[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF54198.1

[Show Plain Result]


## Summary of Sequence Search
    1::175
  227::293     3e-04  41%  308 aa  ALLS_ECOUT RecName: Full=HTH-type transcriptional activator allS;
  227::293     3e-04  41%  308 aa  ALLS_ECOL6 RecName: Full=HTH-type transcriptional activator allS;
  227::293     3e-04  41%  308 aa  ALLS_ECOL5 RecName: Full=HTH-type transcriptional activator allS;
  227::293     3e-04  41%  308 aa  ALLS_ECOK1 RecName: Full=HTH-type transcriptional activator allS;
  227::293     4e-04  41%  308 aa  ALLS_ECOLI RecName: Full=HTH-type transcriptional activator allS;
  227::293     4e-04  41%  308 aa  ALLS_ECO57 RecName: Full=HTH-type transcriptional activator allS;
    1::175

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxTRYAAHFKSVFPTALDDIQSMMRHPRSLARAIPTWRPPSIPLPSL
ALLS_ECOUT      -------------------------TKIAAHLAGVLPKSL--CQSMLDNQQLVSRVIPTMRPPS------
ALLS_ECOL6      -------------------------TKIAAHLAGVLPKSL--CQSMLDNQQLVSRVIPTMRPPS------
ALLS_ECOL5      -------------------------TKIAAHLAGVLPKSL--CQSMLDNQQLVSRVIPTMRPPS------
ALLS_ECOK1      -------------------------TKIAAHLAGVLPKSL--CQSMLDNQQLVSRVIPTMRPPS------
ALLS_ECOLI      -------------------------TKIAAHLAGVLPKSL--CQSMIDNQQLVSRVIPTMRPPS------
ALLS_ECO57      -------------------------TKIAAHLAGVLPKSL--CQSMIDNQQLVSRVIPTMRPPS------


                         .         .         *         .         .         .         .:140
query           PGEDPLTLTLSRHRAGPAARQIIREFGEQRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ALLS_ECOUT      ----PLSLAWRKFGSGKAVEDIVTLFTQRR----------------------------------------
ALLS_ECOL6      ----PLSLAWRKFGSGKAVEDIVTLFTQRR----------------------------------------
ALLS_ECOL5      ----PLSLAWRKFGSGKAVEDIVTLFTQRR----------------------------------------
ALLS_ECOK1      ----PLSLAWRKFGSGKAVEDIVTLFTQRR----------------------------------------
ALLS_ECOLI      ----PLSLAWRKFGSGKAVEDIVTLFTQRR----------------------------------------
ALLS_ECO57      ----PLSLAWRKFGSGKAVEDIVTLFTQRR----------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ALLS_ECOUT      -----------------------------------
ALLS_ECOL6      -----------------------------------
ALLS_ECOL5      -----------------------------------
ALLS_ECOK1      -----------------------------------
ALLS_ECOLI      -----------------------------------
ALLS_ECO57      -----------------------------------