSGYLRDVTGNYTASFVVAGAFLLAGSGVLITLPH-------------------
MDTH_YERPY      SLLMMQDSAGAVIGALIGSWLFHFVCWTGAAIFVLAAGWNAWLLPAYRISTVRAPMKMRVLRDRRFVTY-
MDTH_YERPS      SLLMMQDSAGAVIGALIGSWLFHFVCWTGAAIFVLAAGWNAWLLPAYRISTVRAPMKMRVLRDRRFVTY-
MDTH_YERPP      SLLMMQDSAGAVIGALIGSWLFHFVCWTGAAIFVLAAGWNAWLLPAYRISTVRAPMKMRVLRDRRFVTY-
MDTH_YERPN      SLLMMQDSAGAVIGALIGSWLFHFVCWTGAAIFVLAAGWNAWLLPAYRISTVRAPMKMRVLRDRRFVTY-
MDTH_YERPG      SLLMMQDSAGAVIGALIGSWLFHFVCWTGAAIFVLAAGWNAWLLPAYRISTVRAPMKMRVLRDRRFVTY-
MDTH_YERPE      SLLMMQDSAGAVIGALIGSWLFHFVCWTGAAIFVLAAGWNAWLLPAYRISTVRAPMKMRVLRDRRFVTY-
MDTH_YERPB      SLLMMQDSAGAVIGALIGSWLFHFVCWTGAAIFVLAAGWNAWLLPAYRISTVRAPMKMRVLRDRRFVTY-
MDTH_YERPA      SLLMMQDSAGAVIGALIGSWLFHFVCWTGAAIFVLAAGWNAWLLPAYRISTVRAPMKMRVLRDRRFVTY-
MDTH_YERP3      SLLMMQDSAGAVIGALIGSWLFHFVCWTGAAIFVLAAGWNAWLLPAYRISTVRAPMKMRVLRDRRFVTY-
MDTH_SODGM      SLLMMQDSACSVIGALLGSWL-LRYDFKLVCLAGAVLFVFAAIFNAWLLPGYRSTVRAPMLEGMRRVLRD
GTR2_MOUSE      TLLVTGILISQIAG--LSFILGNQDHWH-ILLGLSAVPAXXXXXXXXFCPESPRYLYIKLEEEVRA----
EXUT_ECOLI      GYFNVGSSIGAMIAPPLVVWAIVMHSWQMAFIISGALSFIWAMA--------------------------
EXUT_ECO57      GYFNVGSSIGAMIAPPLVVWAIVMHSWQMAFIISGALSFIWAMA--------------------------
EDL18_ARATH     TFTFTNQLLQN-SGLAMVYFSGNFLNWRILAL-LGALPCFIQVIGLFFVPESP-----------------
Y2171_CITK8     A--------AYMMVYYVGTFLGQLLVSKVPTELMSVLPWVTGMILAGILPLLFT-RILNQQSEEHDTTPI
TSGA_SHISS      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_SHIFL      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_SHIF8      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_SHIDS      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_SHIBS      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ERWT9      LFTDSFFSMAGTLFPIIAAAI--LARSLPWYWVYACIGVI------------------------------
TSGA_ECOLU      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECOLC      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECOHS      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TSGA_ECO7I      LFTDSFFSMAGMIFPMIAAFL--LARSIEWYWVYACIGLV------------------------------
TCR8_PASMU      ----------------------------------------------------------------------
STP7_ARATH      THLRGGLNMMFQLATTIGIFTANMVNWRLS-LGLAAFPALLMTLGGYFLPETPN----------------
MSSP3_ARATH     TFQFCGSGGMFLYCLVFGMSLQESPSWRLMLGVLSIPSIAYFVLAAFFLPESP-----------------
MOT8_MOUSE      GYLLGMMALPMIAGPPIGLLRNCFGDYHVAFYFAGVPPIIGAV-ILFFVPLMHQKKEQRDSSKDKMLSH-
MOT8_HUMAN      GYLLGMMALPMIAGPPIGLLRNCFGDYHVAFYFAGVPPIIGAV-ILFFVP--------------------
MDTH_BLOPB      SVLMLEDSMCAIIGIVLGTWL-LQYNFKLVCFTGAILFFIAGVFNAWRLPAYKSSSHASLLEGIKKVLNN
HXT10_YEAST     SFYQLMITLGIFLGYCTNYGTKKYSNWRVPLGLCFAWAIFMVIGMV-MVPESP-----------------
GTR2_BOVIN      ALIVTGILISQIVGLDF--ILGNHELWH-ILLGLSAVPAILQCLLLFFCPESPRYLYIKLDEEAKA----
GTR1_RAT        TLHQLGIVVGILIAQVFGSIMGNADLWPLLLSVIFIPALLQCI----LLPFCPSPRFLLINR--------
GTR1_MOUSE      TLHQLGIVVGILIAQVFGSIMGNADLWPLLLSVIFIPALLQCI----LLPFCPSPRFLLINR--------


                         .         .         .         +         .         .         .:280
query           QVILALLMTLFGFGGVFAALTYLTPIMTDIAGYAESSMSWILIIVGVGMFTGNWTGGKLADRSLIPSVXX
YDHP_ECOLI      QVLSALLTTVLGAGAMFTLYTYISPVLQSITHATPVFVTAMLVLIGVGFSIGNYLGGKLADRSVNGTLKG
YDHP_ECO57      QVLSALLTTVLGAGAMFTLYTYISPVLQSITHATPVFVTAMLVLIGVGFSIGNYLGGKLADRSVNGTLKG
YFHI_BACSU      QVLFSFAITILGYSGVFIAYTFIEPILRHSAGFSTVGITGALFAYGLGGVAGNFFAGKVPLPLLTRTMIG
YTBD_BACSU      RLLLLFVITALGYGGTFVVFTYLSPLLQEVTGFKAGTVAVXXXXXXXXXXXXXXXXXKLSNRNPIAALFY
ARAJ_ECOLI      APWLIFAATMFGNAGVFAWFSYVKPYMMFISGFSETAMTFIXXXXXXXXXXXXXXXXRISGRLRIAAVTD
SOTB_CITK8      ALMSIYXXXXXXXXAHYTAYSYIEPFVQTVAGLSANFATVXXXXXXXXXXXXSVVFGKLGNQYASPLISX
PBUE_BACAM      KIASAHLVTLFTLAGHYTLYAYFAPFLETTLHLSSVWVSVCYFLFGLSAVCGGPFGGWLYDR--------
SOTB_ERWCH      ALVGIYLLTVVVVTAHFTAYSYIEPFIQTVAGLPENFTTLILLLFGCAGIAGSMLYSRYSDRFPIGFXXX
PBUE_BACSU      KIASSHLVTMFTLAGHYTLYAYFAPFLEETLHLSSFWVSICYFLFGISAVCGGPFGGALSDRGSFKSILL
SOTB_HAEIN      XXXXXYVTTAIVISAHFTAYTYIEPFMIDVGHLDPNFATAVLLVFGFSGIAASLLFNRLY-RFAPTKFIV
SOTB_HAEIG      XXXXXYVTTAIVISAHFTAYTYIEPFMIDVGHLDPNFATAVLLVFGFSGIAASLLFNRLY-RFAPTKFIV
SOTB_HAEI8      XXXXXYVTTAIVISAHFTAYTYIEPFMIDVGHLDPNFATAVLLVFGFSGIAASLLFNRLY-RFAPTKFIV
YBCL_BACSU      KVAMGLSITFFWLGGYSVAYTYLSPYLLNISGINGKLLSGVLLIFGIASLVGSKFGGYSTDKWGVPFTLV
SOTB_ECOLU      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_PSEA7      ALVCLYILTVVVISAQFTAYSYIEPFARQVA---------------------------------------
SOTB_HELPG      LLMGIYLLVIMVISGHFTTYSYIEPFIIQISQFSPDITTLMLFVFGLAGVAGSFLFGRLYAKNSRKFIAF
SOTB_SALNS      ALIXXXXXXXXXXXXXXXXXXXIEPFVQNVAGLSANFATVXXXXXXXXXXXXSLVFGKLGNRHXXXXXXX
SOTB_SHIFL      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_SALSV      ALMXXXXXXXXXXXXXXXXXXXIEPFVQNVAGLSANFATVXXXXXXXXXXXXSLVFGKLGNRHXXXXXXX
SOTB_SHIF8      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
NEPI_SHISS      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFSVDGLTLVLLSFGIASFIGTSLSSFILKRSVKLALAG
SOTB_SALTI      ALMXXXXXXXXXXXXXXXXXXXIEPFVQNVAGLSANFATVXXXXXXXXXXXXSLVFGKLGNRHXXXXXXX
SOTB_SALPB      ALMXXXXXXXXXXXXXXXXXXXIEPFVQNVAGLSANFATVXXXXXXXXXXXXSLVFGKLGNRHXXXXXXX
SOTB_SALHS      ALMXXXXXXXXXXXXXXXXXXXIEPFVQNVAGLSANFATVXXXXXXXXXXXXSLVFGKLGNRHXXXXXXX
SOTB_SALG2      ALMXXXXXXXXXXXXXXXXXXXIEPFVQNVAGLSANFATVXXXXXXXXXXXXSLVFGKLGNRHXXXXXXX
SOTB_SALEP      ALMXXXXXXXXXXXXXXXXXXXIEPFVQNVAGLSANFATVXXXXXXXXXXXXSLVFGKLGNRHXXXXXXX
SOTB_SALDC      ALMXXXXXXXXXXXXXXXXXXXIEPFVQNVAGLSANFATVXXXXXXXXXXXXSLVFGKLGNRHXXXXXXX
SOTB_SALA4      ALMXXXXXXXXXXXXXXXXXXXIEPFVQNVAGLSANFATVXXXXXXXXXXXXSLVFGKLGNRHXXXXXXX
SOTB_SALPC      ALMXXXXXXXXXXXXXXXXXXXIEPFVQNVAGLSANFATVXXXXXXXXXXXXSLVFGKLGNRHXXXXXXX
SOTB_SALCH      ALMXXXXXXXXXXXXXXXXXXXIEPFVQNVAGLSANFATVXXXXXXXXXXXXSLVFGKLGNRHXXXXXXX
SOTB_ECO5E      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
NEPI_ECOL5      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFGVDGLTLVLLSFGIASFVGTSLSSFILKRSV------
SOTB_SALAR      ALMSLYLLTAVVVTAHYTAYSYIEPFVQNVAG--------------------------------------
NEPI_ECOL6      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFGVDGLTLVLLSFGIASFVGTSLSSFILKRSV------
SOTB_SALTY      ALMXXXXXXXXXXXXXXXXXXXIEPFVQNVAGLSANFATVXXXXXXXXXXXXSLVFGKLGNRXXXXXXXX
SOTB_SALPK      ALMXXXXXXXXXXXXXXXXXXXIEPFVQNVAGLSANFATVXXXXXXXXXXXXXXVFGKLGNRHXXXXXXX
SOTB_SALPA      ALMXXXXXXXXXXXXXXXXXXXIEPFVQNVAGLSANFATVXXXXXXXXXXXXXXVFGKLGNRHXXXXXXX
SOTB_ECOL5      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
NEPI_ECOUT      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFGVDGLTLVLLSFGIASFVGTSLSSFILKRSV------
NEPI_ECOK1      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFGVDGLTLVLLSFGIASFVGTSLSSFILKRSV------
NEPI_ECO27      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFGVDGLTLVLLSFGIASFVGTSLSSFILKRSV------
SOTB_ECOUT      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_ECOL6      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_ECOK1      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_ECO81      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_ECO45      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_ECO27      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_SHISS      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_SHIBS      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_SHIB3      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_ESCF3      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGLSANFATVXXXXXXXXXXXXSVIFGKLGNNSVLVSVXX
SOTB_ECOSM      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASTLVST
SOTB_ECOSE      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_ECOLI      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_ECOLC      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_ECOHS      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_ECODH      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_ECOBW      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_ECO8A      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_ECO7I      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_ECO55      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_ECO24      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
SOTB_ECO57      ALMSIYXXXXXXXXAHYTAYSYIEPFVQNIAGFSANFATXXXXXXXXXXXXXSVIFGKLGNQYASALVST
NEPI_SHIDS      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFGVDGLTLVLLSFGIASFIGTSLSSFILKRSV------
NEPI_ECO57      GVMAGMIAIFMSFAGQFAFFTYIRPVYMTLAGFGVDGLTLVLLSFGIASFVGTSLSSFILKRSV------
NEPI_SHIFL      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFGVDGLTLVLLSFGIASFIGTSLSSFILKRSV------
NEPI_SHIF8      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFGVDGLTLVLLSFGIASFIGTSLSSFILKRSV------
NEPI_ECOLI      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFGVDGLTLVLLSFGIASFIGTSLSSFILKRSV------
NEPI_ECOBW      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFGVDGLTLVLLSFGIASFIGTSLSSFILKRSV------
SOTB_HELAH      LLVGIYLLVILAISGHFTTYSYIEPFIIQISQFSPEVATLMLFVFGLAGVMGSFLFGRFYEKNPKKFIAC
SOTB_ERWT9      ALVALYLLIAITVTAHYTAYSYIEPFIQSVXXXXXXXXXXXXXIVGSVLF--SIYGNKFPATFLLAAI--
NEPI_SHIBS      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFGVDGLTLVLLSFGIASFIGTSLSSFILKRSV------
SOTB_KLEP7      AXXXXXXXXXXXXXAHYTAYSYIEPFVQTVAGLSGNFATVXXXXXXXXXXXXXXXXXKLGNQHXXXXXXX
SOTB_HELPH      LLMGIYLLVIMVISGHFTTYSYIEPFIIQISQFSPDITTLMLFVFGLAGVAGSFLFSRLYAKNSRKFIAF
SOTB_ENT38      ALMSIYXXXXXXXXAHYTAYSYIEPFVQVVAGFSANFATVXXXXXXXXXXXXSVLFGKLGNKSLLVSIGX
SOTB_HELP2      LLVGIYLLVIMVISGHFTTYSYIEPFIIQISQFSPDITTLMLFVFGLAGVAGSFLFGRLYAKNSRKFIAF
SOTB_HELPY      LLMGIYLLVIMVISGHFTTYSYIEPFIIQISQFSPDITTLMLFVFGLAGVVGSFLFGRLYAKNSRKFIAF
SOTB_HELPJ      LLVGIYLLVIMVISGHFTTYSYIEPFIIQISQFSPDITTLMLFVFGLAGVVGSFLFGRLYAKNSRKFIAF
SOTB_PSE14      RLMAIYLLTAIVVTAHFTAYSYIEPFTQTVSRLSGEMTTILLLVFGGAGIMGSIIFSLFSDR--------
SOTB_KLEP3      AXXXXXXXXXXXXXAHYTAYSYIEPFVQTVAGLSGNFATVXXXXXXXXXXXXXXXXXKLGNQHXXXXXXX
SOTB_PSEAE      ALVCLYVLTVVVISAQFTAYSYIEPFAKQVA---------------------------------------
SOTB_PSEAB      ALVCLYVLTVVVISAQFTAYSYIEPFAKQVA---------------------------------------
SOTB_PSEA8      ALVCLYVLTVVVISAQFTAYSYIEPFAKQVA---------------------------------------
SOTB_PASMU      PLLLGLALTMIIISAHFTAYSYIEPFMLNISTMSHSMATFVLFVFGLSGITASLLFNRYYNAGPIRFILF
CMLR_STRLI      RXXXXXXXXXXXXXXTFASFTFLAPVVTDTAGLGDLWISVALVLFGAGSFAGVTVAGRLSDRRXXXXXXX
SOTB_PSEU2      RLMAIYLLTAIVVTAHFTAYSYIEP-FTQTVSLLSGEMTTILLLV-------------------------
SOTB_PSESM      RLMAIYLLTAIVVTAHFTAYSYIEPFTQTVSRLSGEMTTILLLVFGGAGIMGSIVFSLFSDR--------
SOTB_PSEE4      AXXXXXXXXXXXXXAQFTAYSYIEPFALHVA---------------------------------------
YWFA_BACSU      RVPVYITITFCNMIGFYGMYSFLGTYLQDVFTGGNTAAGLFIMIYGIG-FSMSVITGKIADR--------
NEPI_SALPK      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFDVDGLTLVLLSFGIASFVGTSFSSYVLKRSV------
NEPI_SALPA      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFDVDGLTLVLLSFGIASFVGTSFSSYVLKRSV------
NEPI_SALG2      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFDVDGLTLVLLSFGIASFVGTSFSSYVLKRSVXXXXXX
NEPI_SALEP      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFDVDGLTLVLLSFGIASFVGTSFSSYVLKRSVXXXXXX
NEPI_SALTY      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFDVDGLTLVLLSFGIASFVGTSFSSYVLKRSV------
NEPI_SALTI      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFDVDGLTLVLLSFGIASFVGTSFSSYVLKRSV------
NEPI_SALPC      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFDVDGLTLVLLSFGIASFVGTSFSSYVLKRSV------
NEPI_SALPB      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFDVDGLTLVLLSFGIASFVGTSFSSYVLKRSV------
NEPI_SALCH      GVMAGMIAIFMSFAGQFAFFTYIRPVYMNLAGFDVDGLTLVLLSFGIASFVGTSFSSYVLKRSV------
OPDE_PSEAE      GVMLGMLASSLFFMGQFSLFTYVRPFLETVTGVHGAHVSLVLLVIGAAGFIG------------------
SOTB_PSEPK      AXXXXXXXXXXXXXAQFTAYSYIEPFALHVA---------------------------------------
SOTB_PSEPG      AXXXXXXXXXXXXXAQFTAYSYIEPFALHVA---------------------------------------
SOTB_PSEPW      AXXXXXXXXXXXXXAQFTAYSYIEPFALQVA---------------------------------------
SOTB_MANSM      MLITLYIFTILVISAHFTAYSYIEPFMIQIGRVSANKATAVLLIFGV-----------------------
SOTB_ERWCT      ----------------------------------------------------------------------
YCEJ_BACSU      SVIL-LAYFLFQTGN-FASFSFLGTWLSADYHLTVSQIGAAMLVLGLGNMLGSLIGSRVSEKLGMFKTLI
GALP_ECOLI      ----------------------------------------------------------------------
GALP_ECOL6      ----------------------------------------------------------------------
YCNB_BACSU      ----------------------------------------------------------------------
YFIU_BACSU      ----------------------------------------------------------------------
YHCA_BACSU      ----------------------------------------------------------------------
EXUT_BACSU      GEKIPLLFTAFAFFALFFFLTWFPSYLVDERGLSVESMSVITVIPWILGFIGLAAGGFVSD---------
TCR_STRPN       SVGIVFFM--------------------------------------------------------------
TCR_BACSU       SVGIVFFM--------------------------------------------------------------
TCR_BACST       SVGIVFFM--------------------------------------------------------------
TCR_BACCE       SVGIVFFM--------------------------------------------------------------
EMRB_HAEIN      ----------------------------------------------------------------------
YGAY_ECOLI      ----------------------------------------------------------------------
YGAY_ECO57      ----------------------------------------------------------------------
ARAE_KLEOX      ----------------------------------------------------------------------
SGE1_YEAST      D--YGELLKASFWKNTFEVLVF----KLDMVGIILSSAGFTLLMLGLS-FGGNWNSG-------------
TCR_STRAG       SVGIVFFM--------------------------------------------------------------
TCRB_BACSU      ----------------------------------------------------------------------
YFMO_BACSU      GLLMAVSAFLYNFG--FFILLAYSPFVLDLHGLGYVFFGWGLLLAITSVFTAPLVHKALGTRSL---VVL
MDTD_PECCP      ----------------------------------------------------------------------
PCAK_ACIAD      QKV-------------------------------------------------------------------
YB30_YEAST      ----------------------------------------------------------------------
TCR_STAHY       ----------------------------------------------------------------------
MDTD_YERPS      ----------------------------------------------------------------------
MDTD_YERPY      ----------------------------------------------------------------------
MDTD_YERPP      ----------------------------------------------------------------------
MDTD_YERPN      ----------------------------------------------------------------------
MDTD_YERPG      ----------------------------------------------------------------------
MDTD_YERPE      ----------------------------------------------------------------------
MDTD_YERPB      ----------------------------------------------------------------------
MDTD_YERPA      ----------------------------------------------------------------------
MDTD_YERP3      ----------------------------------------------------------------------
MDTD_YERE8      ----------------------------------------------------------------------
ARAE_ECOLI      ----------------------------------------------------------------------
ARAE_ECO57      ----------------------------------------------------------------------
MHPT_ECOLI      ----------------------------------------------------------------------
XYLL1_ARATH     ----------------------------------------------------------------------
YLD2_CAEEL      AVWACWAGHFAGDWGAYTMLVSLPSFLKDVLGLNLSSLGAVASIPYIAYFLAINAGGVLAD---------
NANT_YERPY      ----------------------------------------------------------------------
YJA1_SCHPO      IVILCSTYMAIQYGILYLVLTTYPTLWTEEYHERPSIAGLNYIASGIGLIFGSQASGIFIDKT-------
YYBF_BACSU      KXXXXXXXXXXXXXXNVALFNYIVYVLLGPPSLNKAFSSWIFIVMIVGIFSSSFI-GRMVDRYGYPKILV
YEBQ_ECOLI      LLITAL----------------------------------------------------------------
YWOD_BACSU      LDILGIVL--------------------------------------------------------------
MDTD_SERP5      ----------------------------------------------------------------------
BMR3_BACSU      ----------------------------------------------------------------------
EDL15_ARATH     --VEAVLLSLRG----------------------------------------------------------
NANT_YERPS      ----------------------------------------------------------------------
NANT_YERPP      ----------------------------------------------------------------------
NANT_YERPG      ----------------------------------------------------------------------
NANT_YERPE      ----------------------------------------------------------------------
NANT_YERPB      ----------------------------------------------------------------------
NANT_YERPA      ----------------------------------------------------------------------
NANT_YERP3      ----------------------------------------------------------------------
NANT_SALAR      ----------------------------------------------------------------------
LMRB_LISMO      KIILSIILSTLGFGGVVFAFS-----SAGESGWGSATVLVSIIVGGIALGLFVW----------------
XYLL3_ARATH     ----------------------------------------------------------------------
NANT_CITK8      ----------------------------------------------------------------------
MFSD8_HUMAN     ----------------------------------------------------------------------
LMRB_LISIN      KIILSIILSTLGFGGVVFAFS-------------------------------------------------
SPIN_DROME      QDIKALV---------------------------------------------------------------
NANT_ESCF3      ----------------------------------------------------------------------
SPNS3_DANRE     EDIKYLL---------------------------------------------------------------
NANT_SALTY      ----------------------------------------------------------------------
NANT_SALTI      ----------------------------------------------------------------------
NANT_SALSV      ----------------------------------------------------------------------
NANT_SALPK      ----------------------------------------------------------------------
NANT_SALPC      ----------------------------------------------------------------------
NANT_SALPB      ----------------------------------------------------------------------
NANT_SALPA      ----------------------------------------------------------------------
NANT_SALNS      ----------------------------------------------------------------------
NANT_SALHS      ----------------------------------------------------------------------
NANT_SALG2      ----------------------------------------------------------------------
NANT_SALEP      ----------------------------------------------------------------------
NANT_SALDC      ----------------------------------------------------------------------
NANT_SALCH      ----------------------------------------------------------------------
MFSD8_MOUSE     ----------------------------------------------------------------------
EDL14_ARATH     ----------------------------------------------------------------------
YMPB_CAEEL      ----------------------------------------------------------------------
VBA5_YEAST      ----------------------------------------------------------------------
MDTM_ECO57      DFRNVFCNRLFLFGAATISLSYIPVILIDAGGLTTSQFAWTQVPVFGAVIVAN-----------------
YWTG_BACSU      ----------------------------------------------------------------------
NANT_SHIFL      ----------------------------------------------------------------------
NANT_SHIF8      ----------------------------------------------------------------------
NANT_SHIB3      ----------------------------------------------------------------------
NANT_ECOSM      ----------------------------------------------------------------------
NANT_ECOSE      ----------------------------------------------------------------------
NANT_ECOLI      ----------------------------------------------------------------------
NANT_ECOLC      ----------------------------------------------------------------------
NANT_ECOL5      ----------------------------------------------------------------------
NANT_ECOHS      ----------------------------------------------------------------------
NANT_ECODH      ----------------------------------------------------------------------
NANT_ECOBW      ----------------------------------------------------------------------
NANT_ECO8A      ----------------------------------------------------------------------
NANT_ECO7I      ----------------------------------------------------------------------
NANT_ECO5E      ----------------------------------------------------------------------
NANT_ECO57      ----------------------------------------------------------------------
NANT_ECO55      ----------------------------------------------------------------------
NANT_ECO45      ----------------------------------------------------------------------
NANT_ECO27      ----------------------------------------------------------------------
NANT_ECO24      ----------------------------------------------------------------------
NANT1_ECOL6     ----------------------------------------------------------------------
MDTD_ERWCT      ----------------------------------------------------------------------
YYAJ_BACSU      ----------------------------------------------------------------------
MDTD_SALPB      ----------------------------------------------------------------------
MDTD_SALHS      ----------------------------------------------------------------------
AZR1_YEAST      ----------------------------------------------------------------------
YIZG_SCHPO      ----------------------------------------------------------------------
GHT3_SCHPO      ----------------------------------------------------------------------
MDTD_SALSV      ----------------------------------------------------------------------
MDTD_KLEP3      ----------------------------------------------------------------------
MDTD_ESCF3      ----------------------------------------------------------------------
MDTD_SHISS      ----------------------------------------------------------------------
MDTD_SHIFL      ----------------------------------------------------------------------
MDTD_SHIBS      ----------------------------------------------------------------------
MDTD_SHIB3      ----------------------------------------------------------------------
MDTD_KLEP7      ----------------------------------------------------------------------
MDTD_ECOUT      ----------------------------------------------------------------------
MDTD_ECOSM      ----------------------------------------------------------------------
MDTD_ECOSE      ----------------------------------------------------------------------
MDTD_ECOLI      ----------------------------------------------------------------------
MDTD_ECOLC      ----------------------------------------------------------------------
MDTD_ECOL5      ----------------------------------------------------------------------
MDTD_ECOK1      ----------------------------------------------------------------------
MDTD_ECOHS      ----------------------------------------------------------------------
MDTD_ECODH      ----------------------------------------------------------------------
MDTD_ECOBW      ----------------------------------------------------------------------
MDTD_ECO8A      ----------------------------------------------------------------------
MDTD_ECO7I      ----------------------------------------------------------------------
MDTD_ECO5E      ----------------------------------------------------------------------
MDTD_ECO57      ----------------------------------------------------------------------
MDTD_ECO55      ----------------------------------------------------------------------
MDTD_ECO45      ----------------------------------------------------------------------
MDTD_ECO27      ----------------------------------------------------------------------
MDTD_ECO24      ----------------------------------------------------------------------
TCR_STAES       ----------------------------------------------------------------------
TCR_STAAU       ----------------------------------------------------------------------
SPNS2_XENTR     ----------------------------------------------------------------------
MDTD_SALTY      ----------------------------------------------------------------------
MDTD_SALTI      ----------------------------------------------------------------------
MDTD_SALPK      ----------------------------------------------------------------------
MDTD_SALPA      ----------------------------------------------------------------------
MDTD_SALNS      ----------------------------------------------------------------------
MDTD_SALEP      ----------------------------------------------------------------------
MDTD_SALA4      ----------------------------------------------------------------------
MDTD_ENT38      ----------------------------------------------------------------------
MDTD_ECO81      ----------------------------------------------------------------------
GHT7_SCHPO      ----------------------------------------------------------------------
GHT4_SCHPO      ----------------------------------------------------------------------
MDTD_SHIF8      ----------------------------------------------------------------------
HGT1_KLULA      ----------------------------------------------------------------------
CSBC_BACSU      ----------------------------------------------------------------------
QAY_NEUCR       ----------------------------------------------------------------------
MDTM_ECOLI      DFRNVFCNRLFLFGAATISLSYI-PMMSWVA---------------------------------------
MDTD_SALDC      ----------------------------------------------------------------------
MDTD_ECOLU      ----------------------------------------------------------------------
MDTD_CITK8      ----------------------------------------------------------------------
LMRB_BACSU      KIVLSIILSTIGFGGI------------------------------------------------------
YJHB_ECOLI      ----------------------------------------------------------------------
ORCT_DROME      ----------------------------------------------------------------------
MDTD_ENTS8      ----------------------------------------------------------------------
MDTD_ECOL6      ----------------------------------------------------------------------
YDER_BACSU      VLRRRAIYHAFVFGAFSLFWTTVPLLLSGPDFHFSQKAIALYALVGIAGAVTAPIGGRLADRGL------
OCTL_DROME      ----------------------------------------------------------------------
MDTL_SALAR      ----------------------------------------------------------------------
YAN6_SCHPO      ----------------------------------------------------------------------
SV2C_MOUSE      ----------------------------------------------------------------------
SV2C_RAT        ----------------------------------------------------------------------
MDTL_SALHS      FFVSRLAITTLSVSVILTFVNASPVLLMEVMGFSRGDYATMALTAGVSM---------------------
MDTL_SALEP      FFVSRLAITTLSVSVILTFVNASPVLLMEVMGFSRGDYATMALTAGVSM---------------------
MDTL_SALDC      FFVSRLAITTLSVSVILTFVNASPVLLMEVMGFSRGDYATMALTAGVSM---------------------
GHT1_SCHPO      ----------------------------------------------------------------------
ERDL7_ARATH     ----------------------------------------------------------------------
STP5_ARATH      ----------------------------------------------------------------------
MDTL_SALPB      FFVSRLAITTLSVSVILTFVNASPVLLMEVMGFSRGDYATMALTAGVSM---------------------
MDTL_SALNS      FFVSRLAITTLSVSVILTFVNASPVLLMEVMGFSRGDYATMALTAGVSM---------------------
MDTL_SALA4      FFVSRLAITTLSVSVILTFVNASPVLLMEVMGFSRGDYATMALTAGVSM---------------------
CITH_KLEPN      QVFATLLANXXXXXXXFYLITVYAPTFKKVLMLSASDSLLVTLLVAISNFFWLPVGGALSDR--------
BCRH_RICBR      ----------------------------------------------------------------------
Y466_BUCAI      ----------------------------------------------------------------------
SV2C_HUMAN      ----------------------------------------------------------------------
S22A2_RAT       ----------------------------------------------------------------------
PLT3_ARATH      ----------------------------------------------------------------------
MDTL_SALTY      FFVSRLAITTLSVSVILTFVNASPVLLMEVMGFSRGDYATMALTAGVSM---------------------
GTR1_LEIDO      ----------------------------------------------------------------------
GHT2_SCHPO      ----------------------------------------------------------------------
ERDL9_ARATH     ----------------------------------------------------------------------
BMR2_BACSU      ----------------------------------------------------------------------
PLT6_ARATH      ----------------------------------------------------------------------
MDTL_SALSV      FFVSRLAITTLSVSVILTFVNASPVLLMEVMGFSRGDYATMALTAGVSM---------------------
MDTL_SALPK      FFVSRLAITTLSVSVILTFVNASPVLLMEVMGFSRGDYATMALTAGVSM---------------------
MDTL_SALPC      FFVSRLAITTLSVSVILTFVNASPVLLMEVMGFSRGDYATMALTAGVSM---------------------
MDTL_SALPA      FFVSRLAITTLSVSVILTFVNASPVLLMEVMGFSRGDYATMALTAGVSM---------------------
MDTL_SALCH      FFVSRLAITTLSVSVILTFVNASPVLLMEVMGFSRGDYATMALTAGVSM---------------------
GTR6_HUMAN      ----------------------------------------------------------------------
ENB1_YEAST      ----------------------------------------------------------------------
YI32_SCHPO      ----------------------------------------------------------------------
XYLT_LACBR      SLIIGIGLAIFQVMGCNTVLYYAPTIFTDV-GFGVSAA--LLAHIGIGIF--------------------
MDTH_PROMH      KRFVQYVLTLTGYFVLSVQVMLMFPIVVNEIAGTPSAVKWMYAI--------------------------
MDTH_BLOFL      QKFIIYTLTLSGYYILSAQVMLMLPIMHEISGITEAILSLLLII--------------------------
GTR2_HUMAN      ----------------------------------------------------------------------
PHDK_NOCSK      ----------------------------------------------------------------------
NANT_SALA4      ----------------------------------------------------------------------
MFSD8_XENLA     ----------------------------------------------------------------------
GHT5_SCHPO      ----------------------------------------------------------------------
ERDL6_ARATH     ----------------------------------------------------------------------
ERDL4_ARATH     ----------------------------------------------------------------------
EDL11_ARATH     ----------------------------------------------------------------------
Y567_BUCAP      TLLILFAIGFMLMGSFITIFNYISRLMLSPFFLSSSNIGFLSIIYLTGVYSSPKAGILINQYNRSSXXXX
S22A2_MOUSE     ----------------------------------------------------------------------
PLT4_ARATH      ----------------------------------------------------------------------
NANT_ENTS8      ----------------------------------------------------------------------
MDTL_SALTI      ----------------------------------------------------------------------
NANT2_ECOL6     ----------------------------------------------------------------------
GHT8_SCHPO      ----------------------------------------------------------------------
SPNS1_XENLA     ----------------------------------------------------------------------
PMRA_STRR6      YLLLNLFLTSF-----------------------------------------------------------
PMRA_STRPN      YLLLNLFLTSF-----------------------------------------------------------
EDL10_ARATH     ----------------------------------------------------------------------
BAIG_EUBSP      VVFFSLFLCIPSFG--------------------------------------------------------
YUSP_BACSU      ----------------------------------------------------------------------
YN43_SCHPO      ----------------------------------------------------------------------
SPNS1_XENTR     ----------------------------------------------------------------------
QAY_NEUTR       ----------------------------------------------------------------------
MOT2_RAT        GFLIYLSGNVVLFLGMFAPIIFLAPYAKD-KGVDDYNSAFLLSVMAFTDMFARPSVGLIANTSLI-----
EDL17_ARATH     ----------------------------------------------------------------------
YQO5_SCHPO      ----------------------------------------------------------------------
YBIH_SCHPO      ----------------------------------------------------------------------
STP4_ARATH      ----------------------------------------------------------------------
OXLT_OXAFO      ----------------------------------------------------------------------
NORA_STAAW      VFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDIS--IAITGGGIF--------------------
NORA_STAAU      VFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDIS--IAITGGGIF--------------------
NORA_STAAN      VFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDIS--IAITGGGIF--------------------
NORA_STAAM      VFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDIS--IAITGGGIF--------------------
NORA_STAAC      VFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDIS--IAITGGGIF--------------------
ITR2_SCHPO      ----------------------------------------------------------------------
GTR12_XENLA     ----------------------------------------------------------------------
CITA_SALTY      ----------------------------------------------------------------------
CITA_SALTI      ----------------------------------------------------------------------
YUBD_BACSU      ----------------------------------------------------------------------
YHA8_SCHPO      ----------------------------------------------------------------------
NORA_STAAS      VFITPVILTLVLSLGLSAFETLYSLYTADKVNYSPKDIS--IAITGGGIF--------------------
YWOG_BACSU      ----------------------------------------------------------------------
VBA2_YEAST      ----------------------------------------------------------------------
TSGA_YERE8      ----------------------------------------------------------------------
MDTL_ECOLU      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_ECOL5      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_ECO27      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
IOLT_BACSU      ----------------------------------------------------------------------
AQR1_YEAST      ----------------------------------------------------------------------
YRT3_CAEEL      ----------------------------------------------------------------------
PLST1_ARATH     ----------------------------------------------------------------------
NORA_STAAR      ----------------------------------------------------------------------
MSSP1_ARATH     ----------------------------------------------------------------------
MDTL_ECOUT      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_ECOK1      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_ECO45      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTH_ENT38      KRFVTYVLTLTGYYMLAVQVMLMLPIMNDIAG-SPAAVKWMYAI--------------------------
GTR3_CHICK      ----------------------------------------------------------------------
CITA_ECOLX      ----------------------------------------------------------------------
YDHC_ECOLI      KTYRGNVLIYAACSASFFAWLTGSPFILSEMGYS------------------------------------
S22AD_HUMAN     ----------------------------------------------------------------------
S17A5_HUMAN     ----------------------------------------------------------------------
MSSP2_ARATH     ----------------------------------------------------------------------
MDTH_ERWCT      RRFLMYVLTLTGYYMLAVQVLLMLPIMVNEIAGTPSAVKWMYAIEAV-----------------------
YCAD_SALAR      SAMLKLRQARLGVNGVLGSLYGLMPLYLKHQGMANASIGWMAVLVSAGIL-GQWPVGRLADK--------
TCR2_ECOLX      ----------------------------------------------------------------------
QAY_NEUAF       ----------------------------------------------------------------------
MDTL_ECOL6      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_ECO81      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
GTR9_HUMAN      QTFL------------------------------------------------------------------
GTR10_XENLA     ----------------------------------------------------------------------
ERDL3_ARATH     ----------------------------------------------------------------------
Y1104_HAEIN     SLGIVVLTSVQNFG-YYGIMIWLPNFLSKQLGFSLTKSGLWTAVTVCGMMAGIWIFGQLADR--------
SPNS3_HUMAN     ----------------------------------------------------------------------
MDTL_KLEP7      ----------------------------------------------------------------------
MDTL_KLEP3      Q---------------------------------------------------------------------
MDTL_ESCF3      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_ECOSM      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
ERDL2_ARATH     ----------------------------------------------------------------------
TSGA_YERPY      ----------------------------------------------------------------------
TSGA_YERPS      ----------------------------------------------------------------------
TSGA_YERPP      ----------------------------------------------------------------------
TSGA_YERPN      ----------------------------------------------------------------------
TSGA_YERPE      ----------------------------------------------------------------------
TSGA_YERPB      ----------------------------------------------------------------------
TSGA_YERPA      ----------------------------------------------------------------------
TSGA_YERP3      ----------------------------------------------------------------------
SETB_SALTY      ----------------------------------------------------------------------
S17A5_SHEEP     ----------------------------------------------------------------------
MOT10_MOUSE     KMLENQSSLLSGSSGIF-----------------------------------------------------
MFSD8_DANRE     ----------------------------------------------------------------------
MDTL_ECOSE      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_ECOLI      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_ECODH      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_ECOBW      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_ECO7I      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIILTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_ECO55      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTH_SHIFL      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
GTR1_PIG        ----------------------------------------------------------------------
YYBO_BACSU      RKVWGLMIGFTGYGYTFNLLLTWLPTMDLMSSGLFTAVPWLISTIS-GIAVGGWLVDYFIKKG-YPNTKV
TSGA_EDWI9      ----------------------------------------------------------------------
TSGA_BUCAT      ----------------------------------------------------------------------
TSGA_BUCAI      ----------------------------------------------------------------------
TSGA_BUCA5      ----------------------------------------------------------------------
MDTL_SHISS      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_SHIFL      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_SHIDS      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_SHIBS      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_SHIB3      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_ECOLC      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_ECOHS      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_ECO8A      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_ECO5E      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_ECO57      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTL_ECO24      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTH_SHIB3      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECOUT      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECOSM      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECOSE      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECOLU      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECOLI      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECOLC      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECOL6      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECOL5      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECOK1      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECOHS      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECODH      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECOBW      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECO8A      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECO81      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECO7I      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECO5E      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECO57      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECO55      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECO45      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECO27      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_ECO24      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
GTR4_HUMAN      ----------------------------------------------------------------------
GTR4_BOVIN      ----------------------------------------------------------------------
ERDL1_ARATH     ----------------------------------------------------------------------
YCEI_BACSU      ----------------------------------------------------------------------
MOT13_MOUSE     ----------------------------------------------------------------------
GTR9_PONAB      QTFL------------------------------------------------------------------
GTR8_HUMAN      ----------------------------------------------------------------------
GTR3_RAT        ----------------------------------------------------------------------
GTR1_CHICK      ----------------------------------------------------------------------
YDJK_ECOLI      ----------------------------------------------------------------------
Y1322_DEIRA     ----------------------------------------------------------------------
SPNS1_DANRE     ----------------------------------------------------------------------
S22FL_XENLA     ----------------------------------------------------------------------
S22A5_HUMAN     ----------------------------------------------------------------------
QACA_STAAU      WDIPSTILSIAGIGLVWSIKEFSKEGLADI-------IPWVVIVLAITM---------------------
QACA_STAAM      WDIPSTILSIAGIGLVWSIKEFSKEGLADI-------IPWVVIVLAITM---------------------
PLT5_ARATH      ----------------------------------------------------------------------
PLT1_ARATH      ----------------------------------------------------------------------
MOT8_RAT        ----------------------------------------------------------------------
BENK_ACIAD      MFWCSIFMTLI---MVYALGNWLPKLMIE-AGYNLSKSLIFLFSLNVGGMIGSILGGYLADR--------
YN2F_SCHPO      ----------------------------------------------------------------------
YCT4_SCHPO      ----------------------------------------------------------------------
YCAD_SALEP      SSISAMLQARLGVNGVLGSLYGLMPLYLKHQGMANASIGWMAVLVSAGIL-GQWPMGRLADK--------
YBJJ_ECOLI      VVVLAMA---FAEG---SANDWLPLLMVDGHGFSPTSGSLIYAGFTLGMTVGRFTGGWFIDR--------
SPNS3_MOUSE     ----------------------------------------------------------------------
MDTL_SHIF8      FFLSRVVITTLSVSVILTFVNTSPVLLMEIMGFERGEYATIMLTAGVSMFSTPFALGIFKPRTLM--ITS
MDTH_SHIBS      KRFVTYVLTLAGY--YMLAVQVMLPIMVNDVAGAPSAVKWMYAI--------------------------
GTR3_CANFA      ----------------------------------------------------------------------
BCR_HAEIN       ----------------------------------------------------------------------
BCRH_RICTY      KILWLYAFIIGAFNGIYYGFFIEAPILIDKMKVLPSFYGKLAFLLSFSAIFGGFLGGYL-----------
YFIG_BACSU      ----------------------------------------------------------------------
YD199_YEAST     ----------------------------------------------------------------------
YCAD_ESCF3      TSMLKLRQARLGVNGVLGSLYGLMPLYLNHQGISNSNIGWMAVLVSAGI-VGQWPIGRLADK--------
Y1421_ENT38     WPMLRLRHARLGVNGVLGSLYGLMPLYLNHQGVSDSGIGWMAVMVSAGI-VGQWPIGKLADR--------
TSGA_SERP5      ----------------------------------------------------------------------
TSGA_SALTI      ----------------------------------------------------------------------
TSGA_SALSV      ----------------------------------------------------------------------
TSGA_SALNS      ----------------------------------------------------------------------
TSGA_SALAR      ----------------------------------------------------------------------
TSGA_SALA4      ----------------------------------------------------------------------
S22A7_HUMAN     ----------------------------------------------------------------------
S22A1_RABIT     ----------------------------------------------------------------------
MDTH_SHIF8      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAI--------------------------
MDTH_SALTI      KRFVTYVLTLAGYYMLAVQVMLMLPIMNDIAG-SPAAVKWMYAI--------------------------
MDTH_SALSV      KRFVTYVLTLAGYYMLAVQVMLMLPIMNDIAG-SPAAVKWMYAI--------------------------
MDTH_SALPK      KRFVTYVLTLAGYYMLAVQVMLMLPIMNDIAG-SPAAVKWMYAI--------------------------
MDTH_SALPC      KRFVTYVLTLAGYYMLAVQVMLMLPIMNDIAG-SPAAVKWMYAI--------------------------
MDTH_SALPB      KRFVTYVLTLAGYYMLAVQVMLMLPIMNDIAG-SPAAVKWMYAI--------------------------
MDTH_SALPA      KRFVTYVLTLAGYYMLAVQVMLMLPIMNDIAG-SPAAVKWMYAI--------------------------
MDTH_SALNS      KRFVTYVLTLAGYYMLAVQVMLMLPIMNDIAG-SPAAVKWMYAI--------------------------
MDTH_SALHS      KRFVTYVLTLAGYYMLAVQVMLMLPIMNDIAG-SPAAVKWMYAI--------------------------
MDTH_SALG2      KRFVTYVLTLAGYYMLAVQVMLMLPIMNDIAG-SPAAVKWMYAI--------------------------
MDTH_SALEP      KRFVTYVLTLAGYYMLAVQVMLMLPIMNDIAG-SPAAVKWMYAI--------------------------
MDTH_SALDC      KRFVTYVLTLAGYYMLAVQVMLMLPIMNDIAG-SPAAVKWMYAI--------------------------
MDTH_SALCH      KRFVTYVLTLAGYYMLAVQVMLMLPIMNDIAG-SPAAVKWMYAI--------------------------
MDTH_SALA4      KRFVTYVLTLAGYYMLAVQVMLMLPIMNDIAG-SPAAVKWMYAI--------------------------
GTR8_RAT        ----------------------------------------------------------------------
GTR8_MOUSE      ----------------------------------------------------------------------
GTR3_SHEEP      ----------------------------------------------------------------------
GTR1_BOVIN      ----------------------------------------------------------------------
EDL16_ARATH     ----------------------------------------------------------------------
BCRH_RICPR      ----------------------------------------------------------------------
BCRH_RICFE      ----------------------------------------------------------------------
YDFJ_ECOLI      ----------------------------------------------------------------------
TSGA_SALPK      ----------------------------------------------------------------------
TSGA_SALPB      ----------------------------------------------------------------------
TSGA_SALPA      ----------------------------------------------------------------------
TSGA_SALHS      ----------------------------------------------------------------------
TSGA_SALG2      ----------------------------------------------------------------------
TSGA_SALEP      ----------------------------------------------------------------------
TSGA_SALDC      ----------------------------------------------------------------------
SETB_ECOLI      ----------------------------------------------------------------------
S22A6_RABIT     ----------------------------------------------------------------------
S17A5_MOUSE     ----------------------------------------------------------------------
MOT2_MOUSE      ----------------------------------------------------------------------
MOT10_RAT       ----------------------------------------------------------------------
MDTH_YERE8      ------VLTLTGYYMLSVQVMLMLPIVVNEIAGSPAAVKWMYAI--------------------------
MDTH_SALAR      KRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGSPAAVKWMYAI--------------------------
GTR8_BOVIN      ----------------------------------------------------------------------
GTR3_HUMAN      ----------------------------------------------------------------------
GTR1_RABIT      ----------------------------------------------------------------------
GTR10_HUMAN     ----------------------------------------------------------------------
ERD6_ARATH      ----------------------------------------------------------------------
EMRY_ECOLI      ----------------------------------------------------------------------
YCAD_SALTY      SSISAMLQARLGVNGVLGSLYGLMPLYLKHQGMANASIGWMAVLVSAGIL-GQWPMGRLADK--------
YCAD_SALTI      SSISAMLQARLGVNGVLGSLYGLMPLYLKHQGMANASIGWMAVLVSAGIL-GQWPMGRLADK--------
YCAD_SALSV      SSISAMLQARLGVNGVLGSLYGLMPLYLKHQGMANASIGWMAVLVSAGIL-GQWPMGRLADK--------
YCAD_SALPK      SSISAMLQARLGVNGVLGSLYGLMPLYLKHQGMANASIGWMAVLVSAGIL-GQWPMGRLADK--------
YCAD_SALPC      SSISAMLQARLGVNGVLGSLYGLMPLYLKHQGMANASIGWMAVLVSAGIL-GQWPMGRLADK--------
YCAD_SALPA      SSISAMLQARLGVNGVLGSLYGLMPLYLKHQGMANASIGWMAVLVSAGIL-GQWPMGRLADK--------
YCAD_SALNS      SSISAMLQARLGVNGVLGSLYGLMPLYLKHQGMANASIGWMAVLVSAGIL-GQWPMGRLADK--------
YCAD_SALHS      SSISAMLQARLGVNGVLGSLYGLMPLYLKHQGMANASIGWMAVLVSAGIL-GQWPMGRLADK--------
YCAD_SALCH      SSISAMLQARLGVNGVLGSLYGLMPLYLKHQGMANASIGWMAVLVSAGIL-GQWPMGRLADK--------
YCAD_SALA4      SSISAMLQARLGVNGVLGSLYGLMPLYLKHQGMANASIGWMAVLVSAGIL-GQWPMGRLADK--------
TCR1_ECOLX      ----------------------------------------------------------------------
S22A7_PONAB     ----------------------------------------------------------------------
S22A6_RAT       ----------------------------------------------------------------------
S22A6_MOUSE     ----------------------------------------------------------------------
MDTH_ENTS8      RRFVTYVLTLTGYYMLAVQVMLMLPVMNDIAG-EPAAVKWMYAIEAV-----------------------
GUDP_BACSU      ----------------------------------------------------------------------
GTR3_BOVIN      ----------------------------------------------------------------------
GTR14_HUMAN     ----------------------------------------------------------------------
GTR10_XENTR     ----------------------------------------------------------------------
ERDL8_ARATH     ----------------------------------------------------------------------
ERDL5_ARATH     ----------------------------------------------------------------------
YQEH_SCHPO      ----------------------------------------------------------------------
YCAD_SALPB      SSISAMLQARLGVNGVLGSLYGLMPLYLKHQGMANASIGWMAVLVSAGIL-GQWPMGRLADK--------
YAJR_ECOLI      ----------------------------------------------------------------------
TSGA_SHIB3      ----------------------------------------------------------------------
TSGA_ECOUT      ----------------------------------------------------------------------
TSGA_ECOSM      ----------------------------------------------------------------------
TSGA_ECOSE      ----------------------------------------------------------------------
TSGA_ECOLI      ----------------------------------------------------------------------
TSGA_ECOL6      ----------------------------------------------------------------------
TSGA_ECOL5      ----------------------------------------------------------------------
TSGA_ECOK1      ----------------------------------------------------------------------
TSGA_ECODH      ----------------------------------------------------------------------
TSGA_ECOBW      ----------------------------------------------------------------------
TSGA_ECO8A      ----------------------------------------------------------------------
TSGA_ECO81      ----------------------------------------------------------------------
TSGA_ECO5E      ----------------------------------------------------------------------
TSGA_ECO57      ----------------------------------------------------------------------
TSGA_ECO55      ----------------------------------------------------------------------
TSGA_ECO45      ----------------------------------------------------------------------
TSGA_ECO27      ----------------------------------------------------------------------
TSGA_ECO24      ----------------------------------------------------------------------
STP8_ARATH      ----------------------------------------------------------------------
SETA_ECOLI      ----------------------------------------------------------------------
MUCK_ACIAD      ----------------------------------------------------------------------
MOT13_RAT       ----------------------------------------------------------------------
MDTH_YERPY      ------VLTLTGYYMLAVQVMLMLPIVVNELAGSPAAVKWMYAI--------------------------
MDTH_YERPS      ------VLTLTGYYMLAVQVMLMLPIVVNELAGSPAAVKWMYAI--------------------------
MDTH_YERPP      ------VLTLTGYYMLAVQVMLMLPIVVNELAGSPAAVKWMYAI--------------------------
MDTH_YERPN      ------VLTLTGYYMLAVQVMLMLPIVVNELAGSPAAVKWMYAI--------------------------
MDTH_YERPG      ------VLTLTGYYMLAVQVMLMLPIVVNELAGSPAAVKWMYAI--------------------------
MDTH_YERPE      ------VLTLTGYYMLAVQVMLMLPIVVNELAGSPAAVKWMYAI--------------------------
MDTH_YERPB      ------VLTLTGYYMLAVQVMLMLPIVVNELAGSPAAVKWMYAI--------------------------
MDTH_YERPA      ------VLTLTGYYMLAVQVMLMLPIVVNELAGSPAAVKWMYAI--------------------------
MDTH_YERP3      ------VLTLTGYYMLAVQVMLMLPIVVNELAGSPAAVKWMYAI--------------------------
MDTH_SODGM      QRFVTYVLTLTGYYMLSVQVMLMLPIRINEVAGQPAAVKWMYAI--------------------------
GTR2_MOUSE      ----------------------------------------------------------------------
EXUT_ECOLI      ----------------------------------------------------------------------
EXUT_ECO57      ----------------------------------------------------------------------
EDL18_ARATH     ----------------------------------------------------------------------
Y2171_CITK8     TSMLRLRQARLGVNGVLGSLYGLMPLYLNHQGISNASIGWMAVLVSAGIL-GQWPIGRLADK--------
TSGA_SHISS      ----------------------------------------------------------------------
TSGA_SHIFL      ----------------------------------------------------------------------
TSGA_SHIF8      ----------------------------------------------------------------------
TSGA_SHIDS      ----------------------------------------------------------------------
TSGA_SHIBS      ----------------------------------------------------------------------
TSGA_ERWT9      ----------------------------------------------------------------------
TSGA_ECOLU      ----------------------------------------------------------------------
TSGA_ECOLC      ----------------------------------------------------------------------
TSGA_ECOHS      ----------------------------------------------------------------------
TSGA_ECO7I      ----------------------------------------------------------------------
TCR8_PASMU      ----------------------------------------------------------------------
STP7_ARATH      ----------------------------------------------------------------------
MSSP3_ARATH     ----------------------------------------------------------------------
MOT8_MOUSE      ----------------------------------------------------------------------
MOT8_HUMAN      ----------------------------------------------------------------------
MDTH_BLOPB      QRFVIYVFTLTGYYILSAQVMLMLPIRIHEVSGQLSYIKWMYIIEAI-----------------------
HXT10_YEAST     ----------------------------------------------------------------------
GTR2_BOVIN      ----------------------------------------------------------------------
GTR1_RAT        ----------------------------------------------------------------------
GTR1_MOUSE      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXXXXXXXXXXXXXHSAILSLITIFFIGFFGMATVAPLQSVVLEYAKGAPTLASSINIGVFNLGNAVA
YDHP_ECOLI      FLLLLMVIMLAIPFLARNEFGAAISMVVWGAATFAVVPPLQMRVMRVASEAPGLSSSV------------
YDHP_ECO57      FLLLLMVIMLAIPFLARNKFGAAISMAVWGAATFAVVPPLQMRVMRVASEAPGLSSSV------------
YFHI_BACSU      VMIGLIGVLXXXXXXXXXXXXXXXXTFLFGACAF