[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF54084.1

[Show Plain Result]


## Summary of Sequence Search
    1::81
    4::78      2e-29  73%   85 aa  EX7S_CORDI RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    3::78      1e-28  76%   95 aa  EX7S_CORA7 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   11::78      5e-21  63%   82 aa  EX7S_MYCMM RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::74      1e-20  66%   78 aa  EX7S_NOCFA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   18::77      7e-19  65%   85 aa  EX7S_MYCTU RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   18::77      7e-19  65%   85 aa  EX7S_MYCTA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   18::77      7e-19  65%   85 aa  EX7S_MYCBT RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   18::77      7e-19  65%   85 aa  EX7S_MYCBP RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   18::77      7e-19  65%   85 aa  EX7S_MYCBO RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   11::71      3e-18  62%   78 aa  EX7S_MYCLE RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   15::70      4e-17  62%   82 aa  EX7S_MYCPA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   15::70      4e-17  62%   82 aa  EX7S_MYCA1 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   11::72      1e-14  56%   76 aa  EX7S_ARTS2 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   14::73      2e-13  55%   80 aa  EX7S_STRAW RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   14::74      3e-13  54%   78 aa  EX7S_PROAC RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::58      5e-13  62%   92 aa  EX7S_LEIXX RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   12::65      1e-12  59%   86 aa  EX7S_BEUC1 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::71      2e-12  52%   83 aa  EX7S_RHOP2 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::70      2e-12  55%   83 aa  EX7S_BRASO RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::70      2e-12  55%   83 aa  EX7S_BRASB RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::70      3e-12  55%   83 aa  EX7S_NITHX RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::71      4e-12  51%   83 aa  EX7S_RHOPS RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::71      5e-12  51%   83 aa  EX7S_RHOPT RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::71      5e-12  51%   83 aa  EX7S_RHOPA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::70      7e-12  52%   83 aa  EX7S_BRAJA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-11  52%   81 aa  EX7S_RHOP5 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    3::65      3e-11  53%   83 aa  EX7S_RHIE6 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    3::65      4e-11  46%   83 aa  EX7S_SINMW RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    3::65      6e-11  46%   83 aa  EX7S_RHIME RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    3::65      6e-11  52%   83 aa  EX7S_RHILW RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    3::65      6e-11  52%   83 aa  EX7S_RHIEC RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::70      6e-11  48%   83 aa  EX7S_OLICO RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   15::55      6e-10  61%   88 aa  EX7S_STRCO RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::65      6e-10  49%   83 aa  EX7S_AGRRK RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    6::61      8e-10  46%   81 aa  EX7S_SILST RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::65      1e-09  47%   83 aa  EX7S_AGRVS RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    6::68      1e-09  46%   86 aa  EX7S_AGRT5 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    3::67      2e-09  42%   76 aa  EX7S_GLUDA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::62      3e-09  45%   83 aa  EX7S_NOVAD RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      4e-09  40%   81 aa  EX7S_ZYMMO RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::65      4e-09  44%   83 aa  EX7S_RHILO RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   10::66      5e-09  46%   84 aa  EX7S_BART1 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   10::66      7e-09  44%   84 aa  EX7S_BARQU RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   16::70      7e-09  47%   96 aa  EX7S_ACIC1 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      9e-09  44%   80 aa  EX7S_PHEZH RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    3::59      1e-08  44%   83 aa  EX7S_GLUOX RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::65      1e-08  44%   83 aa  EX7S_BRUSU RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::65      1e-08  44%   83 aa  EX7S_BRUME RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    1::52      2e-08  46%   72 aa  EX7S_SILPO RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    5::57      3e-08  43%   76 aa  EX7S_LEGPC RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    5::57      3e-08  43%   76 aa  EX7S_LEGPA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   11::67      3e-08  42%   84 aa  EX7S_CAUCR RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   11::67      3e-08  42%   84 aa  EX7S_CAUCN RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    8::66      6e-08  39%   84 aa  EX7S_BARBK RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   10::62      8e-08  43%   84 aa  EX7S_AZOSB RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      1e-07  39%   74 aa  EX7S_SYMTH RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   10::65      1e-07  39%   83 aa  EX7S_HELMI RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   10::66      2e-07  37%   82 aa  EX7S_COXBU RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   10::66      2e-07  37%   82 aa  EX7S_COXBR RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   10::66      2e-07  37%   82 aa  EX7S_COXBN RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   10::66      2e-07  37%   82 aa  EX7S_COXB2 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   10::66      2e-07  37%   82 aa  EX7S_COXB1 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::64      2e-07  41%   80 aa  EX7S_RICM5 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    8::67      2e-07  42%   81 aa  EX7S_MAGSA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::71      3e-07  47%   80 aa  EX7S_VIBFM RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::71      3e-07  47%   80 aa  EX7S_VIBF1 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::66      3e-07  41%   78 aa  EX7S_PSYIN RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   18::80      3e-07  37%   93 aa  EX7S_POLNA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      3e-07  39%   76 aa  EX7S_METCA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    5::60      3e-07  38%   79 aa  EX7S_DECAR RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::70      4e-07  37%   80 aa  EX7S_RICAE RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::70      5e-07  37%   80 aa  EX7S_RICRS RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::70      5e-07  37%   80 aa  EX7S_RICRO RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::70      5e-07  37%   80 aa  EX7S_RICPU RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::70      5e-07  37%   80 aa  EX7S_RICCN RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::60      5e-07  42%   78 aa  EX7S_PARZE RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      5e-07  40%   80 aa  EX7S_ECOSE RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::61      6e-07  43%   80 aa  EX7S_PHOPR RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    3::57      8e-07  35%   75 aa  EX7S_CHLAB RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_SHISS RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_SHIFL RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_SHIF8 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_SHIDS RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_SHIBS RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_SHIB3 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   11::70      1e-06  37%   80 aa  EX7S_RICPR RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   11::70      1e-06  37%   80 aa  EX7S_RICCK RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::68      1e-06  40%   80 aa  EX7S_PSEHT RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ESCF3 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECOUT RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECOSM RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECOLU RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECOLI RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECOLC RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECOL6 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECOL5 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECOHS RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECODH RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECOBW RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECO8A RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECO81 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECO7I RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECO5E RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECO57 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECO55 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECO45 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECO27 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_ECO24 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   11::70      1e-06  37%   80 aa  EX7S_RICFE RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_KLEP7 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      1e-06  40%   80 aa  EX7S_KLEP3 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::71      1e-06  43%   80 aa  EX7S_ALISL RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   11::70      2e-06  37%   80 aa  EX7S_RICBR RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   11::70      2e-06  37%   80 aa  EX7S_RICB8 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   10::68      2e-06  42%   80 aa  EX7S_ENTS8 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      2e-06  39%   80 aa  EX7S_ENT38 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    1::59      2e-06  37%   79 aa  EX7S_SYNAS RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   11::70      2e-06  37%   80 aa  EX7S_RICAH RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      2e-06  40%   80 aa  EX7S_CITK8 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    1::53      2e-06  36%   74 aa  EX7S_BDEBA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   11::70      3e-06  37%   80 aa  EX7S_RICTY RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::60      4e-06  42%   80 aa  EX7S_VIBVY RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::60      4e-06  42%   80 aa  EX7S_VIBVU RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::68      4e-06  40%   80 aa  EX7S_VIBSL RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    6::63      4e-06  33%   78 aa  EX7S_OCEIH RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::68      4e-06  35%   84 aa  EX7S_HAEI8 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    3::60      5e-06  40%   95 aa  EX7S_LEPIN RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    3::60      5e-06  40%   95 aa  EX7S_LEPIC RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::68      5e-06  35%   84 aa  EX7S_HAEIN RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::68      5e-06  35%   79 aa  EX7S_HAEIG RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::68      5e-06  35%   84 aa  EX7S_HAEIE RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    8::65      5e-06  33%   82 aa  EX7S_CELJU RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    6::68      5e-06  33%   83 aa  EX7S_AERS4 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    3::60      7e-06  40%   96 aa  EX7S_LEPBL RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    3::60      7e-06  40%   96 aa  EX7S_LEPBJ RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    3::57      7e-06  35%   75 aa  EX7S_CHLFF RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   10::63      7e-06  39%   80 aa  EX7S_CAUSK RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      7e-06  32%   76 aa  EX7S_BACHK RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      7e-06  32%   76 aa  EX7S_BACCZ RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      7e-06  32%   76 aa  EX7S_BACCR RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      7e-06  32%   76 aa  EX7S_BACCQ RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      7e-06  32%   76 aa  EX7S_BACC7 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      7e-06  32%   76 aa  EX7S_BACC4 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      7e-06  32%   76 aa  EX7S_BACC3 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      7e-06  32%   76 aa  EX7S_BACC2 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      7e-06  32%   76 aa  EX7S_BACC1 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      7e-06  32%   76 aa  EX7S_BACC0 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      7e-06  32%   76 aa  EX7S_BACAN RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      7e-06  32%   76 aa  EX7S_BACAH RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      7e-06  32%   76 aa  EX7S_BACAC RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      7e-06  32%   76 aa  EX7S_BACAA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::66      9e-06  36%   80 aa  EX7S_VIBPA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::66      9e-06  36%   80 aa  EX7S_VIBHB RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   10::65      9e-06  39%   82 aa  EX7S_SODGM RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      9e-06  39%   80 aa  EX7S_SALTY RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      9e-06  39%   80 aa  EX7S_SALTI RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      9e-06  39%   80 aa  EX7S_SALSV RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      9e-06  39%   80 aa  EX7S_SALPK RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      9e-06  39%   80 aa  EX7S_SALPC RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      9e-06  39%   80 aa  EX7S_SALPB RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      9e-06  39%   80 aa  EX7S_SALPA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      9e-06  39%   80 aa  EX7S_SALNS RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      9e-06  39%   80 aa  EX7S_SALHS RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      9e-06  39%   80 aa  EX7S_SALG2 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      9e-06  39%   80 aa  EX7S_SALEP RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      9e-06  39%   80 aa  EX7S_SALDC RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      9e-06  39%   80 aa  EX7S_SALCH RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      9e-06  39%   80 aa  EX7S_SALAR RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::68      9e-06  39%   80 aa  EX7S_SALA4 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   18::75      9e-06  33%   87 aa  EX7S_HALHL RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      9e-06  32%   76 aa  EX7S_BACWK RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      9e-06  32%   76 aa  EX7S_BACCN RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    2::53      1e-05  37%   76 aa  EX7S_ENTFA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   14::69      2e-05  38%   84 aa  EX7S_YERPS RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   14::69      2e-05  38%   84 aa  EX7S_YERPG RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   14::69      2e-05  38%   84 aa  EX7S_YERPE RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   14::69      2e-05  38%   84 aa  EX7S_YERPB RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   14::69      2e-05  38%   84 aa  EX7S_YERP3 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   14::69      2e-05  39%   84 aa  EX7S_YERE8 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    1::60      2e-05  33%   75 aa  EX7S_THEP1 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    1::60      2e-05  33%   75 aa  EX7S_THEMA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   10::65      2e-05  39%   80 aa  EX7S_EDWI9 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    8::65      2e-05  33%   80 aa  EX7S_PSEFS RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   11::70      2e-05  35%   82 aa  EX7S_MANSM RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    3::57      2e-05  35%   75 aa  EX7S_CHLCV RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   11::69      2e-05  32%   86 aa  EX7S_BACP2 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    6::65      3e-05  32%   81 aa  EX7S_PSEU2 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    6::65      3e-05  32%   81 aa  EX7S_PSESM RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    6::64      3e-05  32%   83 aa  EX7S_MOOTA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    1::63      3e-05  33%   77 aa  EX7S_GEOLS RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    8::68      3e-05  30%   72 aa  EX7S_CHLTA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   20::70      3e-05  37%   88 aa  EX7S_BORPE RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   20::70      3e-05  37%   88 aa  EX7S_BORPA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   20::70      3e-05  37%   88 aa  EX7S_BORBR RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    5::61      4e-05  35%   76 aa  EX7S_STAHJ RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   14::69      5e-05  36%   84 aa  EX7S_YERPY RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::62      5e-05  27%   74 aa  EX7S_VESOH RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   13::56      5e-05  39%   74 aa  EX7S_RUTMC RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    8::63      5e-05  39%   92 aa  EX7S_PARUW RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   24::76      5e-05  34%   89 aa  EX7S_ACISJ RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   10::67      6e-05  33%   80 aa  EX7S_MARMS RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    8::68      6e-05  30%   72 aa  EX7S_CHLTR RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    1::61      6e-05  28%   75 aa  EX7S_ALKMQ RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   30::80      8e-05  37%   93 aa  EX7S_POLSJ RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   20::71      8e-05  33%   89 aa  EX7S_NITEU RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::66      8e-05  35%   74 aa  EX7S_HAEPS RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::56      1e-04  32%   75 aa  EX7S_THEP3 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::65      1e-04  31%   81 aa  EX7S_DESRM RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    1::41      1e-04  44%   77 aa  EX7S_CARHZ RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    4::56      1e-04  32%   75 aa  EX7S_THEPX RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::66      1e-04  34%   84 aa  EX7S_SYNFM RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      1e-04  32%   76 aa  EX7S_STAAW RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      1e-04  32%   76 aa  EX7S_STAAT RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      1e-04  32%   76 aa  EX7S_STAAS RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      1e-04  32%   76 aa  EX7S_STAAN RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      1e-04  32%   76 aa  EX7S_STAAM RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      1e-04  32%   76 aa  EX7S_STAAC RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      1e-04  32%   76 aa  EX7S_STAAB RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      1e-04  32%   76 aa  EX7S_STAA9 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      1e-04  32%   76 aa  EX7S_STAA8 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      1e-04  32%   76 aa  EX7S_STAA3 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      1e-04  32%   76 aa  EX7S_STAA2 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      1e-04  32%   76 aa  EX7S_STAA1 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      2e-04  32%   76 aa  EX7S_STAES RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      2e-04  32%   76 aa  EX7S_STAEQ RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   13::64      2e-04  33%   84 aa  EX7S_HERAR RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    5::57      2e-04  34%   75 aa  EX7S_CLOPS RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    5::57      2e-04  34%   75 aa  EX7S_CLOPE RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    5::57      2e-04  34%   75 aa  EX7S_CLOP1 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    6::72      2e-04  34%   97 aa  EX7S_BURVG RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::63      2e-04  32%   76 aa  EX7S_STAAR RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::45      2e-04  51%   83 aa  EX7S_NITWN RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::47      3e-04  46%   88 aa  EX7S_TOLAT RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   28::81      3e-04  35%   96 aa  EX7S_HAMD5 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::61      3e-04  31%   77 aa  EX7S_CHRVO RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    8::68      3e-04  28%   72 aa  EX7S_CHLTB RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    8::68      3e-04  28%   72 aa  EX7S_CHLT2 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    3::57      3e-04  31%   75 aa  EX7S_CHLPN RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    8::72      3e-04  32%   93 aa  EX7S_BURM1 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::64      3e-04  34%   74 aa  EX7S_ACTPJ RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::64      3e-04  34%   74 aa  EX7S_ACTP7 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    9::64      3e-04  34%   74 aa  EX7S_ACTP2 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   17::61      4e-04  38%   94 aa  EX7S_RALSO RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   13::64      4e-04  33%   84 aa  EX7S_JANMA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   29::71      5e-04  37%   87 aa  EX7S_XANCP RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   29::71      5e-04  37%   87 aa  EX7S_XANCB RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   29::71      5e-04  37%   87 aa  EX7S_XANC8 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::58      7e-04  33%   80 aa  EX7S_DESAD RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   10::46      7e-04  46%   84 aa  EX7S_BARHE RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    7::53      9e-04  34%   73 aa  EX7S_STRMU RecName: Full=Exodeoxyribonuclease 7 small subunit;   
   16::65      9e-04  30%   89 aa  EX7S_CHLPD RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    8::72      9e-04  31%   97 aa  EX7S_BURS3 RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    8::72      9e-04  31%   97 aa  EX7S_BURCJ RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    8::72      9e-04  31%   97 aa  EX7S_BURCH RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    8::72      9e-04  31%   97 aa  EX7S_BURCC RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    8::72      9e-04  31%   97 aa  EX7S_BURCA RecName: Full=Exodeoxyribonuclease 7 small subunit;   
    1::81

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxNPDIVGSGQGNDSFEPVAQLSYERARDELVEIVKILELGQMGLDESLKYWERGEALAKRCEEHLAGAS
EX7S_CORDI      ----DIIGQGTGTNAFAPVEELSYEQARDELVEVVRILELGQMGLDESLAYWERGEALAKRCEEHLNGAQ
EX7S_CORA7      ----DTIGAGQGQDAFPPVEELSYEQARDELIETVKILELGQMGLDESLKYWERGEALAKACEAHLDGAS
EX7S_MYCMM      -------------DSVTPISQLGYEACRDELIEVVRLLEQGGLDLDTSLKLWERGEVLAKRCEEHLAGAR
EX7S_NOCFA      -------------DELAEIAGFGYERARDELVNVVKMLEQGGMDLDESLALWERGEALANRCEEHLAGAR
EX7S_MYCTU      -----------------PVSQLGYEACRDELMEVVRLLEQGGLDLDASLRLWERGEQLAKRCEEHLAGAR
EX7S_MYCTA      -----------------PVSQLGYEACRDELMEVVRLLEQGGLDLDASLRLWERGEQLAKRCEEHLAGAR
EX7S_MYCBT      -----------------PVSQLGYEACRDELMEVVRLLEQGGLDLDASLRLWERGEQLAKRCEEHLAGAR
EX7S_MYCBP      -----------------PVSQLGYEACRDELMEVVRLLEQGGLDLDASLRLWERGEQLAKRCEEHLAGAR
EX7S_MYCBO      -----------------PVSQLGYEACRDELMEVVRLLEQGGLDLDASLRLWERGEQLAKRCEEHLAGAR
EX7S_MYCLE      -----------------PINQLGYEACRDELIEVVRLLEQGGLNLDMSLKLWERGEQLAKRCEEHLDGAR
EX7S_MYCPA      -----------------PISRLGYEACRDELIEVVRQLEQGGLDLDASLNLWERGEQLAKRCEEHLAGAR
EX7S_MYCA1      -----------------PISRLGYEACRDELIEVVRQLEQGGLDLDASLNLWERGEQLAKRCEEHLAGAR
EX7S_ARTS2      ------------------IEALSYEEAREQLVAVVGKLEAGGASLEDSLALWERGEALARRCEEWLEGAR
EX7S_STRAW      ---------------------LGYEQARDELIEVVRRLEAGGTTLEESLALWERGEELAKVCRTWLEGAR
EX7S_PROAC      --------------------EITYEAARDELVEIVTRLESGGISLAETMTLWERGEKLADICQSWLNGAR
EX7S_LEIXX      ------------------ISALGYEEARDELVRVVTELEQGSATLEESLALWERGEALARRCEEWLIG--
EX7S_BEUC1      -------------------ATLSYEQARAELVDVVQRLEQGAATLEDSLALWERGEALAARCQEWLDGAR
EX7S_RHOP2      ------------------VKKLSFERAMEELETIVKRLEDGKVPLEESVAIYERGEALKRRCEELLRQAE
EX7S_BRASO      ------------------VKKLSFERAIEELESIVKRLEDGKVPLEESVTIYERGEALKRRCEELLRQAE
EX7S_BRASB      ------------------VKKLSFERAIEELESIVKRLEDGKVPLEESVAIYERGEALKRRCEELLRQAE
EX7S_NITHX      ------------------VKTLSFERAIEELESIVKRLEDGKVPLEESVAIYERGEALKRRCEELLRQAE
EX7S_RHOPS      ------------------VKKLSFERAMEELETIVKRLEDGKVPLEESVAIYERGEALKRRCDELLRQAE
EX7S_RHOPT      ------------------VKKLSFERALEELETIVKRLEDGKVPLEESVTIYERGEALKRRCEDLLRQAE
EX7S_RHOPA      ------------------VKKLSFERALEELETIVKRLEDGKVPLEESVTIYERGEALKRRCEDLLRQAE
EX7S_BRAJA      ------------------VSRLTFERAIEELETIVKRLEDGKVPLEESVTIYERGEALKRRCEELLRQAE
EX7S_RHOP5      ------------------VKKLSFETAMEELESIVKRLEDGKVPLEESVAIYERGEALKRRCEELLRTAE
EX7S_RHIE6      -------------DSAKPVAGLSFEKAVAELESIVARLERGDVALDESIEIYERGEALKKHCETLLSAAE
EX7S_SINMW      ------------NTAQQDVSALSFEQAVEELERIVSALERGDVALDKSIEIYERGEALKKHCEALLKAAE
EX7S_RHIME      ------------NNAQPDVSALSFEQAVEELERIVSALERGDVALDKSIEIYERGEALKKHCEALLKAAE
EX7S_RHILW      -------------DSAKPVSGLSFEKAVAELESIVARLERGDVALDESIEIYERGEALKKHCETLLSAAE
EX7S_RHIEC      -------------DSAKPVSGLSFEKAVAELESIVARLERGDVALDESIEIYERGEALKKHCETLLSAAE
EX7S_OLICO      ------------------VTTMTFERAIEELESIVKRLEDGKVPLEESVAIYERGETLKRRCEELLRQAE
EX7S_STRCO      ---------------------LGYEQARDELIEVVRRLEAGGTTLEESLALWERGEELAEVC--------
EX7S_AGRRK      ------------------VSDYSFEKAVAELESIVARLERGDVALDESIAIYERGEALKKHCETLLSAAE
EX7S_SILST      -----------------PVEEMSFETAMQELERVVDQLERGDVALDASISLYERGAALKKRCEDELKRAE
EX7S_AGRVS      ------------------IAAYSFEKAVAELESIVARLERGDVALDESISIYERGELLKKHCEALLSAAE
EX7S_AGRT5      ------------NANTADVSGYSFEKAVAELESIVARLERGDVALDESIAIYERGEALKKHCETLLNAAE
EX7S_GLUDA      ----------------EDLSQLSFEDALAQLEEIVRQLEGGQLRLQDAIASYERGAALRRYCDTKLNEAD
EX7S_NOVAD      ------------------LASLSFEEALKELENVVRRLESGEAPLDESIELYARGDALRAHCQARLDAAQ
EX7S_ZYMMO      ------------------ISELSFEEALKKLEEIVRRLESGDTTLEDSIQMYSQGDALKKQCEARLKAAQ
EX7S_RHILO      ----------------EDVKAMSFEQALDALEKIVDDLERGDVPLDQSIRIYERGEALKAHCDRLLKAAE
EX7S_BART1      ------------------ITTLSFEQALKQLEVIVENLERGDVPLEQSIDIYERGEALKKHCEKLLKVAE
EX7S_BARQU      ------------------ITALSFEQALKQLEVIVENLERGDVPLEQSIDIYERGEALRKHCDRLLKAAE
EX7S_ACIC1      -------------------ARLSYEDARDELIQIVQXXXXXXXXXXXXXXXWERGEELARVCQAWLDGAR
EX7S_PHEZH      ------------------IAAMTFEQALAELEQIVARLESGQAPLEDSIRMYERGAALKAHCETRLEAAR
EX7S_GLUOX      ----------------EPIDAMSFEDALSELERIVRGLEGGQMKLEDAISAYERGAALRRHCDAKLGEAE
EX7S_BRUSU      ------------------IAVMSFEDALKQLEKIVDDLERGDVPLEESIRIYERGEALKKHCDTLLKSAE
EX7S_BRUME      ------------------IAVMSFEDALKQLEKIVDDLERGDVPLEESIRIYERGEALKKHCDTLLKSAE
EX7S_SILPO      ---------------------MSFEQAMKELETVVGQLERGDVALDQSIALYERGAALKKRCEDELKRAE
EX7S_LEGPC      ---------------------IHFEQSITELEEIVRQLEKGELTLEESLKQFEKGISLARRCQNALNQAE
EX7S_LEGPA      ---------------------IHFEQSITELEEIVRQLEKGELTLEESLKQFEKGISLARRCQNALNQAE
EX7S_CAUCR      ------------------ISALSFEEALSQLERIVQELESGQAALERSIDIYERGAALKAHCEKKLEAAR
EX7S_CAUCN      ------------------ISALSFEEALSQLERIVQELESGQAALERSIDIYERGAALKAHCEKKLEAAR
EX7S_BARBK      ----------------DDISGLSFEEALKQLEVIVENLERGDVPLEQSIDIYERGEALKNHCDKLLKVAE
EX7S_AZOSB      ----------------------SFEAAVAELETIVQQMESGQLSLEDALARYQRGVGLLKFCQETLSGAE
EX7S_SYMTH      --------------------ELSFEEAIQRLEQVVRELESGDLPLERGLELFQEGVALARHCTALLDRAE
EX7S_HELMI      ---------------------LTYEAAIGRLEEVVRSLETGEASLDESLKLFQEGIGLVRHCHSQLDAYE
EX7S_COXBU      ----------------------NFEASLNELTALVEKLEQGDLTLEESLQNFERGVGLVRSCQQALSDAE
EX7S_COXBR      ----------------------NFEASLNELTALVEKLEQGDLTLEESLQNFERGVGLVRSCQQALSDAE
EX7S_COXBN      ----------------------NFEASLNELTALVEKLEQGDLTLEESLQNFERGVGLVRSCQQALSDAE
EX7S_COXB2      ----------------------NFEASLNELTALVEKLEQGDLTLEESLQNFERGVGLVRSCQQALSDAE
EX7S_COXB1      ----------------------NFEASLNELTALVEKLEQGDLTLEESLQNFERGVGLVRSCQQALSDAE
EX7S_RICM5      -------------------ANISFEEALKELEEIVKKIDNGQESLETAVKSFERGILLKNHCEKKLKEAR
EX7S_MAGSA      ------------------IAAMSFEEALAELDLIVRRLEEGKGRLDDSIVAYERGALLKKHCEAKLEEAR
EX7S_VIBFM      ---------------------LSFEAAIEELDSVVNQLESGDLPLEDALKKFERGISLARAGQEKLTQAE
EX7S_VIBF1      ---------------------LSFEAAIEELDSVVNQLESGDLPLEDALKKFERGISLARAGQEKLTQAE
EX7S_PSYIN      ---------------------MHYEEAIDELENIVNHLEVGDLALEDALKQFERGIALARSNNQKLQKAQ
EX7S_POLNA      -----------GPDASAPALPVSYEAALQELEGLVSRLESGQLPLDQLLAGYQRGAQLLKFCRDRLEAVE
EX7S_METCA      ----------------------SFEEALTELEQLVERMEQGNLPLEESLKLFERGIELTRTCQKSLQDAE
EX7S_DECAR      -----------------PIADMKFETALAELEDIVASMEGGKLELEASIAAYKRGMELMKHCQNQLADAE
EX7S_RICAE      -------------------ANISFEEALKELEEIVKKIDKGQESLETAVNSFERGILLKNHCEKKLKEAR
EX7S_RICRS      -------------------ANISFEEALKELEEIVKKIDNGQESLETAVNSFERGILLKNHCEKKLKEAR
EX7S_RICRO      -------------------ANISFEEALKELEEIVKKIDNGQESLETAVNSFERGILLKNHCEKKLKEAR
EX7S_RICPU      -------------------ANISFEEALKELEEIVKKIDNGQESLETAVNSFERGILLKNHCEKKLKEAR
EX7S_RICCN      -------------------ANISFEEALKELEEIVKKIDNGQESLETAVNSFERGILLKNHCEKKLKEAR
EX7S_PARZE      ------------------IQTLSFEEAMRELEATVGKLETGEATLEDSIALYERGAALRAHCETRLREAE
EX7S_ECOSE      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQDKLQQAE
EX7S_PHOPR      ---------------------MAFEAALDELDSIVNELESGDIALEDALKKFERGIMLARTSQKKLTQAE
EX7S_CHLAB      --------------------EITFEKAMERLEEIVDLMNQPSTSLDASLKFYEEADALMRICESRIRKAE
EX7S_SHISS      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_SHIFL      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_SHIF8      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_SHIDS      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_SHIBS      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_SHIB3      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_RICPR      ---------------------ISFEEALRELEEIVKKIDTGQENLETAVNSFERGILLKNHCEKKLKEAR
EX7S_RICCK      ---------------------ISFEEALKELEEIVKKIDNGQESLETAVNSFERGIVLKNHCEKKLKEAR
EX7S_PSEHT      ---------------------LSFEQALEELTTIVSEMEQGDLSLEQSLKQFERGIALAGASSSKLQQAE
EX7S_ESCF3      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECOUT      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECOSM      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECOLU      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECOLI      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECOLC      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECOL6      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECOL5      -------------------APASFEKALSELEQIVTHLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECOHS      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECODH      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECOBW      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECO8A      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECO81      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECO7I      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECO5E      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECO57      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECO55      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECO45      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECO27      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_ECO24      -------------------APASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_RICFE      ---------------------ISFEEALKELEEIVKKIDNGQESLETAVNSFERGILLKNHCEKKLKEAR
EX7S_KLEP7      -------------------APASFETALGELEQIVNRLESGDLPLEEALSEFERGVQLARQGQSQLQKAE
EX7S_KLEP3      -------------------APASFETALGELEQIVNRLESGDLPLEEALSEFERGVQLARQGQSQLQKAE
EX7S_ALISL      ---------------------LTFEAAIEELDSVVNQLESGDLPLEDALKKFERGISLARAGQEKLTQAE
EX7S_RICBR      ---------------------ISFEEALSELEEIVKKIDNGQETLEAAVNSFERGILLKNHCEKKLKEAR
EX7S_RICB8      ---------------------ISFEEALSELEEIVKKIDNGQETLEAAVNSFERGILLKNHCEKKLKEAR
EX7S_ENTS8      ----------------------SFETALTELEQIVTRLESGDLPLEEALNEFERGVQLARQGQVKLQQAE
EX7S_ENT38      -------------------APASFETALNELEQIVNRLESGDLPLEDALNEFERGVQLARQGQVKLQQAE
EX7S_SYNAS      ------------------MAKEKFEEAMAKLEALVRKMETGDMTLEESLKAFEEGIRLSRLCASRLDDAE
EX7S_RICAH      ---------------------ISFESALKELEEIVKKIDNGQESLEMAVNSFERGILLKNHCEKKLKEAR
EX7S_CITK8      -------------------APASFETALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAE
EX7S_BDEBA      ---------------------MDFEKKLGRLEEIVQKMEKGDLALEESLKLFEEGVKLSRECHQRLNEAE
EX7S_RICTY      ---------------------ISFEEALRELEEIVKKIDNGQESLETAVNSFERGILLKNYCEKKLKEAR
EX7S_VIBVY      ---------------------MSFEATIEELDNLVDQLENGDLALDDALKKFERGIALARASQAKLTEAE
EX7S_VIBVU      ---------------------MSFEATIEELDNLVDQLENGDLALDDALKKFERGIALARASQAKLTEAE
EX7S_VIBSL      ---------------------MSFEAAIEELDGLVDQLENGDLALDDALKKFERGISLARAGQSKLNDAE
EX7S_OCEIH      ---------------------LTFEQAMEKLEGIVSKLEEGDVPLEKAIEYYQEGMNLSKLCSEKLNHVQ
EX7S_HAEI8      ----------------KPASSQDFETTLAQLENIVTHLENGDLPLEEALKEFEQGVQLAKLGQERLQQAE
EX7S_LEPIN      ----------------ETKSKISFEDALMELEQIAEKLERQDFSLEESLKAYERGMELKKICQGILDTAE
EX7S_LEPIC      ----------------ETKSKISFEDALMELEQIAEKLERQDFSLEESLKAYERGMELKKICQGILDTAE
EX7S_HAEIN      ----------------KPASSQDFETTLVQLENIVTHLENGDLPLEEALKEFEQGVQLAKLGQERLQQAE
EX7S_HAEIG      ----------------KPASSQDFETTLAKLENIVAHLENGDLPLEEALKEFEQGVQLAKLGQERLQQAE
EX7S_HAEIE      ----------------KPASSQDFETTLAKLENIVAHLENGDLPLEEALKEFEQGVQLAKLGQERLQQAE
EX7S_CELJU      ---------------------IDFEQSLNALEALVNRMEQGDMPLEESLQAFESGIALTRECQARLAAAE
EX7S_AERS4      ------------------IDRLSFDATLEELETIVHQLEQGSLPLEEALKQFEQGVHLVRAGQQKLEQAE
EX7S_LEPBL      ----------------EARSKISFEDALVELEQIAEKLERQDFSLEESLKAYERGMELKKICRGILDSAE
EX7S_LEPBJ      ----------------EARSKISFEDALVELEQIAEKLERQDFSLEESLKAYERGMELKKICRGILDSAE
EX7S_CHLFF      --------------------EIPFENAMERLEEIVDLMNQPSTSLDSSLKLYEEADALMRICESRIRKAE
EX7S_CAUSK      ---------------------MSFEQALARLEQIVGELESGKAELERSIEIYEDGAALKAHCEKKLEAAR
EX7S_BACHK      --------------------KLSFEEAISQLEHLVSKLEQGDVPLEEAISYFKEGMELSKLCDEKLKNVQ
EX7S_BACCZ      --------------------KLSFEEAISQLEHLVSKLEQGDVPLEEAISYFKEGMELSKLCDEKLKNVQ
EX7S_BACCR      --------------------KLSFEEAISQLEHLVSKLEQGDVPLEEAISYFKEGMELSKLCDEKLKNVQ
EX7S_BACCQ      --------------------KLSFEEAISQLEHLVSKLEQGDVPLEEAISYFKEGMELSKLCDEKLKNVQ
EX7S_BACC7      --------------------KLSFEEAISQLEHLVSKLEQGDVPLEEAISYFKEGMELSKLCDEKLKNVQ
EX7S_BACC4      --------------------KLSFEEAISQLEHLVSKLEQGDVPLEEAISYFKEGMELSKLCDEKLKNVQ
EX7S_BACC3      --------------------KLSFEEAISQLEHLVSKLEQGDVPLEEAISYFKEGMELSKLCDEKLKNVQ
EX7S_BACC2      --------------------KLSFEEAISQLEHLVSKLEQGDVPLEEAISYFKEGMELSKLCDEKLKNVQ
EX7S_BACC1      --------------------KLSFEEAISQLEHLVSKLEQGDVPLEEAISYFKEGMELSKLCDEKLKNVQ
EX7S_BACC0      --------------------KLSFEEAISQLEHLVSKLEQGDVPLEEAISYFKEGMELSKLCDEKLKNVQ
EX7S_BACAN      --------------------KLSFEEAISQLEHLVSKLEQGDVPLEEAISYFKEGMELSKLCDEKLKNVQ
EX7S_BACAH      --------------------KLSFEEAISQLEHLVSKLEQGDVPLEEAISYFKEGMELSKLCDEKLKNVQ
EX7S_BACAC      --------------------KLSFEEAISQLEHLVSKLEQGDVPLEEAISYFKEGMELSKLCDEKLKNVQ
EX7S_BACAA      --------------------KLSFEEAISQLEHLVSKLEQGDVPLEEAISYFKEGMELSKLCDEKLKNVQ
EX7S_VIBPA      ---------------------MTFEATIEELDSLVDQLENGDLALDDALRKFERGIALARAGQTKLSDAE
EX7S_VIBHB      ---------------------MTFEATIEELDSLVDQLENGDLALDDALRKFERGIALARAGQTKLSDAE
EX7S_SODGM      ----------------------SFETALKELEQIVTRLESGELPLEQALNEFEQGVQLARQGQKTLQQAE
EX7S_SALTY      -------------------APASFETALSELEHIVTRLESGDLPLEDALNEFERGVQLARQGQAKLQQAE
EX7S_SALTI      -------------------APASFETALSELEHIVTRLESGDLPLEDALNEFERGVQLARQGQAKLQQAE
EX7S_SALSV      -------------------APASFETALSELEHIVTRLESGDLPLEDALNEFERGVQLARQGQAKLQQAE
EX7S_SALPK      -------------------APASFETALSELEHIVTRLESGDLPLEDALNEFERGVQLARQGQAKLQQAE
EX7S_SALPC      -------------------APASFETALSELEHIVTRLESGDLPLEDALNEFERGVQLARQGQAKLQQAE
EX7S_SALPB      -------------------APASFETALSELEHIVTRLESGDLPLEDALNEFERGVQLARQGQAKLQQAE
EX7S_SALPA      -------------------APASFETALSELEHIVTRLESGDLPLEDALNEFERGVQLARQGQAKLQQAE
EX7S_SALNS      -------------------APASFETALSELEHIVTRLESGDLPLEDALNEFERGVQLARQGQAKLQQAE
EX7S_SALHS      -------------------APASFETALSELEHIVTRLESGDLPLEDALNEFERGVQLARQGQAKLQQAE
EX7S_SALG2      -------------------APASFETALSELEHIVTRLESGDLPLEDALNEFERGVQLARQGQAKLQQAE
EX7S_SALEP      -------------------APASFETALSELEHIVTRLESGDLPLEDALNEFERGVQLARQGQAKLQQAE
EX7S_SALDC      -------------------APASFETALSELEHIVTRLESGDLPLEDALNEFERGVQLARQGQAKLQQAE
EX7S_SALCH      -------------------APASFETALSELEHIVTRLESGDLPLEDALNEFERGVQLARQGQAKLQQAE
EX7S_SALAR      -------------------APASFETALSELEHIVTRLESGDLPLEDALNEFERGVQLARQGQAKLQQAE
EX7S_SALA4      -------------------APASFETALSELEHIVTRLESGDLPLEDALNEFERGVQLARQGQAKLQQAE
EX7S_HALHL      -----------------------FERSVAELEALIERMERGEQTLEEALRDFERGIHLTRHCQKALSAAE
EX7S_BACWK      --------------------KLSFEEAISQLEHLVSKLEQGDVPLEEAISYFKEGMELSKLCDEKLKDVQ
EX7S_BACCN      --------------------KLSFEEAISQLEHLVSKLEQGDVPLEEAISYFKEGMELSKLCDEKLKDVQ
EX7S_ENTFA      -----------------PAKEKTFEESLNALEEIVQRLERGDVPLEEALAAFQEGMALSKQCQDTLEKA-
EX7S_YERPS      ----------------------SFETSLSELEQIVTRLESGELPLEDALNEFERGVQLARQGQQTLLQAE
EX7S_YERPG      ----------------------SFETSLSELEQIVTRLESGELPLEDALNEFERGVQLARQGQQTLLQAE
EX7S_YERPE      ----------------------SFETSLSELEQIVTRLESGELPLEDALNEFERGVQLARQGQQTLLQAE
EX7S_YERPB      ----------------------SFETSLSELEQIVTRLESGELPLEDALNEFERGVQLARQGQQTLLQAE
EX7S_YERP3      ----------------------SFETSLSELEQIVTRLESGELPLEDALNEFERGVQLARQGQQTLLQAE
EX7S_YERE8      ----------------------SFETSLSELEQIVTRLESGELPLEEALNEFERGVQLARIGQQTLLQAE
EX7S_THEP1      ---------------------MNFEEMMKELEEIVNRLENEDLPLEESIKLFERGVELYRKCKEILQQNR
EX7S_THEMA      ---------------------MNFEEMMKELEEIVNRLENEDLPLEESIKLFERGVELYRKCKEILQQNR
EX7S_EDWI9      ----------------------AFEQALSELEQIVVRLESGDLPLEEALSEFERGIRLARQGQQTLQQAE
EX7S_PSEFS      ---------------------LDFEQSLADLQTLVERLENGELSLEDSLTAFEQGIGLTRDCQSALAQAE
EX7S_MANSM      ---------------------VDFETTLNQLETIVTRLEAGDLPLEEALKEFENGIKLAKLGQERLQQAE
EX7S_CHLCV      --------------------EIPFENAMARLEEIVDLMNQPSTSLDSSLKLYEEADALMRICESRIRKAE
EX7S_BACP2      --------------------QMTFEEAMKGLEEIVGKLEEGDVPLEQAIHYFQEGMTLSKLCHEKLQHVE
EX7S_PSEU2      -------------------AALDFEQSLADLQALVERLENGELSLEDSLTAFEQGVRLTRDCQSALTQAE
EX7S_PSESM      -------------------AALDFEQSLADLQALVERLENGELSLEDSLTAFEQGVRLTRDCQSALTQAE
EX7S_MOOTA      --------------------QLTFEAALQKLEEVVQALEGEGLTLEDSLAYYQEGIRLVRLCRQRLKEVE
EX7S_GEOLS      ------------------MAAEKFETSLKKLEEVVRKLEGGSLSLDDSIKAFEEGVKHAAFCAKKLDEAE
EX7S_CHLTA      ------------------VEKIPFEDAMKRLEEIIDLMNQPTTSLEASLTLYEEADQLMRICESHIQEVE
EX7S_BORPE      -----------------------FETALAELESLVSAMENGTLPLEQSLSAYRRGVELARVCQDRLAQAE
EX7S_BORPA      -----------------------FETALAELESLVSAMENGTLPLEQSLSAYRRGVELARVCQDRLAQAE
EX7S_BORBR      -----------------------FETALAELESLVSAMENGTLPLEQSLSAYRRGVELARVCQDRLAQAE
EX7S_STAHJ      --------------------QQSFEEMMQELENIVQKLDNETVSLEESLELYQRGMKLSATCDATLKDAE
EX7S_YERPY      ----------------------SFETSLSELEQIVTRLESGELPLEDALNEFERGVQLVRQGQQTLLQAE
EX7S_VESOH      --------------------KFNFNQGLIDLEKIVKAMESGDLSLEDSLNHFSKGVELTKQCQSALNKAE
EX7S_RUTMC      -----------------------------DLEKIVKTMESGDLSLENSLDYFSKGVALTKLCQSALNEAE
EX7S_PARUW      ----------------EPTA--SFETALCRLEEILEKMNSGTVSLDESLKLYEEADQLIIICNKRLNDAE
EX7S_ACISJ      ---------------------VSYEAALEELEQLVGRIESGQLPLDQMLAGYQRGAVLLNFCRARLEAVQ
EX7S_MARMS      -----------------------FEENLSELDTLVTQLESNQLSLEEALKAFEKGVKLSQECQSVLTQAE
EX7S_CHLTR      ------------------VEKISFEDAMKRLEEIIDLMNQPTTSLEASLALYEEADQLMRICESRIQEVE
EX7S_ALKMQ      ------------------MAKIKFEEGIKKLEEIINQLENKEQGLDDALELFQEGVRLYRICNEKLTEAE
EX7S_POLSJ      -----------------------YEAALQELEGLVAGLESGQLPLDQLLTGYQRGAQLLKFCRDKLEAVE
EX7S_NITEU      ----------------------NFETATAELEQIVAGMETGQMSLEDALSAYKRGVELLQYCQNILKNSQ
EX7S_HAEPS      ---------------------LDFETTLKELEEIVNRLETGDLPLEEALNEFETAVKLVQQGQERLQKAE
EX7S_THEP3      --------------------ELTFEEEMMRLEEIVNTLEKGNLRLEESFNLFKEGVEISKRLEKRLSEVE
EX7S_DESRM      ----------------------TFEEALARLEQVVRELELTQLPLDQALELFAEGITLSKYCNSCLEQAE
EX7S_CARHZ      ---------------------MTFEEAMNRLNEIVERLERGNVGLEESLALFEEGLKLHRFC--------
EX7S_THEPX      --------------------ELTFEEEMMRLEEIVNTLEKGNLMLEESFNLFKEGVEISKRLEKRLSEVE
EX7S_SYNFM      -----------------------FEEALKKLQDIVEKLERGDMPLEEAMEAFSEGIRLARVCHGKLEEAE
EX7S_STAAW      ----------------------SFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAE
EX7S_STAAT      ----------------------SFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAE
EX7S_STAAS      ----------------------SFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAE
EX7S_STAAN      ----------------------SFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAE
EX7S_STAAM      ----------------------SFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAE
EX7S_STAAC      ----------------------SFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAE
EX7S_STAAB      ----------------------SFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAE
EX7S_STAA9      ----------------------SFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAE
EX7S_STAA8      ----------------------SFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAE
EX7S_STAA3      ----------------------SFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAE
EX7S_STAA2      ----------------------SFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAE
EX7S_STAA1      ----------------------SFEEMMQELEQIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAE
EX7S_STAES      ----------------------SFEEMMKELENIVQKLDNEAVSLEESLDLYQRGMKLSANCDSTLKEAE
EX7S_STAEQ      ----------------------SFEEMMKELENIVQKLDNEAVSLEESLDLYQRGMKLSANCDSTLKEAE
EX7S_HERAR      ----------------------SFEEAMAELEQLVARMEAGELPLEASVAAYKRGSELVKYCAAQLEKVD
EX7S_CLOPS      --------------------ETNYESMVSELNEIVKQLENGDLTLEESIKSYENGVKIVNKLYKKLSTLE
EX7S_CLOPE      --------------------ETNYESMVSELNEIVKQLENGDLTLEESIKSYENGVKIVNKLYKKLSTLE
EX7S_CLOP1      --------------------ETNYESMVSELNEIVKQLENGDLTLEESIKSYENGVKIVNKLYKKLSTLE
EX7S_BURVG      --SPGDTAAGNGT---EPLPD-KYETALAELESLVARMEGGALSLEDSLAAYRRGAALVAFCQQQLEKVE
EX7S_STAAR      ----------------------SFEEMMQELERIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAE
EX7S_NITWN      ------------------VNTLSFELAIEELETIVKRLEDGKVALEESVAIYERG---------------
EX7S_TOLAT      ---------------------LSFDAALGELEQIVQQLEQGDLPLETALKQFERGIQLAR----------
EX7S_HAMD5      ------------------------ETALNDLEQVVTRLESGNLSLEEALNEFERGIKLTKQTQKTLLEAE
EX7S_CHRVO      -------------------APASFETALAQLEDIIQAMDSGDMPLETALASYKQGTELIKFCQGKLADAE
EX7S_CHLTB      ------------------VEKVPFEDAMKRLEEIIDLMNQPTTSLEASLALYEEADQLMRICESRIQEVE
EX7S_CHLT2      ------------------VEKVPFEDAMKRLEEIIDLMNQPTTSLEASLALYEEADQLMRICESRIQEVE
EX7S_CHLPN      --------------------EVPFENAMQRLEEIVDLMNQPTTSLDASLALYEEADALMRICESRIRQVE
EX7S_BURM1      -------GATPPGNGAEPLPD-NYETALAELETLVARMEGGALSLEDSLAAYRRGAALVAFCQQQLEKVE
EX7S_ACTPJ      -----------------------FESTLKELEAIVSHLETGELPLEEALNEFETAVKLVQQGQERLQKAE
EX7S_ACTP7      -----------------------FESTLKELEAIVSHLETGELPLEEALNEFETAVKLVQQGQERLQKAE
EX7S_ACTP2      -----------------------FESTLKELEAIVSHLETGELPLEEALNEFETAVKLVQQGQERLQKAE
EX7S_RALSO      -----------------PATPASYEAAMAELETLVASMESGELPLEASLAAYRRGAELVRYC--------
EX7S_JANMA      ----------------------SFEEAMAELEQLVARMEAGELPLEASVAAYKRGSELVKYCAAQLEKVD
EX7S_XANCP      -------------------------------------MEVGEMSLEQSLTAYERGIGLYRDCQQALEQAE
EX7S_XANCB      -------------------------------------MEVGEMSLEQSLTAYERGIGLYRDCQQALEQAE
EX7S_XANC8      -------------------------------------MEVGEMSLEQSLTAYERGIGLYRDCQQALEQAE
EX7S_DESAD      ----------------------TFEDRLDRLKAIVSALEKGDLPLEEGVALFKEGQTLSKECATQLEKAR
EX7S_BARHE      ------------------VATLSFEQALKQLEVIVENLERGDVPLEQSIDIYERG---------------
EX7S_STRMU      ----------------------TFEENLQDLEEIVNQLETGEIPLEEAITQFQKGMALSKDLQKTLESA-
EX7S_CHLPD      ------------------------EELISRLEEITRNIENPETGIENSIALYEEGLAIAEQCKKRLQEAR
EX7S_BURS3      -------GATPPGNGTEPLPD-NYEMALAELETLVARMEGGALSLEDSLTAYRRGATLVAFCQQQLEKVE
EX7S_BURCJ      -------GATPPGNGTEPLPD-NYEMALAELETLVARMEGGALSLEDSLAAYRRGATLVAFCQQQLEKVE
EX7S_BURCH      -------GATPPGNGTEPLPD-NYEMALAELETLVARMEGGALSLEDSLAAYRRGATLVAFCQQQLEKVE
EX7S_BURCC      -------GATPPGNGTEPLPD-NYEMALAELETLVARMEGGALSLEDSLAAYRRGATLVAFCQQQLEKVE
EX7S_BURCA      -------GATPPGNGTEPLPD-NYEMALAELETLVARMEGGALSLEDSLAAYRRGATLVAFCQQQLEKVE


                         .         .         *         .         .         .         .:140
query           ARVEQALNQAE
EX7S_CORDI      QRIEKALGE--
EX7S_CORA7      KRVEEALRK--
EX7S_MYCMM      QRVADALAASE
EX7S_NOCFA      KRVEDALAGSE
EX7S_MYCTU      QRVSDVL----
EX7S_MYCTA      QRVSDVL----
EX7S_MYCBT      QRVSDVL----
EX7S_MYCBP      QRVSDVL----
EX7S_MYCBO      QRVSDVL----
EX7S_MYCLE      QRVADVLS---
EX7S_MYCPA      KRI--------
EX7S_MYCA1      KRI--------
EX7S_ARTS2      KRLAAARNQA-
EX7S_STRAW      KRLDAALAEEE
EX7S_PROAC      ARIEAARSDAE
EX7S_LEIXX      -----------
EX7S_BEUC1      DRL--------
EX7S_RHOP2      ARVDKITTDAQ
EX7S_BRASO      ARVEKITTDA-
EX7S_BRASB      ARVEKITTDA-
EX7S_NITHX      ARVEKITTDA-
EX7S_RHOPS      ARVDKITTDAQ
EX7S_RHOPT      ARVDKITTDAQ
EX7S_RHOPA      ARVDKITTDAQ
EX7S_BRAJA      ARVDKITTDA-
EX7S_RHOP5      ARVDKITTDA-
EX7S_RHIE6      NRIEK------
EX7S_SINMW      DRIEK------
EX7S_RHIME      DRIEK------
EX7S_RHILW      NRIEK------
EX7S_RHIEC      NRIEK------
EX7S_OLICO      ARVDKITTDA-
EX7S_STRCO      -----------
EX7S_AGRRK      NRIEK------
EX7S_SILST      EKV--------
EX7S_AGRVS      NRIEK------
EX7S_AGRT5      KRIEK------
EX7S_GLUDA      ARVQAIIQRAD
EX7S_NOVAD      ARIE-------
EX7S_ZYMMO      KKIEQ------
EX7S_RHILO      DKVEK------
EX7S_BART1      AKVEK------
EX7S_BARQU      AKVEK------
EX7S_ACIC1      ARLE-------
EX7S_PHEZH      LRVEK------
EX7S_GLUOX      MRV--------
EX7S_BRUSU      DKVEK------
EX7S_BRUME      DKVEK------
EX7S_SILPO      EKV--------
EX7S_LEGPC      QKIE-------
EX7S_LEGPA      QKIE-------
EX7S_CAUCR      LKVEK------
EX7S_CAUCN      LKVEK------
EX7S_BARBK      AKIEK------
EX7S_AZOSB      QRIRQ------
EX7S_SYMTH      ARIEQLLER--
EX7S_HELMI      AKVQRLI----
EX7S_COXBU      QKVKVLINQ--
EX7S_COXBR      QKVKVLINQ--
EX7S_COXBN      QKVKVLINQ--
EX7S_COXB2      QKVKVLINQ--
EX7S_COXB1      QKVKVLINQ--
EX7S_RICM5      LKIEK------
EX7S_MAGSA      TKVERIVS---
EX7S_VIBFM      QRVEQADDNAE
EX7S_VIBF1      QRVEQADDNAE
EX7S_PSYIN      QQVNILMQQ--
EX7S_POLNA      TQIK-------
EX7S_METCA      QKVQILLEE--
EX7S_DECAR      AQI--------
EX7S_RICAE      LKIEKITKLAD
EX7S_RICRS      LKIEKITKLAD
EX7S_RICRO      LKIEKITKLAD
EX7S_RICPU      LKIEKITKLAD
EX7S_RICCN      LKIEKITKLAD
EX7S_PARZE      ERVEK------
EX7S_ECOSE      QRVQILLSDNE
EX7S_PHOPR      QRVE-------
EX7S_CHLAB      ERVRE------
EX7S_SHISS      QRVQILLSDNE
EX7S_SHIFL      QRVQILLSDNE
EX7S_SHIF8      QRVQILLSDNE
EX7S_SHIDS      QRVQILLSDNE
EX7S_SHIBS      QRVQILLSDNE
EX7S_SHIB3      QRVQILLSDNE
EX7S_RICPR      LKIEKITKLAD
EX7S_RICCK      LKIEKITKLAD
EX7S_PSEHT      QKVAILMGKDE
EX7S_ESCF3      QRVQILLSDNE
EX7S_ECOUT      QRVQILLSDNE
EX7S_ECOSM      QRVQILLSDNE
EX7S_ECOLU      QRVQILLSDNE
EX7S_ECOLI      QRVQILLSDNE
EX7S_ECOLC      QRVQILLSDNE
EX7S_ECOL6      QRVQILLSDNE
EX7S_ECOL5      QRVQILLSDNE
EX7S_ECOHS      QRVQILLSDNE
EX7S_ECODH      QRVQILLSDNE
EX7S_ECOBW      QRVQILLSDNE
EX7S_ECO8A      QRVQILLSDNE
EX7S_ECO81      QRVQILLSDNE
EX7S_ECO7I      QRVQILLSDNE
EX7S_ECO5E      QRVQILLSDNE
EX7S_ECO57      QRVQILLSDNE
EX7S_ECO55      QRVQILLSDNE
EX7S_ECO45      QRVQILLSDNE
EX7S_ECO27      QRVQILLSDNE
EX7S_ECO24      QRVQILLSDNE
EX7S_RICFE      LKIEKITKLAD
EX7S_KLEP7      QRVQILLADSE
EX7S_KLEP3      QRVQILLADSE
EX7S_ALISL      QRVDQADDNAE
EX7S_RICBR      LKIEKITKLAD
EX7S_RICB8      LKIEKITKLAD
EX7S_ENTS8      QRVQILLSQNE
EX7S_ENT38      QRVQILLSDSE
EX7S_SYNAS      RRVEMLI----
EX7S_RICAH      LKIEKITKLAD
EX7S_CITK8      QRVQILLSDNE
EX7S_BDEBA      SKVK-------
EX7S_RICTY      LKIEKITKLAD
EX7S_VIBVY      QRV--------
EX7S_VIBVU      QRV--------
EX7S_VIBSL      QRVSILLKNDE
EX7S_OCEIH      DKMVQIMNE--
EX7S_HAEI8      QRIQILLQKTE
EX7S_LEPIN      GKIE-------
EX7S_LEPIC      GKIE-------
EX7S_HAEIN      QRIQILLQKTE
EX7S_HAEIG      QRIQILLQKTE
EX7S_HAEIE      QRIQILLQKTE
EX7S_CELJU      LQVTKLIEE--
EX7S_AERS4      QKIQILLTQAD
EX7S_LEPBL      GKIE-------
EX7S_LEPBJ      GKIE-------
EX7S_CHLFF      DRVRE------
EX7S_CAUSK      LKVEK------
EX7S_BACHK      EQMAVILGE--
EX7S_BACCZ      EQMAVILGE--
EX7S_BACCR      EQMAVILGE--
EX7S_BACCQ      EQMAVILGE--
EX7S_BACC7      EQMAVILGE--
EX7S_BACC4      EQMAVILGE--
EX7S_BACC3      EQMAVILGE--
EX7S_BACC2      EQMAVILGE--
EX7S_BACC1      EQMAVILGE--
EX7S_BACC0      EQMAVILGE--
EX7S_BACAN      EQMAVILGE--
EX7S_BACAH      EQMAVILGE--
EX7S_BACAC      EQMAVILGE--
EX7S_BACAA      EQMAVILGE--
EX7S_VIBPA      QRVSILLSE--
EX7S_VIBHB      QRVSILLSE--
EX7S_SODGM      QRVQILLN---
EX7S_SALTY      QRVQILLSDNE
EX7S_SALTI      QRVQILLSDNE
EX7S_SALSV      QRVQILLSDNE
EX7S_SALPK      QRVQILLSDNE
EX7S_SALPC      QRVQILLSDNE
EX7S_SALPB      QRVQILLSDNE
EX7S_SALPA      QRVQILLSDNE
EX7S_SALNS      QRVQILLSDNE
EX7S_SALHS      QRVQILLSDNE
EX7S_SALG2      QRVQILLSDNE
EX7S_SALEP      QRVQILLSDNE
EX7S_SALDC      QRVQILLSDNE
EX7S_SALCH      QRVQILLSDNE
EX7S_SALAR      QRVQILLSDNE
EX7S_SALA4      QRVQILLSDNE
EX7S_HALHL      QKVAILLENSE
EX7S_BACWK      EQMAVILGE--
EX7S_BACCN      EQMAVILGE--
EX7S_ENTFA      -----------
EX7S_YERPS      QRVQILLS---
EX7S_YERPG      QRVQILLS---
EX7S_YERPE      QRVQILLS---
EX7S_YERPB      QRVQILLS---
EX7S_YERP3      QRVQILLS---
EX7S_YERE8      QRVQVLLS---
EX7S_THEP1      LKIIDVMKELE
EX7S_THEMA      LKIIDVMKELE
EX7S_EDWI9      QRVKILLS---
EX7S_PSEFS      QKVQVLLER--
EX7S_MANSM      QRIQILLQKSD
EX7S_CHLCV      DRVRE------
EX7S_BACP2      KQMDFILKE--
EX7S_PSEU2      QKVQVLLER--
EX7S_PSESM      QKVQVLLER--
EX7S_MOOTA      GKLQVILLQ--
EX7S_GEOLS      RKVEVLIKQRD
EX7S_CHLTA      ARIKQLSDQ--
EX7S_BORPE      QQVK-------
EX7S_BORPA      QQVK-------
EX7S_BORBR      QQVK-------
EX7S_STAHJ      KKVNQLI----
EX7S_YERPY      QRVQILLS---
EX7S_VESOH      QKISMLTEQ--
EX7S_RUTMC      QKI--------
EX7S_PARUW      RKIE-------
EX7S_ACISJ      DQIK-------
EX7S_MARMS      QKVQILLEKQD
EX7S_CHLTR      ARIKQLSDQ--
EX7S_ALKMQ      EKISVMIEE--
EX7S_POLSJ      TQIK-------
EX7S_NITEU      QQIK-------
EX7S_HAEPS      QRIQILLQKNE
EX7S_THEP3      GKI--------
EX7S_DESRM      QKISMLMADGE
EX7S_CARHZ      -----------
EX7S_THEPX      GKI--------
EX7S_SYNFM      RKVRILLKEQE
EX7S_STAAW      KKVNDLIKE--
EX7S_STAAT      KKVNDLIKE--
EX7S_STAAS      KKVNDLIKE--
EX7S_STAAN      KKVNDLIKE--
EX7S_STAAM      KKVNDLIKE--
EX7S_STAAC      KKVNDLIKE--
EX7S_STAAB      KKVNDLIKE--
EX7S_STAA9      KKVNDLIKE--
EX7S_STAA8      KKVNDLIKE--
EX7S_STAA3      KKVNDLIKE--
EX7S_STAA2      KKVNDLIKE--
EX7S_STAA1      KKVNDLIKE--
EX7S_STAES      KKVNELMQE--
EX7S_STAEQ      KKVNELMQE--
EX7S_HERAR      SQVK-------
EX7S_CLOPS      GKI--------
EX7S_CLOPE      GKI--------
EX7S_CLOP1      GKI--------
EX7S_BURVG      QQV--------
EX7S_STAAR      KKVNDLIKE--
EX7S_NITWN      -----------
EX7S_TOLAT      -----------
EX7S_HAMD5      QHVKILLS---
EX7S_CHRVO      QQLK-------
EX7S_CHLTB      ARIKQLSDQ--
EX7S_CHLT2      ARIKQLSDQ--
EX7S_CHLPN      QRVRE------
EX7S_BURM1      QQV--------
EX7S_ACTPJ      QRIQILLNK--
EX7S_ACTP7      QRIQILLNK--
EX7S_ACTP2      QRIQILLNK--
EX7S_RALSO      -----------
EX7S_JANMA      NQVK-------
EX7S_XANCP      LRVRLVTDPA-
EX7S_XANCB      LRVRLVTDPA-
EX7S_XANC8      LRVRLVTDPA-
EX7S_DESAD      NEVK-------
EX7S_BARHE      -----------
EX7S_STRMU      -----------
EX7S_CHLPD      KKIE-------
EX7S_BURS3      QQV--------
EX7S_BURCJ      QQV--------
EX7S_BURCH      QQV--------
EX7S_BURCC      QQV--------
EX7S_BURCA      QQV--------