[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF54269.1

[Show Plain Result]


## Summary of Sequence Search
    1::325
    1::325     e-167 100%  325 aa  ATPG_CORGB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::325     e-166  99%  325 aa  ATPG_CORGL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::326     e-143  86%  326 aa  ATPG_COREF RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::325     e-122  77%  325 aa  ATPG_CORDI RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::326     e-115  68%  326 aa  ATPG_CORJK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::325     e-103  65%  325 aa  ATPG_CORU7 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::323     1e-85  57%  323 aa  ATPG_NOCFA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::313     8e-85  60%  326 aa  ATPG_RHOSR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::313     5e-84  60%  326 aa  ATPG_RHOOB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::306     2e-75  54%  308 aa  ATPG_SACEN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::308     5e-69  52%  309 aa  ATPG_MYCVP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::306     8e-69  52%  307 aa  ATPG_MYCS2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::304     2e-68  51%  305 aa  ATPG_MYCTU RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::304     2e-68  51%  305 aa  ATPG_MYCTA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::304     2e-68  51%  305 aa  ATPG_MYCBT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::304     2e-68  51%  305 aa  ATPG_MYCBP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::304     2e-68  51%  305 aa  ATPG_MYCBO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::299     3e-68  51%  305 aa  ATPG_STRGG RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::299     3e-67  47%  305 aa  ATPG_STRAW RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::298     3e-67  53%  303 aa  ATPG_NOCSJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::308     6e-66  51%  309 aa  ATPG_MYCGI RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::299     1e-65  45%  305 aa  ATPG_STRCO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::303     2e-65  50%  304 aa  ATPG_MYCMM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::305     2e-65  51%  308 aa  ATPG_MYCA9 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::297     4e-65  46%  303 aa  ATPG_STRLI RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::297     5e-65  52%  298 aa  ATPG_MYCLE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::297     5e-65  52%  298 aa  ATPG_MYCLB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::308     7e-65  53%  309 aa  ATPG_MYCSS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::308     7e-65  53%  309 aa  ATPG_MYCSK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::308     7e-65  53%  309 aa  ATPG_MYCSJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    5::299     7e-65  51%  302 aa  ATPG_KINRD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::303     3e-64  50%  304 aa  ATPG_MYCUA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::314     3e-62  48%  314 aa  ATPG_PROAC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::294     3e-62  50%  297 aa  ATPG_ARTS2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   17::298     3e-62  46%  300 aa  ATPG_ACIC1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::303     2e-61  47%  304 aa  ATPG_MYCPA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::303     2e-61  47%  304 aa  ATPG_MYCA1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    5::295     3e-60  49%  298 aa  ATPG_FRASC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    5::295     2e-59  49%  298 aa  ATPG_FRASN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::298     3e-59  42%  299 aa  ATPG_LEIXX RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::306     3e-58  47%  309 aa  ATPG_SALTO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::306     4e-58  47%  309 aa  ATPG_SALAI RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::295     3e-55  46%  296 aa  ATPG_ARTAT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::297     3e-54  41%  297 aa  ATPG_MICLC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    6::297     3e-54  43%  297 aa  ATPG_BEUC1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::295     7e-54  46%  296 aa  ATPG_ARTCA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    7::301     2e-52  38%  306 aa  ATPG_BIFAA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::290     9e-52  45%  304 aa  ATPG_THEFY RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::298     3e-51  39%  299 aa  ATPG_CLAMS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    7::307     3e-51  37%  307 aa  ATPG_BIFLI RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    7::307     5e-51  37%  307 aa  ATPG_BIFLO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    7::307     5e-51  37%  307 aa  ATPG_BIFLD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::301     2e-50  37%  306 aa  ATPG_BIFA0 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::298     2e-49  38%  299 aa  ATPG_CLAM3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::284     4e-49  42%  285 aa  ATPG_EXISA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::294     2e-48  43%  297 aa  ATPG_RENSM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::282     2e-48  42%  283 aa  ATPG_DESRM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     6e-48  40%  286 aa  ATPG_OCEIH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     9e-47  39%  287 aa  ATPG_STRM5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-46  36%  288 aa  ATPG_STAES RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-46  36%  288 aa  ATPG_STAEQ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-46  39%  288 aa  ATPG_STAAW RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-46  39%  288 aa  ATPG_STAAT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-46  39%  288 aa  ATPG_STAAS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-46  39%  288 aa  ATPG_STAAR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-46  39%  288 aa  ATPG_STAAN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-46  39%  288 aa  ATPG_STAAM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-46  39%  288 aa  ATPG_STAAE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-46  39%  288 aa  ATPG_STAAC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-46  39%  288 aa  ATPG_STAA9 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-46  39%  288 aa  ATPG_STAA2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-46  39%  288 aa  ATPG_STAA1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-46  37%  288 aa  ATPG_STAHJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-46  39%  288 aa  ATPG_STAAB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::280     7e-46  39%  290 aa  ATPG_RUBXD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     1e-45  38%  288 aa  ATPG_LEGPL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     1e-45  38%  288 aa  ATPG_LEGPH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     1e-45  38%  288 aa  ATPG_LEGPC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     1e-45  38%  288 aa  ATPG_LEGPA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-45  39%  287 aa  ATPG_PROMH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     5e-45  39%  286 aa  ATPG_PSEAE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     5e-45  39%  286 aa  ATPG_PSEAB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     5e-45  39%  286 aa  ATPG_PSEA8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     5e-45  39%  286 aa  ATPG_PSEA7 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::293     6e-45  35%  293 aa  ATPG_PSYWF RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::303     6e-45  40%  303 aa  ATPG_KOCRD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     8e-45  38%  287 aa  ATPG_STRMK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     8e-45  38%  287 aa  ATPG_STACT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::293     8e-45  36%  293 aa  ATPG_PSYCK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     8e-45  40%  288 aa  ATPG_PSEU5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     8e-45  40%  287 aa  ATPG_AZOVD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     1e-44  41%  316 aa  ATPG_SYNP6 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     1e-44  41%  316 aa  ATPG_SYNE7 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     1e-44  39%  286 aa  ATPG_MARMS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::293     2e-44  35%  293 aa  ATPG_PSYA2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     2e-44  36%  289 aa  ATPG_HAEIN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     3e-44  36%  289 aa  ATPG_HAEIE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     4e-44  42%  286 aa  ATPG_PSEF5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     4e-44  36%  289 aa  ATPG_HAEIG RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     5e-44  38%  286 aa  ATPG_SHEPW RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-44  37%  287 aa  ATPG_HAHCH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     5e-44  40%  285 aa  ATPG_DEHSC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     7e-44  41%  314 aa  ATPG_SYNP2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     7e-44  41%  286 aa  ATPG_PSEPK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     7e-44  41%  286 aa  ATPG_PSEP1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     7e-44  42%  286 aa  ATPG_PSEFS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     9e-44  39%  286 aa  ATPG_SHELP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     9e-44  41%  286 aa  ATPG_PSEPF RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     9e-44  37%  287 aa  ATPG_ERWCT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     9e-44  37%  289 aa  ATPG_ACIBY RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     9e-44  37%  289 aa  ATPG_ACIBT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     9e-44  37%  289 aa  ATPG_ACIBS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     9e-44  37%  289 aa  ATPG_ACIBC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     9e-44  37%  289 aa  ATPG_ACIB3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     1e-43  38%  286 aa  ATPG_SHEWM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::284     1e-43  39%  285 aa  ATPG_LYSSC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     1e-43  38%  289 aa  ATPG_ACIAD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-43  37%  287 aa  ATPG_XANCP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-43  37%  287 aa  ATPG_XANCB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-43  37%  287 aa  ATPG_XANC8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     2e-43  38%  286 aa  ATPG_SHESR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     2e-43  38%  286 aa  ATPG_SHESM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     2e-43  41%  286 aa  ATPG_PSEPW RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-43  39%  287 aa  ATPG_PSEMY RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     2e-43  38%  286 aa  ATPG_SHESA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     2e-43  38%  286 aa  ATPG_SHEPA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-43  37%  287 aa  ATPG_SALTY RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-43  37%  287 aa  ATPG_SALSV RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-43  37%  287 aa  ATPG_SALPC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-43  37%  287 aa  ATPG_SALPB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-43  37%  287 aa  ATPG_SALNS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-43  37%  287 aa  ATPG_SALHS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-43  37%  287 aa  ATPG_SALG2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-43  37%  287 aa  ATPG_SALEP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-43  37%  287 aa  ATPG_SALDC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-43  37%  287 aa  ATPG_SALCH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-43  37%  287 aa  ATPG_SALAR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-43  37%  287 aa  ATPG_SALA4 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     2e-43  41%  286 aa  ATPG_PSEPG RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-43  39%  287 aa  ATPG_KLEP3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     2e-43  36%  289 aa  ATPG_HAEI8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::284     2e-43  36%  285 aa  ATPG_BACHD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     3e-43  37%  287 aa  ATPG_XANC5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     3e-43  38%  288 aa  ATPG_STAS1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     3e-43  38%  286 aa  ATPG_SHESH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     3e-43  38%  287 aa  ATPG_SALPK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     3e-43  38%  287 aa  ATPG_SALPA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     3e-43  41%  286 aa  ATPG_PSEE4 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   17::289     3e-43  39%  290 aa  ATPG_HELMI RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     3e-43  36%  289 aa  ATPG_HALHL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     3e-43  37%  287 aa  ATPG_ENTS8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     3e-43  39%  292 aa  ATPG_CHRSD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     6e-43  38%  288 aa  ATPG_VIBVY RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     6e-43  38%  288 aa  ATPG_VIBVU RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     6e-43  38%  286 aa  ATPG_THISH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     8e-43  37%  287 aa  ATPG_XANOR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     8e-43  37%  287 aa  ATPG_XANOP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     8e-43  37%  287 aa  ATPG_XANOM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     8e-43  38%  288 aa  ATPG_VIBAL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::294     8e-43  35%  294 aa  ATPG_NITEU RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-42  37%  287 aa  ATPG_XANAC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     1e-42  38%  286 aa  ATPG_SHEB9 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     1e-42  38%  286 aa  ATPG_SHEB8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     1e-42  38%  286 aa  ATPG_SHEB5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     1e-42  38%  286 aa  ATPG_SHEB2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-42  37%  288 aa  ATPG_MACCJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-42  38%  287 aa  ATPG_KLEP7 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-42  37%  287 aa  ATPG_YERPY RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-42  37%  287 aa  ATPG_YERPS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-42  37%  287 aa  ATPG_YERPP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-42  37%  287 aa  ATPG_YERPN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-42  37%  287 aa  ATPG_YERPG RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-42  37%  287 aa  ATPG_YERPE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-42  37%  287 aa  ATPG_YERPB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-42  37%  287 aa  ATPG_YERPA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-42  37%  287 aa  ATPG_YERP3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-42  37%  287 aa  ATPG_YERE8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     1e-42  41%  286 aa  ATPG_PSEU2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     1e-42  41%  286 aa  ATPG_PSE14 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::293     1e-42  36%  294 aa  ATPG_MYXXD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     1e-42  36%  289 aa  ATPG_MANSM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     1e-42  37%  286 aa  ATPG_BACHK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     1e-42  37%  286 aa  ATPG_BACCZ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     1e-42  37%  286 aa  ATPG_BACCR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     1e-42  37%  286 aa  ATPG_BACC7 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     1e-42  37%  286 aa  ATPG_BACC4 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     1e-42  37%  286 aa  ATPG_BACC3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     1e-42  37%  286 aa  ATPG_BACC1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     1e-42  37%  286 aa  ATPG_BACC0 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     1e-42  37%  286 aa  ATPG_BACAN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     1e-42  37%  286 aa  ATPG_BACAH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     1e-42  37%  286 aa  ATPG_BACAC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     1e-42  37%  286 aa  ATPG_BACAA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-42  37%  287 aa  ATPG_SERP5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     2e-42  37%  286 aa  ATPG_BACWK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     2e-42  37%  291 aa  ATPG2_PHOPR RecName: Full=ATP synthase gamma chain 2;AltName:
    1::288     2e-42  38%  288 aa  ATPG_VIBPA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     2e-42  37%  314 aa  ATPG_TRIEI RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-42  38%  287 aa  ATPG_SALTI RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     2e-42  36%  291 aa  ATPG_METFK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     3e-42  41%  286 aa  ATPG_PSESM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     4e-42  37%  291 aa  ATPG_RALEH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     4e-42  37%  290 aa  ATPG_GEMAT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     4e-42  37%  286 aa  ATPG_BACCN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     4e-42  38%  286 aa  ATPG_ALCBS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::293     5e-42  35%  293 aa  ATPG_NITMU RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     5e-42  35%  289 aa  ATPG_ACTSZ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     7e-42  40%  315 aa  ATPG_SYNP1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     7e-42  36%  286 aa  ATPG_SHEON RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     7e-42  39%  315 aa  ATPG_CYAP4 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     9e-42  36%  292 aa  ATPG_SYNFM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     9e-42  36%  286 aa  ATPG_SHEHH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     9e-42  38%  286 aa  ATPG_SHEAM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::294     9e-42  33%  294 aa  ATPG_NITEC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     9e-42  37%  291 aa  ATPG_CUPTR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     1e-41  34%  289 aa  ATPG_HAES1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-41  35%  287 aa  ATPG_ALHEH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     1e-41  36%  286 aa  ATPG_SHEFN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     1e-41  38%  287 aa  ATPG_COLMA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::285     1e-41  37%  286 aa  ATPG_BACP3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::282     2e-41  36%  282 aa  ATPG_PROMO RecName: Full=ATP synthase gamma chain, sodium ion
    1::286     2e-41  36%  287 aa  ATPG_MARAV RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     2e-41  36%  289 aa  ATPG_ERWT9 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     3e-41  36%  291 aa  ATPG_RALSO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     3e-41  38%  287 aa  ATPG_PHOLL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::284     3e-41  35%  285 aa  ATPG_GEOSW RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     3e-41  35%  287 aa  ATPG_GEOSM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     4e-41  37%  286 aa  ATPG_SHESW RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     4e-41  37%  286 aa  ATPG_SHEPC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     4e-41  38%  286 aa  ATPG_SHEDO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     4e-41  34%  289 aa  ATPG_HAES2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     6e-41  37%  291 aa  ATPG_RALEJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     6e-41  36%  287 aa  ATPG_COLP3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     9e-41  37%  288 aa  ATPG_VIBF1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     9e-41  37%  288 aa  ATPG_HAEDU RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    5::287     9e-41  37%  287 aa  ATPG_BREBN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     1e-40  37%  288 aa  ATPG_VIBFM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     1e-40  40%  290 aa  ATPG_LISW6 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     1e-40  40%  290 aa  ATPG_LISMO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     1e-40  40%  290 aa  ATPG_LISMH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     1e-40  40%  290 aa  ATPG_LISMF RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     1e-40  40%  290 aa  ATPG_LISMC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     1e-40  40%  290 aa  ATPG_LISIN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     1e-40  37%  286 aa  ATPG_LEPIC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     1e-40  36%  290 aa  ATPG_CHLAD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     1e-40  37%  288 aa  ATPG_ACTPJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-40  36%  287 aa  ATPG_RUTMC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     2e-40  35%  289 aa  ATPG_PASMU RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     2e-40  36%  288 aa  ATPG_DIAST RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     2e-40  36%  288 aa  ATPG_ACISJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     2e-40  36%  288 aa  ATPG1_PHOPR RecName: Full=ATP synthase gamma chain 1;AltName:
    1::288     2e-40  36%  288 aa  ATPG_VIBCM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     2e-40  36%  288 aa  ATPG_VIBCH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     2e-40  36%  288 aa  ATPG_VIBC3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     2e-40  36%  290 aa  ATPG_CHLSY RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     2e-40  36%  290 aa  ATPG_CHLAA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     3e-40  36%  291 aa  ATPG_RALME RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     3e-40  37%  288 aa  ATPG_ALISL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     3e-40  37%  288 aa  ATPG_AERS4 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     3e-40  37%  288 aa  ATPG_AERHH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     4e-40  35%  287 aa  ATPG_GEOBB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     4e-40  37%  288 aa  ATPG_CHRVO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     4e-40  36%  288 aa  ATPG_ACTP7 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     4e-40  36%  288 aa  ATPG_ACTP2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     5e-40  35%  290 aa  ATPG_THIDA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     5e-40  36%  291 aa  ATPG_RALPJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-40  37%  287 aa  ATPG_EDWI9 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     6e-40  35%  289 aa  ATPG_JANMA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     6e-40  35%  288 aa  ATPG_BACSK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     8e-40  35%  286 aa  ATPG_TERTT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-39  36%  287 aa  ATPG_XYLFT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-39  36%  287 aa  ATPG_XYLFM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-39  36%  287 aa  ATPG_XYLF2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-39  40%  287 aa  ATPG_METCA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::281     1e-39  41%  282 aa  ATPG_MOOTA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    6::286     2e-39  36%  288 aa  ATPG_SYMTH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     2e-39  36%  291 aa  ATPG_METPP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     2e-39  33%  288 aa  ATPG_HAEPS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::301     2e-39  34%  301 aa  ATPG_BORPD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     2e-39  37%  290 aa  ATPG_ANAD2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     2e-39  39%  314 aa  ATPG_SYNY3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-39  36%  287 aa  ATPG_ECO55 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-39  36%  287 aa  ATPG_ECO24 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::301     2e-39  34%  301 aa  ATPG_BORPE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::301     2e-39  34%  301 aa  ATPG_BORBR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::284     3e-39  35%  285 aa  ATPG_GEOKA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::301     3e-39  34%  301 aa  ATPG_BORPA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     3e-39  34%  289 aa  ATPG_BACPF RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     3e-39  35%  288 aa  ATPG_ACIAC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     4e-39  36%  287 aa  ATPG_XYLFA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     4e-39  35%  288 aa  ATPG_POLSJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     4e-39  36%  290 aa  ATPG_DELAS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     4e-39  36%  289 aa  ATPG_AZOSE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_SHIFL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_SHIF8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_SHIDS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_SHIB3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ESCF3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECOUT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECOSM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECOSE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECOLU RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECOLI RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECOLC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECOL6 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECOL5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECOK1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECOHS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECODH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECOBW RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECO8A RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECO81 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECO7I RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECO5E RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECO57 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECO45 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-39  35%  287 aa  ATPG_ECO27 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     5e-39  36%  290 aa  ATPG_ANASK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     7e-39  35%  293 aa  ATPG_LEPCP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     7e-39  35%  289 aa  ATPG_DICNV RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::301     7e-39  34%  301 aa  ATPG_BORA1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     9e-39  36%  287 aa  ATPG_PECCP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::296     9e-39  38%  298 aa  ATPG_DESOH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-38  35%  287 aa  ATPG_CITK8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     2e-38  34%  291 aa  ATPG_VARPS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-38  34%  288 aa  ATPG_BACP2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-38  35%  287 aa  ATPG_ENT38 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     3e-38  37%  317 aa  ATPG_SYNS3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::315     3e-38  39%  315 aa  ATPG_SYNR3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     3e-38  35%  287 aa  ATPG_SHISS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     3e-38  34%  287 aa  ATPG_IDILO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     3e-38  35%  314 aa  ATPG_CYAP8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     3e-38  33%  317 aa  ATPG_SYNS9 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     3e-38  35%  286 aa  ATPG_SACD2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     3e-38  35%  288 aa  ATPG_POLNA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     4e-38  36%  316 aa  ATPG_PROMS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     4e-38  35%  316 aa  ATPG_PROM5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   16::286     4e-38  36%  286 aa  ATPG_ALTMD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     6e-38  34%  291 aa  ATPG_VEREI RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::277     6e-38  38%  286 aa  ATPG_RUMAL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     6e-38  34%  290 aa  ATPG_ROSCS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     6e-38  35%  316 aa  ATPG_PROMP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     6e-38  35%  316 aa  ATPG_PROM0 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     7e-38  35%  287 aa  ATPG_SHIBS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     7e-38  38%  316 aa  ATPG_PROMM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     7e-38  38%  316 aa  ATPG_PROM3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     7e-38  37%  289 aa  ATPG_NITOC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     7e-38  36%  289 aa  ATPG_ANADE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     1e-37  34%  290 aa  ATPG_ROSS1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     1e-37  40%  314 aa  ATPG_CYAP7 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     1e-37  32%  291 aa  ATPG_CLOPH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-37  35%  287 aa  ATPG_TOLAT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::315     1e-37  36%  316 aa  ATPG_SYNPW RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::308     1e-37  33%  308 aa  ATPG_SALRD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   16::286     1e-37  36%  286 aa  ATPG_PSEA6 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::286     1e-37  36%  287 aa  ATPG_BACCA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     2e-37  37%  285 aa  ATPG_DEHSB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     2e-37  35%  286 aa  ATPG_DECAR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::315     2e-37  36%  316 aa  ATPG_SYNSC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::316     2e-37  38%  316 aa  ATPG_PROM1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   18::280     2e-37  39%  281 aa  ATPG_DESHD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     2e-37  36%  290 aa  ATPG_ANADF RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::316     3e-37  39%  316 aa  ATPG_PROMT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::295     3e-37  32%  295 aa  ATPG_BURP8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   42::362     4e-37  40%  364 aa  ATPG_SPIOL RecName: Full=ATP synthase gamma chain,
    1::314     4e-37  35%  316 aa  ATPG_PROM9 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::281     4e-37  36%  283 aa  ATPG_EXIS2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     5e-37  37%  286 aa  ATPG_LEPBL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     5e-37  37%  286 aa  ATPG_LEPBJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     5e-37  31%  287 aa  ATPG_GEOSL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     6e-37  34%  316 aa  ATPG_PROM2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   62::369     6e-37  37%  370 aa  ATPG_ODOSI RecName: Full=ATP synthase gamma chain,
    1::314     8e-37  38%  315 aa  ATPG_THEEB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::294     8e-37  32%  294 aa  ATPG_BURXL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::294     8e-37  32%  294 aa  ATPG_BURPP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::315     1e-36  36%  316 aa  ATPG_SYNPX RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     1e-36  40%  316 aa  ATPG_PROMA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::283     1e-36  33%  284 aa  ATPG_PELTS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::293     1e-36  34%  295 aa  ATPG_CYTH3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     1e-36  36%  314 aa  ATPG_CYAA5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::280     1e-36  35%  282 aa  ATPG_CARHZ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     1e-36  33%  288 aa  ATPG_GEOLS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::282     2e-36  36%  282 aa  ATPG_FUSNN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     2e-36  35%  286 aa  ATPG_BACC2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::301     2e-36  34%  302 aa  ATPG_ENTFA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     3e-36  33%  295 aa  ATPG_CHLPB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    6::306     4e-36  33%  308 aa  ATPG_NATTJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::276     4e-36  34%  289 aa  ATPG_COXB2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     5e-36  34%  288 aa  ATPG_VESOH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-36  35%  287 aa  ATPG_SODGM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::303     5e-36  33%  304 aa  ATPG_CHLT3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   16::286     7e-36  36%  286 aa  ATPG_PSEHT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     7e-36  32%  289 aa  ATPG_POLNS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::315     7e-36  38%  315 aa  ATPG_MICAN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     7e-36  32%  291 aa  ATPG_BURS3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::286     7e-36  35%  287 aa  ATPG_BACST RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::311     1e-35  37%  311 aa  ATPG_SPIPL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::276     1e-35  34%  289 aa  ATPG_COXBU RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::276     1e-35  34%  289 aa  ATPG_COXBR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::276     1e-35  34%  289 aa  ATPG_COXBN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::276     1e-35  34%  289 aa  ATPG_COXB1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::316     2e-35  36%  316 aa  ATPG_PROM4 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     2e-35  32%  291 aa  ATPG_BURM1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::283     2e-35  32%  284 aa  ATPG_BACLD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     2e-35  34%  291 aa  ATPG_NEIG1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::284     2e-35  35%  285 aa  ATPG_BACME RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::316     2e-35  37%  317 aa  ATPG_ACAM1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     3e-35  33%  289 aa  ATPG_HERAR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     3e-35  32%  287 aa  ATPG_GEOUR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::290     3e-35  32%  291 aa  ATPG_STRPZ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     3e-35  36%  290 aa  ATPG_PHEZH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     3e-35  34%  291 aa  ATPG_NEIMA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     3e-35  34%  291 aa  ATPG_NEIM0 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     3e-35  33%  288 aa  ATPG_LARHH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    5::293     3e-35  31%  294 aa  ATPG_CLOCE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::290     5e-35  32%  291 aa  ATPG_STRPM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::290     5e-35  32%  291 aa  ATPG_STRPG RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::290     5e-35  32%  291 aa  ATPG_STRPF RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::290     5e-35  32%  291 aa  ATPG_STRPD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::290     5e-35  32%  291 aa  ATPG_STRPC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::290     5e-35  32%  291 aa  ATPG_STRPB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::290     5e-35  32%  291 aa  ATPG_STRP8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::290     5e-35  32%  291 aa  ATPG_STRP6 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::290     5e-35  32%  291 aa  ATPG_STRP1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::292     5e-35  31%  293 aa  ATPG_STRA3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     5e-35  34%  291 aa  ATPG_NEIMF RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     5e-35  34%  291 aa  ATPG_NEIMB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     5e-35  34%  291 aa  ATPG_NEIG2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   37::358     5e-35  38%  359 aa  ATPG_MAIZE RecName: Full=ATP synthase subunit gamma,
   34::355     5e-35  38%  358 aa  ATPG_CHLRE RecName: Full=ATP synthase gamma chain,
    1::276     6e-35  33%  295 aa  ATPG_HERA2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     6e-35  30%  291 aa  ATPG_BUCAP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::291     8e-35  33%  292 aa  ATPG_STRTR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::291     8e-35  33%  292 aa  ATPG_STRTD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::291     8e-35  33%  292 aa  ATPG_STRT2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::291     8e-35  33%  292 aa  ATPG_STRT1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     8e-35  31%  291 aa  ATPG_BURCM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     8e-35  31%  291 aa  ATPG_BURA4 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::290     1e-34  32%  291 aa  ATPG_STRP3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     1e-34  35%  289 aa  ATPG_AZOSB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     1e-34  35%  315 aa  ATPG_ANAVT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::292     1e-34  30%  293 aa  ATPG_STRA5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::292     1e-34  30%  293 aa  ATPG_STRA1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   57::376     2e-34  38%  377 aa  ATPG_TOBAC RecName: Full=ATP synthase gamma chain,
   54::369     2e-34  34%  376 aa  ATPG_PEA RecName: Full=ATP synthase gamma chain,
    1::291     2e-34  31%  291 aa  ATPG_BURCJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     2e-34  35%  315 aa  ATPG_ANASP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     2e-34  33%  288 aa  ATPG_PSYIN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::294     3e-34  33%  295 aa  ATPG_DESAP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     3e-34  32%  291 aa  ATPG_BURTA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     4e-34  33%  291 aa  ATPG_SYNAS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     5e-34  32%  289 aa  ATPG_LEPBP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     5e-34  32%  289 aa  ATPG_LEPBA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::293     5e-34  28%  295 aa  ATPG_BDEBA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::302     5e-34  33%  302 aa  ATPG_BARBK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::296     7e-34  32%  298 aa  ATPG_RHOFD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::296     7e-34  30%  314 aa  ATPG_LACRJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::296     7e-34  30%  314 aa  ATPG_LACRD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     7e-34  34%  289 aa  ATPG_HAMD5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     7e-34  31%  291 aa  ATPG_BURPS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     7e-34  31%  291 aa  ATPG_BURP6 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     7e-34  31%  291 aa  ATPG_BURP1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     7e-34  31%  291 aa  ATPG_BURP0 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     7e-34  31%  291 aa  ATPG_BURMS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     7e-34  31%  291 aa  ATPG_BURMA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     7e-34  31%  291 aa  ATPG_BURM9 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     7e-34  31%  291 aa  ATPG_BURM7 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     9e-34  31%  290 aa  ATPG_BUCDN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     1e-33  35%  286 aa  ATPG_RHOBL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     1e-33  31%  290 aa  ATPG_BUCAT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     1e-33  31%  290 aa  ATPG_BUCAI RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     1e-33  31%  290 aa  ATPG_BUCA5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::303     1e-33  33%  303 aa  ATPG_BARQU RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     2e-33  30%  295 aa  ATPG_SULNB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    5::288     2e-33  35%  289 aa  ATPG_ALKMQ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     2e-33  34%  291 aa  ATPG_SILPO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   61::369     2e-33  36%  370 aa  ATPG_PHATR RecName: Full=ATP synthase gamma chain,
    1::284     2e-33  33%  285 aa  ATPG_PARUW RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   24::289     2e-33  33%  289 aa  ATPG_LACLS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::291     3e-33  31%  292 aa  ATPG_STRMU RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::307     6e-33  31%  308 aa  ATPG_LACC3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::301     7e-33  32%  302 aa  ATPG_LEUMM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::307     7e-33  31%  308 aa  ATPG_LACCB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     7e-33  31%  290 aa  ATPG_DESPS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     9e-33  36%  314 aa  ATPG_SYNJA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     9e-33  35%  315 aa  ATPG_NOSP7 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     1e-32  31%  289 aa  ATPG_POLSQ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   24::289     1e-32  32%  289 aa  ATPG_LACLM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     1e-32  32%  287 aa  ATPG_BAUCH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   24::289     2e-32  33%  289 aa  ATPG_LACLA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::284     5e-32  34%  286 aa  ATPG_FLAPJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     5e-32  33%  289 aa  ATPG_BACV8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::299     6e-32  32%  300 aa  ATPG_ENTHR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::297     6e-32  32%  298 aa  ATPG_DESAH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::295     8e-32  33%  295 aa  ATPG_RHOCS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     8e-32  32%  289 aa  ATPG_LAWIP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::284     8e-32  35%  286 aa  ATPG_FLAJ1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::290     1e-31  31%  291 aa  ATPG_STRU0 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::301     1e-31  31%  302 aa  ATPG_LEUCK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::298     1e-31  34%  298 aa  ATPG_GRABC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    5::298     1e-31  31%  300 aa  ATPG_ACEWO RecName: Full=ATP synthase gamma chain, sodium ion
    1::314     1e-31  35%  314 aa  ATPG_SYNJB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::303     2e-31  32%  303 aa  ATPG_BARHE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     2e-31  29%  287 aa  ATPG_GEOMG RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::299     3e-31  32%  299 aa  ATPG_RHORU RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::299     3e-31  32%  299 aa  ATPG_RHORT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     3e-31  33%  290 aa  ATPG_PELLD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::308     4e-31  31%  309 aa  ATPG_LACS1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     4e-31  32%  287 aa  ATPG_BACA2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     5e-31  30%  291 aa  ATPG_DESVH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     5e-31  34%  292 aa  ATPG_CHLP8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::294     7e-31  33%  294 aa  ATPG_MAGSA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   19::285     9e-31  35%  285 aa  ATPG_DEHE1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    8::279     9e-31  32%  281 aa  ATPG_CLOPA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     9e-31  35%  288 aa  ATPG_ACIF5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     9e-31  35%  288 aa  ATPG_ACIF2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     1e-30  33%  291 aa  ATPG_ROSDO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::292     2e-30  28%  293 aa  ATPG_STRSV RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::292     2e-30  28%  293 aa  ATPG_STRSA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     2e-30  38%  290 aa  ATPG_RHOCA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::293     2e-30  30%  311 aa  ATPG_LACF3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     2e-30  31%  291 aa  ATPG_CHLPD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   17::323     2e-30  36%  323 aa  ATPG_SORC5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     2e-30  33%  291 aa  ATPG_PROVI RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::314     2e-30  32%  315 aa  ATPG_LACSS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::291     3e-30  28%  292 aa  ATPG_STRR6 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::291     3e-30  28%  292 aa  ATPG_STRPN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::291     3e-30  28%  292 aa  ATPG_STRP2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   25::294     3e-30  34%  296 aa  ATPG_RHOBA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::314     3e-30  36%  314 aa  ATPG_GLOVI RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::290     3e-30  30%  291 aa  ATPG_STREM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     3e-30  34%  292 aa  ATPG_METNO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    6::291     3e-30  29%  292 aa  ATPG_CALS8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::298     4e-30  31%  298 aa  ATPG_FRAP2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::291     6e-30  28%  292 aa  ATPG_STRZT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::291     6e-30  28%  292 aa  ATPG_STRZP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::291     6e-30  28%  292 aa  ATPG_STRZJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::291     6e-30  28%  292 aa  ATPG_STRPS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::291     6e-30  28%  292 aa  ATPG_STRPJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::291     6e-30  28%  292 aa  ATPG_STRPI RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::291     6e-30  28%  292 aa  ATPG_STRP7 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     6e-30  30%  292 aa  ATPG_NITWN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::309     6e-30  31%  314 aa  ATPG_LACPL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::298     6e-30  30%  298 aa  ATPG_FRATT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::298     6e-30  30%  298 aa  ATPG_FRAT1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::292     7e-30  28%  293 aa  ATPG_STRGC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::296     7e-30  33%  296 aa  ATPG_JANSC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     7e-30  32%  287 aa  ATPG_GEOSF RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::298     7e-30  30%  298 aa  ATPG_FRATM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::296     7e-30  28%  298 aa  ATPG_BACTN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::295     1e-29  32%  295 aa  ATPG_METPB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     1e-29  33%  292 aa  ATPG_DESAD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     1e-29  34%  291 aa  ATPG_CAUCR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     1e-29  34%  291 aa  ATPG_CAUCN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     2e-29  29%  292 aa  ATPG_NITHX RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::298     2e-29  30%  298 aa  ATPG_FRATO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::298     2e-29  30%  298 aa  ATPG_FRATN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::298     2e-29  30%  298 aa  ATPG_FRATF RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::293     2e-29  34%  298 aa  ATPG_THIFE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    7::290     2e-29  30%  291 aa  ATPG_SULSY RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::290     2e-29  29%  291 aa  ATPG_STRS7 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::290     2e-29  29%  291 aa  ATPG_STRE4 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     2e-29  30%  291 aa  ATPG_PELPB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     2e-29  34%  292 aa  ATPG_CHLTE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::294     2e-29  33%  294 aa  ATPG_AGRRK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     3e-29  31%  291 aa  ATPG_PELUB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::319     3e-29  33%  320 aa  ATPG_LACDB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::319     3e-29  33%  320 aa  ATPG_LACDA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::284     3e-29  38%  286 aa  ATPG_GRAFK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::298     3e-29  30%  298 aa  ATPG_FRATW RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     3e-29  31%  292 aa  ATPG_BRUC2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     3e-29  30%  288 aa  ATPG_BLOFL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     4e-29  31%  291 aa  ATPG_RHOPT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     4e-29  31%  291 aa  ATPG_RHOPA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::298     4e-29  31%  298 aa  ATPG_FRATH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     4e-29  31%  290 aa  ATPG_BACFN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::290     5e-29  29%  291 aa  ATPG_STREI RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::295     5e-29  33%  295 aa  ATPG_MARMM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::296     5e-29  36%  296 aa  ATPG_GLUOX RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     5e-29  31%  291 aa  ATPG_CHLL2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     5e-29  31%  292 aa  ATPG_BRUSU RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     5e-29  31%  292 aa  ATPG_BRUSI RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     5e-29  31%  292 aa  ATPG_BRUO2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     6e-29  34%  292 aa  ATPG_NAUPA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   61::386     6e-29  34%  386 aa  ATPG2_ARATH RecName: Full=ATP synthase gamma chain 2,
    1::294     1e-28  34%  294 aa  ATPG_RHIE6 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::283     1e-28  27%  287 aa  ATPG_WIGBR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     2e-28  29%  291 aa  ATPG_RHOP2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     2e-28  31%  290 aa  ATPG_BACFR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     3e-28  34%  293 aa  ATPG_DESVM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   51::371     3e-28  36%  373 aa  ATPG1_ARATH RecName: Full=ATP synthase gamma chain 1,
    1::294     4e-28  32%  294 aa  ATPG_RHILW RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    9::281     4e-28  32%  282 aa  ATPG_CLOAB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::293     9e-28  32%  293 aa  ATPG_RHISN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::294     9e-28  32%  294 aa  ATPG_RHIL3 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     9e-28  31%  292 aa  ATPG_BRUME RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     9e-28  31%  292 aa  ATPG_BRUMB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     9e-28  31%  292 aa  ATPG_BRUAB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     9e-28  31%  292 aa  ATPG_BRUA2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     9e-28  31%  292 aa  ATPG_BRUA1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::284     1e-27  36%  286 aa  ATPG_SOLUE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     1e-27  28%  291 aa  ATPG_RHOPS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::277     1e-27  31%  279 aa  ATPG_MYCPU RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::294     2e-27  32%  294 aa  ATPG_RHIME RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::294     2e-27  33%  294 aa  ATPG_PARL1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     3e-27  31%  291 aa  ATPG_SILST RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     3e-27  34%  292 aa  ATPG_PROA2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     5e-27  29%  290 aa  ATPG_AKKM8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   24::291     6e-27  31%  292 aa  ATPG_STRSY RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   24::291     6e-27  31%  292 aa  ATPG_STRS2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::281     6e-27  29%  283 aa  ATPG_CLOPS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::281     6e-27  29%  283 aa  ATPG_CLOPE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::281     6e-27  29%  283 aa  ATPG_CLOP1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::298     8e-27  28%  298 aa  ATPG_ZYMMO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     8e-27  32%  291 aa  ATPG_SINMW RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     1e-26  31%  290 aa  ATPG_DINSH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::296     2e-26  30%  296 aa  ATPG_METC4 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     2e-26  30%  289 aa  ATPG_AZOC5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::294     2e-26  28%  295 aa  ATPG_SULDN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::286     3e-26  30%  287 aa  ATPG_BACSU RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    6::291     3e-26  29%  292 aa  ATPG_ANATD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    7::288     4e-26  29%  291 aa  ATPG_AQUAE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   14::288     5e-26  29%  290 aa  ATPG_BUCSC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::293     5e-26  29%  293 aa  ATPG_AGRVS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     7e-26  28%  288 aa  ATPG_BLOPB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     9e-26  32%  290 aa  ATPG_MESSB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     9e-26  28%  291 aa  ATPG_BUCBP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::293     1e-25  30%  295 aa  ATPG_THETN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::294     1e-25  31%  294 aa  ATPG_RHILO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::319     1e-25  30%  320 aa  ATPG_LACAC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::300     1e-25  29%  301 aa  ATPG_HELP2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    7::290     1e-25  27%  291 aa  ATPG_PERMH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     2e-25  33%  293 aa  ATPG_CHLCH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::294     2e-25  28%  295 aa  ATPG_ARCB4 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     4e-25  30%  292 aa  ATPG_MAGSM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::300     4e-25  29%  301 aa  ATPG_HELPY RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::300     4e-25  29%  301 aa  ATPG_HELPG RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::283     6e-25  29%  287 aa  ATPG_PARD8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::281     6e-25  31%  283 aa  ATPG_CLOB8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   28::283     7e-25  32%  285 aa  ATPG_CLONN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::300     9e-25  29%  301 aa  ATPG_HELPJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::293     9e-25  30%  293 aa  ATPG_GLUDA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::308     9e-25  30%  308 aa  ATPG_BART1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::296     2e-24  29%  296 aa  ATPG_METEP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::319     2e-24  29%  320 aa  ATPG_LACH4 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::300     2e-24  28%  301 aa  ATPG_HELPS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::300     2e-24  28%  301 aa  ATPG_HELPH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::277     2e-24  26%  295 aa  ATPG_CAMC5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     2e-24  32%  290 aa  ATPG_BRAJA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     2e-24  28%  289 aa  ATPG_MYCS5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::300     3e-24  28%  301 aa  ATPG_HELAH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    3::297     4e-24  30%  298 aa  ATPG_WOLSU RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::283     4e-24  29%  286 aa  ATPG_MYCPE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::271     5e-24  27%  299 aa  ATPG_LACBA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    9::282     5e-24  29%  283 aa  ATPG_CLOK5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    9::282     5e-24  29%  283 aa  ATPG_CLOK1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     6e-24  30%  289 aa  ATPG_RHOSK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     6e-24  30%  289 aa  ATPG_RHOS1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     8e-24  30%  289 aa  ATPG_RHOS4 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     8e-24  30%  292 aa  ATPG_METS4 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::289     1e-23  34%  289 aa  ATPG_RHOS5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::276     1e-23  26%  294 aa  ATPG_NITSB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::294     2e-23  30%  294 aa  ATPG_CAUSK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     2e-23  34%  290 aa  ATPG_PARDP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::275     2e-23  29%  290 aa  ATPG_AMOA5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     3e-23  31%  292 aa  ATPG_AGRT5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::296     3e-23  31%  296 aa  ATPG_ACICJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    6::284     4e-23  31%  286 aa  ATPG_UREPA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    6::284     4e-23  31%  286 aa  ATPG_UREP2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     5e-23  29%  292 aa  ATPG_OCHA4 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::281     7e-23  30%  283 aa  ATPG_CLOBA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::277     7e-23  24%  295 aa  ATPG_CAMC1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::277     9e-23  31%  294 aa  ATPG_SPHWW RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::277     9e-23  27%  295 aa  ATPG_CAMFF RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::281     1e-22  30%  283 aa  ATPG_CLOBB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    6::284     2e-22  28%  286 aa  ATPG_UREU1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    6::305     2e-22  30%  306 aa  ATPG_PEDPA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::274     2e-22  33%  294 aa  ATPG_OPITP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::294     2e-22  26%  295 aa  ATPG_CLOTH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::278     2e-22  27%  296 aa  ATPG_CAMHC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     3e-22  26%  289 aa  ATPG_AZOPC RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    7::291     7e-22  25%  292 aa  ATPG_HYDS0 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::279     1e-21  30%  281 aa  ATPG_MESFL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    5::296     1e-21  26%  297 aa  ATPG_HELHP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::276     1e-21  26%  294 aa  ATPG_CAMLR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     3e-21  29%  292 aa  ATPG_HYPNA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::293     3e-21  30%  293 aa  ATPG_BEII9 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::302     4e-21  32%  303 aa  ATPG_OENOE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::302     4e-21  32%  303 aa  ATPG_OENOB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     8e-21  29%  287 aa  ATPG_WOLWR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     1e-20  25%  292 aa  ATPG_RHOPB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::278     1e-20  27%  280 aa  ATPG_MYCMS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::273     3e-20  32%  290 aa  ATPG_ERYLH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     7e-20  28%  290 aa  ATPG_WOLPM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     7e-20  25%  292 aa  ATPG_RHOP5 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::317     9e-20  27%  318 aa  ATPG_LACGA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::285     2e-19  28%  293 aa  ATPG_METI4 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     3e-19  26%  292 aa  ATPG_BRASB RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     3e-19  28%  290 aa  ATPG_WOLTR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::280     6e-19  27%  281 aa  ATPG_EHRCR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::291     8e-19  27%  291 aa  ATPG_XANP2 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::292     1e-18  26%  292 aa  ATPG_BRASO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     5e-18  27%  290 aa  ATPG_DICTD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::280     1e-17  25%  281 aa  ATPG_EHRCJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::276     4e-17  23%  294 aa  ATPG_CAMJE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::288     6e-17  25%  288 aa  ATPG_RICCK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    9::280     7e-17  29%  282 aa  ATPG_CLOBJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::271     9e-17  25%  288 aa  ATPG_RICTY RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::287     9e-17  26%  289 aa  ATPG_MYCGA RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   20::305     1e-16  28%  306 aa  ATPG_DICDI RecName: Full=ATP synthase subunit gamma,
    9::280     1e-16  29%  282 aa  ATPG_CLOBH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    9::280     1e-16  29%  282 aa  ATPG_CLOB1 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::276     2e-16  28%  280 aa  ATPG_MYCCT RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::282     2e-16  24%  283 aa  ATPG_EHRRG RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    9::280     2e-16  28%  282 aa  ATPG_CLOB6 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    9::280     2e-16  28%  282 aa  ATPG_CLOBL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    9::280     2e-16  28%  282 aa  ATPG_CLOBK RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::274     4e-16  29%  291 aa  ATPG_SPHAL RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    9::280     4e-16  28%  282 aa  ATPG_CLOBM RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::273     6e-16  29%  290 aa  ATPG_NOVAD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::219     8e-16  27%  288 aa  ATPG_RICPR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::96      1e-15  37%  287 aa  ATPG_HALOH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::276     1e-15  22%  294 aa  ATPG_CAMJR RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::276     1e-15  22%  294 aa  ATPG_CAMJ8 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    4::317     2e-15  26%  318 aa  ATPG_LACJO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::290     3e-15  30%  290 aa  ATPG_WOLPP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::276     3e-15  22%  294 aa  ATPG_CAMJJ RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::276     4e-15  22%  294 aa  ATPG_CAMJD RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::264     7e-15  25%  323 aa  ATPG_RICCN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::271     7e-15  33%  288 aa  ATPG_RICBR RecName: Full=ATP synthase gamma chain;AltName:
    1::282     7e-15  24%  283 aa  ATPG_EHRRW RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::264     9e-15  25%  323 aa  ATPG_RICRS RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::264     9e-15  25%  323 aa  ATPG_RICRO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::219     1e-14  26%  288 aa  ATPG_RICFE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   48::321     1e-14  28%  325 aa  ATPG3_ARATH RecName: Full=ATP synthase subunit gamma,
    1::264     2e-14  25%  323 aa  ATPG_RICAE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   25::297     2e-14  26%  298 aa  ATPG_MACFA RecName: Full=ATP synthase subunit gamma,
    1::301     2e-14  29%  303 aa  ATPG_ELUMP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   25::297     3e-14  25%  297 aa  ATPG_PONAB RecName: Full=ATP synthase subunit gamma,
    1::264     3e-14  26%  323 aa  ATPG_RICPU RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::133     3e-14  29%  288 aa  ATPG_RICAH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   25::297     3e-14  25%  298 aa  ATPG_MOUSE RecName: Full=ATP synthase subunit gamma,
   18::288     3e-14  25%  289 aa  ATPG_KLULA RecName: Full=ATP synthase subunit gamma,
   25::297     3e-14  25%  298 aa  ATPG_HUMAN RecName: Full=ATP synthase subunit gamma,
    1::288     6e-14  33%  288 aa  ATPG_RICB8 RecName: Full=ATP synthase gamma chain;AltName:
    1::96      8e-14  37%  286 aa  ATPG_MYCMO RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::277     8e-14  23%  279 aa  ATPG_MYCGE RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   51::324     2e-13  27%  326 aa  ATPG3_IPOBA RecName: Full=ATP synthase subunit gamma,
    1::272     2e-13  24%  273 aa  ATPG_RAT RecName: Full=ATP synthase subunit gamma,
   25::297     4e-13  25%  298 aa  ATPG_BOVIN RecName: Full=ATP synthase subunit gamma,
    1::287     5e-13  28%  289 aa  ATPG_BUCMH RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::97      3e-12  33%  287 aa  ATPG_MYCAP RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   26::296     1e-11  27%  297 aa  ATPG_DROME RecName: Full=ATP synthase subunit gamma,
    1::181     5e-11  28%  290 aa  ATPG_DICT6 RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
   34::310     9e-10  21%  311 aa  ATPG_YEAST RecName: Full=ATP synthase subunit gamma,
   32::301     2e-08  25%  301 aa  ATPG_SCHPO RecName: Full=ATP synthase subunit gamma,
    3::94      1e-06  38%  118 aa  ATPG_VIGUN RecName: Full=ATP synthase subunit gamma,
    1::269     3e-06  21%  279 aa  ATPG_MYCPN RecName: Full=ATP synthase gamma chain;AltName: Full=ATP
    1::325

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MATIRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQRVLERLASASSLDHPMLRER
ATPG_CORGB      MATIRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQRVLERLASASSLDHPMLRER
ATPG_CORGL      MATIRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQRVLERLASASSLDHPMLRER
ATPG_COREF      MANLRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQKVLERLASASSLDHPMLRER
ATPG_CORDI      MANLRELRDRIRSVNSTKKITKAQELIATSRITKAQARVEASQPYATEIHKVMERLAAASSLEHPMLRER
ATPG_CORJK      MASLRELRTRIKSVNSTKKITKAQELIATSRITKAQARVDDAEPYADEITRVVQRLAAASTLDHKILQEP
ATPG_CORU7      MANLRELRSRIKSVNSTKKITKAQELIATSRITKAQARVDASQPYAHEITKVIERLASASSLDHKMIREP
ATPG_NOCFA      MASLRELRSRIRGVNSIKKITKAQELIATSRISKAQARVAAAKPYAEEITKVLGELASASNLSHPLLTER
ATPG_RHOSR      MASILELRSRIKSVNSTKKITKAQELIATSRITKAQSRVAAAKPYAEEITKVXXXXXXXXXXDHPLLNER
ATPG_RHOOB      MASILELRSRIKSVNSTKKITKAQELIATSRITKAQSRVAAAKPYAEEITKVXXXXXXXXXXDHPLLNER
ATPG_SACEN      MAQLRELRNRIRSVKSTRKITKAQELIATSRIMKAQARVEASRPYADEITNVLTALADASTLDHPLLTER
ATPG_MYCVP      -ATLRELRGRIRSAGSIKKITKAQELIATSRIAKAQARVEAARPYSAEITSMLTELASASALDHPLLVAR
ATPG_MYCS2      -ATLRELRGRIRSAGSIKKITKAQELIATSRIAKAQARVEAARPYAAEITNMLTELAGASALDHPLLVER
ATPG_MYCTU      -ATLRELRGRIRSAGSIKKITKAQELIATSRIARAQARLESARPYAFEITRMLTTLAAEAALDHPLLVER
ATPG_MYCTA      -ATLRELRGRIRSAGSIKKITKAQELIATSRIARAQARLESARPYAFEITRMLTTLAAEAALDHPLLVER
ATPG_MYCBT      -ATLRELRGRIRSAGSIKKITKAQELIATSRIARAQARLESARPYAFEITRMLTTLAAEAALDHPLLVER
ATPG_MYCBP      -ATLRELRGRIRSAGSIKKITKAQELIATSRIARAQARLESARPYAFEITRMLTTLAAEAALDHPLLVER
ATPG_MYCBO      -ATLRELRGRIRSAGSIKKITKAQELIATSRIARAQARLESARPYAFEITRMLTTLAAEAALDHPLLVER
ATPG_STRGG      -AQLRVYKRRIQAVTATKKITKAMEMIAASRIVKAQRKVAASKPYATELTRAVTAVATGSNAKHPLTTEV
ATPG_STRAW      -AQLRVYKRRIRSVTATKKITKAMEMIAASRVVKAQRKVAASTPYATELTRAVTAVGTGSNTKHPLTTQA
ATPG_NOCSJ      --SLREYRARIKSTESMKKITRAMELIAASRIIKAQQRAQSAAPYARELTRAVSAVATYSNVDHPLTREP
ATPG_MYCGI      -ATLRELRGRIRSAGSIKKITKAQELIATSRIAKAQARVEAARPYSTEITSMLTELASASALDHPLLVAR
ATPG_STRCO      -AQLRVYKRRIRSVTATKKITKAMEMIAASRVVKAQRKVAASTPYARELTRAVTAVGTGSNTKHPLTTEA
ATPG_MYCMM      -ATLRELRGRIRSAGSIKKITKAQELIATSRIARAQARLESARPYADQITQMXXXXXXXXXXXHPLLVEH
ATPG_MYCA9      -AQIRELRRRIKSAGAIKKITKAQELIATSRIAKAQARVVAARPYATEITNVLTXXXXXXXXXXXXXVER
ATPG_STRLI      -AQLRVYKRRIRSVTATKKITKAMEMIAASRVVKAQRKVAASTPYAREL--TLPRLGTGSNTKHPLTTEA
ATPG_MYCLE      -ATLRELRGRIRSVGSIKKITKAQELIATSRIARAQVRLESARPYAVDITRMLTTLAYEAVLDHPLLVAS
ATPG_MYCLB      -ATLRELRGRIRSVGSIKKITKAQELIATSRIARAQVRLESARPYAVDITRMLTTLAYEAVLDHPLLVAS
ATPG_MYCSS      -ATLRELRGRIRSAGSIKKITKAQEMIATSRIAKAQARVEAARPYDREITNMLTELATASALDHPLLVQR
ATPG_MYCSK      -ATLRELRGRIRSAGSIKKITKAQEMIATSRIAKAQARVEAARPYDREITNMLTELATASALDHPLLVQR
ATPG_MYCSJ      -ATLRELRGRIRSAGSIKKITKAQEMIATSRIAKAQARVEAARPYDREITNMLTELATASALDHPLLVQR
ATPG_KINRD      ---LRAYRRQIRSVQATKKITRAMELIAASRIIKAQANVRASTPYXXXXXXXXXXXXXNSSLDHPLITEK
ATPG_MYCUA      -ATLRELRGRIRSAGSIKKITKAQELIATSRIARAQARLESARPYADQITQMXXXXXXXXXXXHPLLVEH
ATPG_PROAC      -SNLRELRERRNSVATTKKITRAMELIASSRIIKAQNTVKAAGPYSLELTRALSAVAAHTHEEHPLTSMN
ATPG_ARTS2      -AQIRVYRQKISSTTSMRKIFKAMELIATSRIGKARARVAASLPYANAITRAVSAVASQSEIDHPLVTEP
ATPG_ACIC1      ---------------ATAKITRAMELIAASRIVKAQQRVVASTPYAEAITRAVSAVASQSNVDHPLLTER
ATPG_MYCPA      -ATLRELRGRIRSAGSIKKITKAQELIATSRIGRAQARLDSARPYAFQIXXXXXXXXXXXXXDHPLLVER
ATPG_MYCA1      -ATLRELRGRIRSAGSIKKITKAQELIATSRIGRAQARLDSARPYAFQIXXXXXXXXXXXXXDHPLLVER
ATPG_FRASC      ---LREYRRRIRSVQSTKKITRAMELIXXXXXXXXXXXXXXXXXXXEEITRVIEAVAAQTTIDHPLTTER
ATPG_FRASN      ---LREYRRRIKTVQSTKKITKAMELXXXXXXXXXXXXXXXXXPYAEEITRVISAVASQTTIAHPLTTER
ATPG_LEIXX      -AQLRVYRQKIKSAHRTKKITRAMELISASRIQKEQARVAASSPYARAITRAVSAVATYSNVGHVLTTEP
ATPG_SALTO      -AQVRVLRQRIRAAKSMKKITKAMELVATSRIAKAQEQVAASLPYSRAITEVLTALASNTRIDHPLLTPR
ATPG_SALAI      -AQVRVLRQRIRTAKSMKKITKAMELVATSRIAKAQDQVAASLPYARAITEVLTALASNARIDHPLLTPR
ATPG_ARTAT      -AQIRVYRQKISSTTSMRKIFKAMELIATSRIGKARARVAASLPYANAITRAVSAVATQSEIDHPLTTEP
ATPG_MICLC      -AQIRVYRQKIASTSSMRKIFKAMELIATSRITKARERVSASLPYANAITRAVSAVSSQHDIDHVLTTEP
ATPG_BEUC1      ----RVYKQRIRSTQTLKKMFRAMELIAASRITRAREHARAAAPYSRALTRAVSAVATHTQIDHPLTTDR
ATPG_ARTCA      -AQIRVYRQKISSTTSMRKIFKAMELIATSRIGKARARVAASLPYANAITRAVSAVASQSEIDHPLTTEP
ATPG_BIFAA      ------LKSRIASTASLEKIFNAQEMIASSHIAKARDVALNAKPYTDAIFDAVQALVAHTHIDHPIVKKN
ATPG_THEFY      -AQLRVYRRRIRSTKSMAKITRAMELIAATRITKXXXXXXXXXXXXREITXXXXXXXXXXX-DHPLLTEA
ATPG_CLAMS      -AQLRVYTQKIKSAQTTKKITRAMELISASRIQKAQQRMAASAPYXXXXXXXXXXXXXFSNVDHILTTEP
ATPG_BIFLI      ------LKSRIHSTESLAKIFNAQEMIASSHIAKARDVALNAKPYSDAIFDAVQALVAHTHITHPIAVKD
ATPG_BIFLO      ------LKSRIRSTESLAKIFNAQEMIASSHIAKARDVALNAKPYTDAIFDAVQALVAHTHITHPIAVKD
ATPG_BIFLD      ------LKSRIRSTESLAKIFNAQEMIASSHIAKARDVALNAKPYTDAIFDAVQALVAHTHITHPIAVKD
ATPG_BIFA0      MASQLALKSRIASTGSLEKIFNAQEMIAASHIAQARQLALDSKPYTDAIFDAVQTLVSHTHISHPIVKKD
ATPG_CLAM3      -AQLRVYTQKIKSAQTTKKITRAMELISASRIQKAQQRMAASAPYXXXXXXXXXXXXXFSNVDHILTTEP
ATPG_EXISA      MASLREIQMRITSTQSTKQITKAMNMVSASKLNRAQGNNANFKPYMDKLQEVISSIAGGTSATHPMLQVR
ATPG_RENSM      -AQLRVYRQRIKSTQSMGKLFKAMELIATSRISKARSRVQASLPYANAITRAVSVVASQSEIHHPLTTEP
ATPG_DESRM      MASARDLRRRIKSVKSTQQITKAMKMVAAAKLRRAQEAVEAARPFALKIKDVLSRVAAASGASHPLLEER
ATPG_OCEIH      MASLRELKGRIESTKKTKQITGAMQLVSASKMSKAEQNARGFVPYADKLQEVVSSIANANTAQHPMLMKR
ATPG_STRM5      MASGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQDRMKTSRPYAQAMKQVIGHLAQASTYQHPFLVER
ATPG_STAES      MASLKEIDSRIKSTSKMKQITKAMNMVSSSKLRRAEKNTKSFRPYMEKMQDAITAVAGSNSTNHPMLKSR
ATPG_STAEQ      MASLKEIDSRIKSTSKMKQITKAMNMVSSSKLRRAEKNTKSFRPYMEKMQDAITAVAGSNSTNHPMLKSR
ATPG_STAAW      MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGASSTNHPMLRPR
ATPG_STAAT      MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGASSTNHPMLRPR
ATPG_STAAS      MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGASSTNHPMLRPR
ATPG_STAAR      MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGASSTNHPMLRPR
ATPG_STAAN      MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGASSTNHPMLRPR
ATPG_STAAM      MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGASSTNHPMLRPR
ATPG_STAAE      MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGASSTNHPMLRPR
ATPG_STAAC      MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGASSTNHPMLRPR
ATPG_STAA9      MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGASSTNHPMLRPR
ATPG_STAA2      MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGASSTNHPMLRPR
ATPG_STAA1      MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGASSTNHPMLRPR
ATPG_STAHJ      MASLKEIDGRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFEPYMEKMQDAITAIAGASNSSHPMLRPR
ATPG_STAAB      MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGASSTNHPMLRPR
ATPG_RUBXD      MASLRDLKRQIQSVKNIAKVTDALQAVSAVKFRKAEARVKQARPYAENMEEVMRAIASKASTRNPMLAGR
ATPG_LEGPL      MAGAKEIRSKISSINKTRKITRAMEMVAASKMRKTQERMRASKPYANKIYEVIKHIAAASEYRHPFMSER
ATPG_LEGPH      MAGAKEIRSKISSINKTRKITRAMEMVAASKMRKTQERMRASKPYANKIYEVIKHIAAASEYRHPFMSER
ATPG_LEGPC      MAGAKEIRSKISSINKTRKITRAMEMVAASKMRKTQERMRASKPYANKIYEVIKHIAAASEYRHPFMSER
ATPG_LEGPA      MAGAKEIRSKISSINKTRKITRAMEMVAASKMRKTQERMRASKPYANKIYEVIKHIAAASEYRHPFMSER
ATPG_PROMH      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKTQERMAASRPYAETMRSVIGHLALGNEYKHPYLEER
ATPG_PSEAE      MAGAKEIRSKIASIKSTQKITNAMEKVAVSKMRKAQMRMAAGRPYAERIRQVIGHLANANEYRHPFMVER
ATPG_PSEAB      MAGAKEIRSKIASIKSTQKITNAMEKVAVSKMRKAQMRMAAGRPYAERIRQVIGHLANANEYRHPFMVER
ATPG_PSEA8      MAGAKEIRSKIASIKSTQKITNAMEKVAVSKMRKAQMRMAAGRPYAERIRQVIGHLANANEYRHPFMVER
ATPG_PSEA7      MAGAKEIRSKIASIKSTQKITNAMEKVAVSKMRKAQMRMAAGRPYAERIRQVIGHLANANEYRHPFMVER
ATPG_PSYWF      MASLKEIRAKVTSIKSTQKITRAMQMVAASKMRRAQERMEVGRPYAESMRRVVSHLVNASSYKHPYMTNR
ATPG_KOCRD      -AQIRVYRQKIASTSSMKKIFKAMEMIATSRINKSRQALEGAYPYANALTRAASQIATQHNISHPLTTVP
ATPG_STRMK      MASGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQDRMKTSRPYAQAMKQVIGHLAQASTYQHPFLVER
ATPG_STACT      MGSLKDIDSRIKSTKKMNQITKAMNMVASSKLNKAQRNSNQFKPYMDKLQNAITAVAGQTTSNHPMLVER
ATPG_PSYCK      MANLKEIRAKVTSIQSTQKITRAMQMVAASKMRRAQERMEVGRPYADSMRRVISHLVHASSYKHPYMVSR
ATPG_PSEU5      MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLAYANEYRHPFMVER
ATPG_AZOVD      MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQLRMAASRPYAERIRQVIGHLAKANEYKHPFMVER
ATPG_SYNP6      MANLKAIRDRIKSVRNTRKITEAMRLVAAAKVRRAQEQVLSTRPFADRLAQVLAGLQQRENVDLPLLQRR
ATPG_SYNE7      MANLKAIRDRIKSVRNTRKITEAMRLVAAAKVRRAQEQVLSTRPFADRLAQVLAGLQQRENVDLPLLQRR
ATPG_MARMS      MAVGKEIRTQISSINNTRKITRAMEKVAASKTRKAQDRMAASRPYAERIRQVVGHLANANEYKHRYLTER
ATPG_PSYA2      MASLKEIRAKVTSIKSTQKITRAMQMVAASKMRRAQERMEVGRPYADSMRRVISHLVHASSYKHPYMVNR
ATPG_HAEIN      MAGAKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKASGYKHPFLVER
ATPG_HAEIE      MAGAKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKASGYKHPFLVER
ATPG_PSEF5      MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLANANEYRHPFMIDR
ATPG_HAEIG      MAGAKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKASGYKHPFLVER
ATPG_SHEPW      MANAKEIKTKIASVQNTQKITSAMEMVAASKMRKAQDRMASSRPYAENMRKVIGHVAQGSEYKHPYLEVR
ATPG_HAHCH      MAVGKEIKTQIASIKSTQKITSAMQLVAASKMRKAQQRMAAGRPYADRIRSVISHIATANEYRHLYLQER
ATPG_DEHSC      MANLRIIKRRIRSVRNIAKITRAMEMIAASKMKKAQERGLAGRPYSEKITEVIAALAASGEILHPLL-ER
ATPG_SYNP2      MPNLKGIRDRIQSVKNTKKITEAMRLVAAAKVRRAQEQVTSTRPFANTLLQVLYSLKSRLRLDLPLLKQR
ATPG_PSEPK      MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLANANEYRHPFMIER
ATPG_PSEP1      MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLANANEYRHPFMIER
ATPG_PSEFS      MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLANANEYRHPFMIER
ATPG_SHELP      MAGAKEIKTKIASVQNTQKITSAMEMVAASKMRKAQDRMAASRPYAENMRKVIGHVAQGSEYKHPYLEVR
ATPG_PSEPF      MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLANANEYRHPFMIDR
ATPG_ERWCT      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETIRNVIGHLALGNEYKHPYLEER
ATPG_ACIBY      MANLKEIRAKVASIKSTQKITRAMQMVAASKMRRAQERMAQGRPYADNMRRVIAHLVQANEYKHRYMVDR
ATPG_ACIBT      MANLKEIRAKVASIKSTQKITRAMQMVAASKMRRAQERMAQGRPYADNMRRVIAHLVQANEYKHRYMVDR
ATPG_ACIBS      MANLKEIRAKVASIKSTQKITRAMQMVAASKMRRAQERMAQGRPYADNMRRVIAHLVQANEYKHRYMVDR
ATPG_ACIBC      MANLKEIRAKVASIKSTQKITRAMQMVAASKMRRAQERMAQGRPYADNMRRVIAHLVQANEYKHRYMVDR
ATPG_ACIB3      MANLKEIRAKVASIKSTQKITRAMQMVAASKMRRAQERMAQGRPYADNMRRVIAHLVQANEYKHRYMVDR
ATPG_SHEWM      MANAKEIKTKIASVQNTQKITSAMEMVAASKMRKAQDRMASSRPYAENMRKVIGHVAQGSEYKHPYLEVR
ATPG_LYSSC      MVNLREIKGRINSTKSTKQITKAMQMVSSSKLRRAEQNAKAYVPYMEKIQDVVGAIASGTKSGHPMLTAR
ATPG_ACIAD      MANLKEIRAKVASIKSTQKITRAMQMVAASKMRRAQERMAQGRPYADNMRRVIAHLVQANEYKHRYMVDR
ATPG_XANCP      MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMKQVIGHLAQASTYQHPFLVER
ATPG_XANCB      MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMKQVIGHLAQASTYQHPFLVER
ATPG_XANC8      MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMKQVIGHLAQASTYQHPFLVER
ATPG_SHESR      MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQDRMAASRPYAESMRKVIGHVAQGSEYKHPYLEVR
ATPG_SHESM      MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQDRMAASRPYAESMRKVIGHVAQGSEYKHPYLEVR
ATPG_PSEPW      MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLANANEYRHPFMIER
ATPG_PSEMY      MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQQRMAAGRPYAERIRQVIGHLAKANEYRHSFMVER
ATPG_SHESA      MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAESMRKVIGHVAQGSEYKHPYLEVR
ATPG_SHEPA      MANAKEIKTKIASVQNTQKITSAMEMVAASKMRKAQDRMAASRPYAENMRKVIGHVAQGSEYKHPYLEVR
ATPG_SALTY      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNEYKHPYLEER
ATPG_SALSV      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNEYKHPYLEER
ATPG_SALPC      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNEYKHPYLEER
ATPG_SALPB      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNEYKHPYLEER
ATPG_SALNS      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNEYKHPYLEER
ATPG_SALHS      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNEYKHPYLEER
ATPG_SALG2      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNEYKHPYLEER
ATPG_SALEP      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNEYKHPYLEER
ATPG_SALDC      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNEYKHPYLEER
ATPG_SALCH      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNEYKHPYLEER
ATPG_SALAR      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNEYKHPYLEER
ATPG_SALA4      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNEYKHPYLEER
ATPG_PSEPG      MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRRAQLRMAASRPYAERIRQVIGHLANANEYRHPFMIER
ATPG_KLEP3      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYADTMRKVIGHLANGNEYKHPYLEER
ATPG_HAEI8      MAGAKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKASGYKHPFLVEC
ATPG_BACHD      MASLRDIKQRINSTKKTKQITKAMEMVSAAKLNRSQEKAQSFLPYTDKIREVVASIAASDTVSHPMLEER
ATPG_XANC5      MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMKQVIGHLAQASTFQHPFLVER
ATPG_STAS1      MGSLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAESNAKQFRPYMEKMQDAITAVASDKNSRHPMLQQR
ATPG_SHESH      MANAKEIKTKIASVKNTQKITSAMEMVAASKMRKAQDRMAASRPYAENMRKVIGHVAQGSEYKHPYLEVR
ATPG_SALPK      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNEYKHPYLEER
ATPG_SALPA      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNEYKHPYLEER
ATPG_PSEE4      MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLANANEYRHPFMIER
ATPG_HELMI      ----------------TQQITKAMKMVAAAKLRKAQEKVIQARPYAKRIQGVLSRLAAASDVNHPLLTTR
ATPG_HALHL      MAGAKEVKTKIKSVQNTQKITSAMEMVAASKMRRAQERMEATRPYAEKIRQVIGHLGHANDYRHPFLVER
ATPG_ENTS8      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYADTMRKVIGHLATGNEYKHPYLEER
ATPG_CHRSD      MAAAKEIRTQIGSIKNTQKITSAMEMVAASKMRKAQERMTASQPYARLIRRVVSHIAKANEYRHEYMIER
ATPG_VIBVY      MAGAKEIRSKIGSVKSTQKITKAMEMVAASKMRRSQDAMEASRPYAETMRKVIGHVANASEYRHPYLDER
ATPG_VIBVU      MAGAKEIRSKIGSVKSTQKITKAMEMVAASKMRRSQDAMEASRPYAETMRKVIGHVANASEYRHPYLDER
ATPG_THISH      MAGAKEIRTQIKSIKNTQKITKAMEMVAASKMRKAQDRMLATRPYAEKIRQVIGHVAMAAEYKHPYLEER
ATPG_XANOR      MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMKQVIGHLAQASTFQHPFLIER
ATPG_XANOP      MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMKQVIGHLAQASTFQHPFLIER
ATPG_XANOM      MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMKQVIGHLAQASTFQHPFLIER
ATPG_VIBAL      MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQDAMEASRPYAETMRKVIGHVANANEYRHPYLEER
ATPG_NITEU      MPSSREIRNKIKSVKNTQKITRAMEMVAASKMRKAQDRMKKARPYGEKIRNVAAHMSNASEYRHPFLISR
ATPG_XANAC      MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMKQVIGHLAQASTFQHPFLIER
ATPG_SHEB9      MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAESMRKVIGHVAQGSEYKHPYLEVR
ATPG_SHEB8      MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAESMRKVIGHVAQGSEYKHPYLEVR
ATPG_SHEB5      MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAESMRKVIGHVAQGSEYKHPYLEVR
ATPG_SHEB2      MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAESMRKVIGHVAQGSEYKHPYLEVR
ATPG_MACCJ      MASLRDIKGRINSTKKTSQITKAMHMVSNSKLRRAEENAKSFYPYMEKMQDAVTAIGGSNSANHPMLQKR
ATPG_KLEP7      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYADTMRKVIGHLANGNEYKHPYLEER
ATPG_YERPY      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLALGNEYKHPYLEER
ATPG_YERPS      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLALGNEYKHPYLEER
ATPG_YERPP      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLALGNEYKHPYLEER
ATPG_YERPN      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLALGNEYKHPYLEER
ATPG_YERPG      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLALGNEYKHPYLEER
ATPG_YERPE      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLALGNEYKHPYLEER
ATPG_YERPB      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLALGNEYKHPYLEER
ATPG_YERPA      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLALGNEYKHPYLEER
ATPG_YERP3      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLALGNEYKHPYLEER
ATPG_YERE8      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLALGNEYKHPYLEER
ATPG_PSEU2      MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLANANEYRHPFMIER
ATPG_PSE14      MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLANANEYRHPFMIER
ATPG_MYXXD      MASLRDIRKRIRSVKNTRQITKAMKMVSAAKLRKAQDGILAARPYATMLDQIIADLSARASLSHPLLTAR
ATPG_MANSM      MASGKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKASGYKHPFLVER
ATPG_BACHK      MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKINHPMLNAR
ATPG_BACCZ      MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKINHPMLNAR
ATPG_BACCR      MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKINHPMLNAR
ATPG_BACC7      MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKINHPMLNAR
ATPG_BACC4      MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKINHPMLNAR
ATPG_BACC3      MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKINHPMLNAR
ATPG_BACC1      MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKINHPMLNAR
ATPG_BACC0      MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKINHPMLNAR
ATPG_BACAN      MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKINHPMLNAR
ATPG_BACAH      MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKINHPMLNAR
ATPG_BACAC      MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKINHPMLNAR
ATPG_BACAA      MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKINHPMLNAR
ATPG_SERP5      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRKVIGHLALGNEYKHPYLDER
ATPG_BACWK      MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKINHPMLNSR
ATPG2_PHOPR     MANAKEIRTKIASVQNTQKITSAMEMVAASKMRKVQDNMAATRPYAENMRKVISHVASGSEYKHPYLEER
ATPG_VIBPA      MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQDAMEASRPYAETMRKVIGHVANANEYRHPYLEER
ATPG_TRIEI      MPNLKAIRDRIKSIKNTKKITEAMRLVAAAKVRRAQEQVIGTRPFADRLAQVLYGLAERESLDLPLLQKR
ATPG_SALTI      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNEYKHPYLEER
ATPG_METFK      MAGSKEIRSKIKSVENTRKITKAMEMVAASKMRKAQERMRMARPYAEKIRNVTAHLSHANSYKHPFVVKR
ATPG_PSESM      MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLANANEYLHPFMIER
ATPG_RALEH      MAGTKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRSARPYAEKVRNIAAHLATANEFKHPFMQER
ATPG_GEMAT      MAKGKELKGRIRSTENTRKITRTMEMVATSKLKRATDRVAAARPYALALGEVLSHVYSPEXXXXXXXXXX
ATPG_BACCN      MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKINHPMLTAR
ATPG_ALCBS      MASGKEIKGKIASVQSTKKITRAMEMVAASKMRKAQERMTASKPYASRMRQVVAHLANADEYRHVYLQER
ATPG_NITMU      MAGSREIRNKIKSVKNTQKITRAMEMVAASKMRRAQERMKKARPYGEKIRNVAAHMSRATEYRHPFLIER
ATPG_ACTSZ      MASGKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKASGYKHPFLMER
ATPG_SYNP1      MPNLKAIRDRIKTIKDTRKITEAMRLVAAAKVRRAQEQVMASRPFADRLAQVLYGLQTRLRFEDPLLAKR
ATPG_SHEON      MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAESMRKVIGHVAQGSEYKHPYLEVR
ATPG_CYAP4      MANLKSIRDRIQSVKNTQKITEAMRLVAAAKVRRAQEQVIATRPFADRLAQVLYGLQARLRFEEPLLRRR
ATPG_SYNFM      MATLRDIKRKIDAVKKTSQITKAMNMVAAAKLRGAQQNMERFHPYAEKFNEVIERLAEGDAGQYVLLTPR
ATPG_SHEHH      MANAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQDRMAASRPYAENMRKVIGHVAQGSEYKHPYLEVR
ATPG_SHEAM      MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQDRMTASRPYAESMRKVIGHVAQGSEYKHPYLEVR
ATPG_NITEC      MASSREIRNKIKSIKNTQKITRAMEMVAASKMRKAQDRMKKARPYGEKIRNVAAHMSKASEYRHPFLIDR
ATPG_CUPTR      MAGTKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRNARPYAEKVRNIAAHLATANEFKHPFMQER
ATPG_HAES1      MAGAKEIRTKISSVQSTQKITKAMEMVAASKMRKTQDRMSSSRPYSKAIQGVISHISKANDYQHPFLIER
ATPG_ALHEH      MSGAKEVRTKIKSVQNTQKITKAMEMVAASKMRRAQERMEATRPYAQKMRQVIGHLAGANDYRHPFLEER
ATPG_SHEFN      MASAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAENMRKVIGHVAQGTEYKHPYLEVR
ATPG_COLMA      MAVGKEIKTKIASVKGTQKITSAMEMVAASKMRKAQEGMAASRPYATNIRNVIGHIALGNEYRHPYMDER
ATPG_BACP3      LASLRDIKTRINATKKTSQITKAMEMVLTSKLNRAEKR-EIVRPYMEKIQEVVANVALAARASHPMLVSR
ATPG_PROMO      MAAGKEIKSRISSVQSTRQITKAMEIVSSTKFKKFQALVNQSKPYSGSMDKVLANLAAGIKNEHPLFDGK
ATPG_MARAV      MAVGKEIRNQIGSIKSTQKITSAMEMVAASKMRKAQERMQATRPYAEKMRQVIGHIAKSNKYRHPFMQER
ATPG_ERWT9      MAGAKEIRSKIGSVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRKVIGHIALGNEYKHPYLDER
ATPG_RALSO      MAGTKEIRTKIKSVQNTRKITKAMEMVAASKMRRAQERMRSARPYAEKIRNVAAHMAQANEYQHPFMVKR
ATPG_PHOLL      MAGAKEIRTKIASVQNTQKITKAMEMVAASKMRKTQDRMAASRPYAETIRSVIGHLALGNEYKHPYLEER
ATPG_GEOSW      MASLRDIKKRINATKKTSQITKAMEMVSASKLNRAEMNAKSFVPYMDKMQEVVANIAGAGNATHPMLVTR
ATPG_GEOSM      MANLKSIKKRIVSVKNTRQITKAMKMVSAAKLRRAQENVVAARPYAGKLAEVLERLAKTQESDASPLMVK
ATPG_SHESW      MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAESMRKVIGHVAQGSEYKHPYLEVR
ATPG_SHEPC      MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAESMRKVIGHVAQGSEYKHPYLEVR
ATPG_SHEDO      MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAESMRKVIGHVAQGSEFKHPYLEVR
ATPG_HAES2      MAGAKEIRTKISSVQSTQKITKAMEMVAASKMRKTQDRMSSSRPYSKAIQGVISHISKANDYQHPFLIER
ATPG_RALEJ      MAGTKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRNARPYAEKVRNIAAHLASANEFKHPFMQER
ATPG_COLP3      MAVGKEIKTKIASVKNTQKITSAMEMVAASKMRKAQEGMAASRPYATNIRNVIGHIALGNEYRHPYMEER
ATPG_VIBF1      MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQESMEASRPYADTMRKVIGHLALGNEYRHPYLEER
ATPG_HAEDU      MAGAKEIRTKIASVRNTQKITKAMEMVATSKMRKTQERMAAGRPYSETIRKVISHIAKGSGYKHPFLIER
ATPG_BREBN      ---IREIRRSIKSKKDMRQITKAMKMVAAAKLRRNQDKAEAARPYADKIQEVIASIASGTSSKHPMLQNR
ATPG_VIBFM      MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQESMEASRPYADTMRKVIGHLALGNEYRHPYLEER
ATPG_LISW6      MASLIDIKQRITSTRKTSQITKAMQMVSAAKLGRAESNARSYEPYVSKIKDVVTHVASTNSNDHPMLVSR
ATPG_LISMO      MASLIDIKQRITSTRKTSQITKAMQMVSAAKLGRAESNARSYEPYVSKIKDVVTHVASTNSSDHPMLVSR
ATPG_LISMH      MASLIDIKQRITSTRKTSQITKAMQMVSAAKLGRAESNARSYEPYVSKIKDVVTHVASTNSSDHPMLVSR
ATPG_LISMF      MASLIDIKQRITSTRKTSQITKAMQMVSAAKLGRAESNARSYEPYVSKIKDVVTHVASTNSSDHPMLVSR
ATPG_LISMC      MASLIDIKQRITSTRKTSQITKAMQMVSAAKLGRAESNARSYEPYVSKIKDVVTHVASTNSSDHPMLVSR
ATPG_LISIN      MASLIDIKQRITSTRKTSQITKAMQMVSAAKLGRAESNARSYEPYVSKIKDVVTHVASTNSSDHPMLVSR
ATPG_LEPIC      MATPREIKKRINSVKNTRKITRTMEMVSTAKSKKISDRVNASHPFSNKIKELVSSLASLGGVVHPYLRRP
ATPG_CHLAD      MASSREIKRRIRSVKNVAQITRAMEMVSASKMRRAQRNVLATRPYADRMREVMANLTAGAARRGTLLEKR
ATPG_ACTPJ      MAGAKEIRTKIASVKNTQKITKAMEMVATSKMRKTQERMAASRPYSETIRKVISHIAKGSGYKHPFLTER
ATPG_RUTMC      MAAGKEIRTQISSIKNTQKITSAMEMVAASKMKKAQDRMLASRPYCEKISNVIGHLAYASEFEYSYMNSS
ATPG_PASMU      MAGAKEIRTKIASVKSTQKITKAMEMVAASKMRKTQERMSSSRPYSETIRNVISHVSKATGYKHPFLVDR
ATPG_DIAST      MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQDRMRAARPYAEKVRNIAAHLGEANEYVHPFMKAN
ATPG_ACISJ      MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQDRMRAARPYAEKVRNIAAHLGEANEYVHPFMKAN
ATPG1_PHOPR     MASAKEIRNKIGSVQNTQKITKAMEMVAASKMRKTQDAMESSRPYAETMRKVIGHIALGNEYKHPYLEVR
ATPG_VIBCM      MAGAKEIRTKIGSVKSTQKITKAMEMVAASKMRRSQDAMESSRPYAQTIRKVIGHVANASEYRHPYLEER
ATPG_VIBCH      MAGAKEIRTKIGSVKSTQKITKAMEMVAASKMRRSQDAMESSRPYAQTIRKVIGHVANASEYRHPYLEER
ATPG_VIBC3      MAGAKEIRTKIGSVKSTQKITKAMEMVAASKMRRSQDAMESSRPYAQTIRKVIGHVANASEYRHPYLEER
ATPG_CHLSY      MPSSREIKRRIRSVKNVAQITRAMEMVSASKMRRAQRNVLATRPYADRMREVMANLTAGAARRGTLLEKR
ATPG_CHLAA      MPSSREIKRRIRSVKNVAQITRAMEMVSASKMRRAQRNVLATRPYADRMREVMANLTAGAARRGTLLEKR
ATPG_RALME      MAGTKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRNARPYAEKVRNIAAHLASANEFKHPFMVAR
ATPG_ALISL      MAGAKEIRSKIGSVKSTQKITKAMEMVAASKMRRSQESMAASRPYADTMRKVIGHLALGNEYRHPYLEER
ATPG_AERS4      MAGAKEIRNKIGSVKNTQKITGAMEMVAASKMRRAQERMSASRPYAETMRKVIGHIAQGNEYKHPYLMER
ATPG_AERHH      MAGAKEIRNKIGSVKNTQKITGAMEMVAASKMRRAQDRMSASRPYAETMRKVIGHIAQGNEYKHPYLIER
ATPG_GEOBB      MANLKSIKKRIVSVKNTRQITKAMKMVSAAKLRRAQENVVAARPYAGKLAEVLERLAKTQESDASPLMVK
ATPG_CHRVO      MAVGKEILTKIRSVQNTQKITRAMQMVSTSKMRKTQERMRAARPYAEKVRTVMAHLAQANALGHPLLARR
ATPG_ACTP7      MAGAKEIRTKIASVKNTQKITKAMEMVATSKMRKTQERMAASRPYSETIRKVISHIAKGSGYKHPFLTER
ATPG_ACTP2      MAGAKEIRTKIASVKNTQKITKAMEMVATSKMRKTQERMAASRPYSETIRKVISHIAKGSGYKHPFLTER
ATPG_THIDA      MAAGKEIRTKIKSVENTRKITKAMEMVAASKMRKAQDRMKAARPYAEKIARVATHLAYAPEYKHPFVIAR
ATPG_RALPJ      MAGTKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRAARPYAEKIRNVAAHMALANEYKHPFMVAR
ATPG_EDWI9      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKTQDRMAASRPYAETMRKVIGHLALGNEYKHPYLEER
ATPG_JANMA      MASGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQDRMHAARPYSDKIRNIAANLSQANEYTHPFLVKS
ATPG_BACSK      MASLRDIKNRINSTKKTRQITKAMQMVSAAKLNRAQEKAQSYEVYAKKMREVVGNIAQAGSTSHPMLEER
ATPG_TERTT      MASGKEIRTKIGSIKNTQKITSAMEMVAASKMRKAQDRMEVGKPYARRMREVVGHIAAGNEYQHLYITER
ATPG_XYLFT      MASGREIKSKIKSVQNTRKVTRALEMVSASKIRKAQEQMKISRPYAQAMKQMIGHLAQANTYLHPFLIAH
ATPG_XYLFM      MASGREIKSKIKSVQNTRKVTRALEMVSASKIRKAQEQMKISRPYAQAMKQMIGHLAQANTYLHPFLIAH
ATPG_XYLF2      MASGREIKSKIKSVQNTRKVTRALEMVSASKIRKAQEQMKISRPYAQAMKQMIGHLAQANTYLHPFLIAH
ATPG_METCA      MAVGKEIRIKIASVRNTQKITRAMEMVAASKMRRTQDRLQATRPYARKIARIIKHLAQANEYKNPFMVER
ATPG_MOOTA      MAHMRDLKRRIRSVQSTQHITRAMKMVAAAKLRKAQAQVTAARPYAAKLEEVVGRLMAAVDPETQPLAAT
ATPG_SYMTH      ----KAVQRRIRAVKSTQQITKAMKMVDAAKLRRAQEKVQNARPYSRELAKTLGRLIQAGAIDHPLLHRR
ATPG_METPP      MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQERMRAARPYADKIRNITANLAQANEYTHPMAVSA
ATPG_HAEPS      MAGAKEIRTKIASVRNTQKITKAMEMVAASKMRKTQERMSASRPYSDAIRKVISHIAKGSDYKHPFLTER
ATPG_BORPD      MPGIKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQDRMRAGRPYATKVREIAAHLMQANEYSHPYLVER
ATPG_ANAD2      MPSLRDIRNRIGSVRSTRQITKAMKMVSAAKLRRAQDAVLKTRPYAVLLDQTLSRLXXXXXXEHPLLAPR
ATPG_SYNY3      MPNLKAIRDRIQSVKNTKKITEAMRLVAAAKVRRAQEQVLSTRPFADALAQVLYNLLSFAETELPLFEQR
ATPG_ECO55      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEER
ATPG_ECO24      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEER
ATPG_BORPE      MPGIKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRAGRPYATKVREIAAHLMQANEYSHPYLVER
ATPG_BORBR      MPGIKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRAGRPYATKVREIAAHLMQANEYSHPYLVER
ATPG_GEOKA      MASLRDIKTRINATKKTSQITKAMEMVSTSKLNRAEQNAKSFVPYMEKIQEXXXXXXXXXXXSHPMLVSR
ATPG_BORPA      MPGIKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRAGRPYATKVREIAAHLMQANEYGHPYLVER
ATPG_BACPF      MASLRDIQGRXXXXXXXXXXXXAMQMVSAAKLNRAQHNAQSFTPYTDKIREVVAAIASSGTISHPMLEER
ATPG_ACIAC      MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQDRMRAARPYSEKIRNIAANLGQANEYVHPFMKSN
ATPG_XYLFA      MASGREIKSKIKSVQNTRKVTRALEMVSASKIRKAQEQMKISRPYAQAMKQMTGHLAQANTYLHPFLIAH
ATPG_POLSJ      MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQERMRAARPYSDKIRNVAANLSQANPEYTHAFMES
ATPG_DELAS      MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQERMLAARPYSEKIRNIAVHLGQANEYVHPFMQVN
ATPG_AZOSE      MASGKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQDRMRAARPYAEKIRRLAANLSQANVTDHAFLVQK
ATPG_SHIFL      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_SHIF8      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_SHIDS      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_SHIB3      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ESCF3      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECOUT      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECOSM      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECOSE      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECOLU      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECOLI      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECOLC      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECOL6      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECOL5      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECOK1      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECOHS      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECODH      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECOBW      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECO8A      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECO81      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECO7I      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECO5E      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECO57      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECO45      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ECO27      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_ANASK      MPSLRDIRNRIGSVRSTRQITKAMKMVSAAKLRRAQDAVLKTRPYAVLLDQTLSRLXXXXXXEHPLLAPR
ATPG_LEPCP      MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQERMRAARPYADKIRNITANLSRATEYHHPFVVKN
ATPG_DICNV      MSNAKEIRSQIKSVKSTQKITKAMEMVAASKVRRVQNYMRGGRPYAEHIQRVIAHLVRASSSTHPFLVKP
ATPG_BORA1      MPGIKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRAGRPYANKVREIAAHLMQANEYNHPYLQQR
ATPG_PECCP      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETIRNVIGHLALGNEYKHPYLEER
ATPG_DESOH      MPSLKEVQLKIKGVKQTKKITKAMNMVATSKLRGAQTNMEAFRPYAEKFAEVLGSLAAAGEETSPLLVPK
ATPG_CITK8      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYADTMRKVIGHLANGNEYKHPYLEER
ATPG_VARPS      MAAGKEIRGKIKSVENTKKITKAMEMVSVSKMRKAQERMRAARPYSEKIRNIAANLGKANEYTHAFMKKN
ATPG_BACP2      MASLRDXXXXXXXXXXXXXXXXAMQMVSAAKLNRAENNAKSFVPYMEKIQEVVAAIATGTSAKHPMLLSR
ATPG_ENT38      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMASSRPYADTMRKVIGHLANGNEYKHPYLEER
ATPG_SYNS3      MANLKEIRDRIKSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARLLENLQAREDADAPLLEQR
ATPG_SYNR3      MANLKEIRDRIKSVKNTRKITEAMRLVAAAKVRRAQDLVLRSRPFADRLARVLESLQSLESADTPLLQAR
ATPG_SHISS      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHPYLEDR
ATPG_IDILO      MASGKEIKTQISSIGNTQKITSAMEMVAASKMKKAQERMEASRPYADTIRKVIGHVARGNEYRHPFMEER
ATPG_CYAP8      MPNLKAIRDRIQSVKNTKKITEAMRLVAAAKVRRAQEQVIATRPFADALANVLYNLLNRGDVSLPLLQQR
ATPG_SYNS9      MANLKDIRDRIKSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLSRILENLQSREEADAPLMEQR
ATPG_SACD2      MASGKEIRTQIGSIKNTQKITSAMEMVAASKMRRAQDRMELGKPYASRMRAVVGHLANGNEYKHLYLQER
ATPG_POLNA      MAAGKEIRGKIKSVENTRKITKAMEMVAASKMRKAQERMRAARPYSDKIRNIAAHLSQANEYTHPFM-ES
ATPG_PROMS      MANLKEIRDRIVSVKNTRKITEAMRLVAAAKVRRAQDQVLKSRPFADKLARVLENIQSREAVDSPLLSKR
ATPG_PROM5      MANLKEIRDRIVSVKNTRKITEAMRLVAAAKVRRAQDQVLKSRPFADKLARVLENIQSREAVDSPLLSKR
ATPG_ALTMD      ---------------NTQKITSAMEMVAASKMKKAQERMASGRPYAQNMLKVIGHIANGNEYRHPYLEER
ATPG_VEREI      MAAGKEIRGKIKSVENTKKITKAMEMVSVSKMRKAQERMRAARPYSEKIRNIAANLGKANPEYTHAFMKK
ATPG_RUMAL      MANMKDVKRRIKSVESTMQITKAMQLVASSKMRKAKERAEAVHPFFEGVFQVMADI----SRDHEVFTKK
ATPG_ROSCS      MPSTREIRRRIRSVKNLAQITRAMEMVSASKMRRAQRNVLATRPYADRLLDVMGELTAVGMRRGTLLEVR
ATPG_PROMP      MANLKEIRDRIVSVKNTRKITEAMRLVAAAKVRRAQDQVLKSRPFADKLARVLENIQSREAVDSPLLSKR
ATPG_PROM0      MANLKEIRDRIVSVKNTRKITEAMRLVAAAKVRRAQDQVLKSRPFADKLARVLENIQSREAVDSPLLSKR
ATPG_SHIBS      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNEYKHLYLEDR
ATPG_PROMM      MANLKDIRDRIVSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARVLENIQSRMSFDAPLLKTS
ATPG_PROM3      MANLKDIRDRIVSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARVLENIQSRMSFDAPLLKTS
ATPG_NITOC      MASGKEIRSKIASVKNTQKITRAMEMVAASKMRKAQDRMRASRPYADKIRNVIRHLAQAQEYQHPYLTSR
ATPG_ANADE      MPSLRDIRTRIGSVRSTRQITKAMKMVSAAKLRRAQDAVLKTRPYAMLLDQTLSRLXXXXXXEHPLLAPR
ATPG_ROSS1      MPSTREIRRRIRSVKNLAQITRAMEMVSASKMRRAQRNVLATRPYADRLLDVMGELTAVGMRRGTLLEVR
ATPG_CYAP7      MPNLKFIRDRIQSVKNTKKITEAMRLVAAAKVRRAQEQVIATRPFADALAQVLYNLQNRGEVSLPLLTQR
ATPG_CLOPH      MASMRDIKRRKESIQSTGQITKAMKLVSTVKLQKAKSKAENAKPYFDHMDTVLNMLRKSGNISHPYLSAG
ATPG_TOLAT      MAGAKEIRNKIASVKNTQKITGAMEMVAASKMRKAQERMAYSRPYAVTMRKVIGHIALGNEYKHSYLIER
ATPG_SYNPW      MANLKEIRDRIKSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARLLENLQAREDADAPLLEDR
ATPG_SALRD      MANLRDIRNRIDSIENTKQVTRAMKMVAAAKLRRAQEKIFRARPYAYKIGELTNHLQELDPTAHPFFQAP
ATPG_PSEA6      ---------------NTQKITSAMEMVAASKMKKAQDRMTASRPYAENIRNVIGHLANANEYRHPYLEDR
ATPG_BACCA      LASLRDIKTRINATKKTSQITKAMEMVSTSKLNRAEKR-EIVRPYMEKIQEVVAMSASAAR-SHPMLVSR
ATPG_DEHSB      MANLRIIKRRIRSVRNIAKITRAMEMIAASKMKKAQERGLAGRPYSEKITEVIAALAASGEILHPLL-ER
ATPG_DECAR      MPSGKEIRNKIKSVENTRKITKAMEMVAASKMRKAQDRMRAARPYGEKIRRVAGNLSHATEYRHPFLVNR
ATPG_SYNSC      MANLKEIRDRIKSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARILENLQSRMGFESPLMQQR
ATPG_PROM1      MANLKDIRDRIVSVKNTRKITEAMRLVAAAKVRRAQDQVLRSRPFADRLARVLENIQSREAADSPLLNKR
ATPG_DESHD      -----------------QQITKAMKMVAASKLRKAQEKVIAARPYARQLQEVLARLADQADVTHPLLMER
ATPG_ANADF      MPSLRDIRNRIGSVKSTRQITKAMKMVSAAKLRRAQDAILKTRPYAQLLEQTLGRIXXXXXXDHPLLAPR
ATPG_PROMT      MANLKDIRDRIVSVKNTRKITEAMRLVAAAKVRRAQDQVLRSRPFADRLARVLENIQSREAADSPLLNKR
ATPG_BURP8      MAGMKEIRGKIKSVQNTRKITKAMEMVAASKXXXXXXXXXXXXPYADKVRDIAAHMSSATEYRHPFMVSN
ATPG_SPIOL      -ANLRELRDRIGSVKNTQKITEAMKLVAAAKVRRAQEAVVNGRPFSETLVEVLYNMLQTEDVDVPLTKIR
ATPG_PROM9      MANLKEIRDRIVSVKNTRKITEAMRLVAAAKVRRAQDQVLKSRPFADKLARVLENIQSREAVDSPLLSKR
ATPG_EXIS2      MASLREIQMRINSTKSTKQITKAMNMVSASKLNRAQAHSAKFQPYMLKMQEVLGTIANGTTASHPMLEKR
ATPG_LEPBL      MATPREIKKRINSVKNTRKITRTMEMVSTAKSKKISDRVNASHPFSNKIKEXXXXXXXXXXXXXPYLRRP
ATPG_LEPBJ      MATPREIKKRINSVKNTRKITRTMEMVSTAKSKKISDRVNASHPFSNKIKEXXXXXXXXXXXXXPYLRRP
ATPG_GEOSL      MASLKSIKKRIVSVKNTRQITKAMKMVSAAKLRRAQENVVAARPYAKKLGEVLQRLAKSQDESGSPLMQQ
ATPG_PROM2      MANLKEIRDRIVSVKNTRKITEAMRLVAAAKVRRAQDQVLKSRPFADKLARVLENIQSREAVDSPLLSKR
ATPG_ODOSI      ------IRDRITSVKNTKKITMAMKLVAAAKVRRAQDAVLATRPFSETLQSVFGGLIAGEALDLPLLTQR
ATPG_THEEB      MANLKAIRDRIKTIKDTRKITEAMRLVAAAKVRRAQEQVMASRPFADRLAQVLYSLQTREDVDLPLLAKR
ATPG_BURXL      MAGMKEIRGKIKSVQNTRKITKAMEMVAASKXXXXXXXXXXXXPYADKVRDIAAHMSRANEYRHPFMVSN
ATPG_BURPP      MAGMKEIRGKIKSVQNTRKITKAMEMVAASKXXXXXXXXXXXXPYADKVRDIAAHMSRANEYRHPFMVSN
ATPG_SYNPX      MANLKEIRDRIKSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARILENLQSRMRFESPLMEQR
ATPG_PROMA      MANLKEIRDRIVSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARVLENIQSREAADSPLLKAR
ATPG_PELTS      MPSLRDLRRRIKSIKSTQQITKAMKAVSAAKMRKAQEAVLSARPYSKRLKSVLGRVAVASGVSHPLLAVR
ATPG_CYTH3      MPSLKEVRNRIASVNSTQQITKAMKMVSAAKLRRAQDRAMKIRPYAEKLNGILQNIAASDGADNVYAEER
ATPG_CYAA5      MPNLKAIRDRIQSVKNTKKITEAMRLVAAAKVRRAQEQVISTRPFADALANVLFNLLNRGDVSLPLLQQR
ATPG_CARHZ      MPSMRDLRRRIKSIKNTQQITKAMKMVAAAKLRRAQEMVVASRPYAKRIKDVLXXXXXXXXXXHPLLIKR
ATPG_GEOLS      MASLKSIKKRIVSVKNTRQITKAMKMVSAAKLRRAQENVVAARPYAQKMGEVLQSLAGNLEGNHPLLEKR
ATPG_FUSNN      MPGMKEIKSRIKSVQSTRQITNAMEIVSTTKFKRYSKLVTESRPYEESMRKILGNIASVKNEGHPLFDGR
ATPG_BACC2      MASLRDXXXXXXXXXXXXXXXXXMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKINHPMLNAR
ATPG_ENTFA      -ASLNEIKQRIASTKKTSQITKAMQMVSAAKLTKSEGASKSFQEYSSKIRSVVTHLVAASSLSHVMLAQR
ATPG_CHLPB      MATLKDIRTRIQSIASTQQVTKAMKMVSAAKLRRAQDSAIQARPYAAKLKEMLGSLSTVDTTLNPLLSDR
ATPG_NATTJ      ----REIKRRISSVNSTKQITRAMEMVAAAKLRRAQQRVEDNRPYEEKMRQAIFRILNAKTISHPLMESK
ATPG_COXB2      MSKAREIRTKIASIKNTQKITRAMELVAASKMRKAQDRMAMSRPYASKIRKVISHVASHAEYPHPYLQQR
ATPG_VESOH      MAVGKEIRTQISSIKNTQKITSAMEMVAASKMKKAQDRMLESRPYCEKISNIIGHLAYASEFQHPYMNSL
ATPG_SODGM      MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKTQERMASSRPYAETMRKVIGHLALGNEYKHSYLDER
ATPG_CHLT3      MATLREIRTRIKSVKSTQQLTKAMKMVXXXXXXXXXXXXXXXXPYAAKLKELLDSLSGVDTTINPLLTPR
ATPG_PSEHT      ---------------NTQKITSAMEMVAASKMKRAQERVATSRPYAAKLRTVIGRVAQANDFTHPFLEER
ATPG_POLNS      MASTKEIRSKIKSVQNTRKITKAMEMVAASKMRRAQERMRNARPYAEKIREIVANLSKANPGFRPAYMAT
ATPG_MICAN      MPNLKAIRDQIQSVKNTKKITEAMRLVAAAKVRRAQEQVLCTRPFADALAQVLYNLQGRSDVNLPLLAQR
ATPG_BURS3      MAGMKEIRGKIKSVQNTRKITKAMEMVAASKXXXXXXXXXXXXPYADKVRAIAAHMSRANEYRHPFMVAN
ATPG_BACST      LASLRDIKTRINATKKTSQITKAMEMVSTSKLNRAAKREIVRS-YMEKIQEVVANVASRGR-SHPMLVSR
ATPG_SPIPL      MSNLKAIRDRIQSVKNTKKITEAMRLVASAKVRRAQEQVLATRPFADRLAGVLYGLQGREDVECPLLQQR
ATPG_COXBU      MSKAREIRTKIASIKNTQKITRAMELVAASKMRKAQDRMAMSRPYASKIRKVISHVASHAEYPHPYLQQR
ATPG_COXBR      MSKAREIRTKIASIKNTQKITRAMELVAASKMRKAQDRMAMSRPYASKIRKVISHVASHAEYPHPYLQQR
ATPG_COXBN      MSKAREIRTKIASIKNTQKITRAMELVAASKMRKAQDRMAMSRPYASKIRKVISHVASHAEYPHPYLQQR
ATPG_COXB1      MSKAREIRTKIASIKNTQKITRAMELVAASKMRKAQDRMAISRPYASKIRKVISHVASHAEYPHPYLQQR
ATPG_PROM4      MANLKEIRDRIVSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADRLARVLQNIQSRETADAPLLKSR
ATPG_BURM1      MAGMKEIRGKIKSVQNTRKITKAMEMVAASKXXXXXXXXXXXXPYADKVRAIAAHMSRANEYRHPFMVAN
ATPG_BACLD      MASLRDIKSRIASNKKMSQITKAQEMVSASKLNRAENKAKSFVPYMEKMQEVVADIAVGYTGKHPMMSSR
ATPG_NEIG1      MAVGKEILTKIRSVQNTQKITKAMQMVSTSKMRKTQERMSLARPYAEKVRMVMSHLAQTNT-DHPLLESH
ATPG_BACME      MASLRDXXXXXXXXXXXXXXXXAMEMVSAAKLNRAEQNAKSFVPYMEKIQEVVSSVALGSGASHPMLTAR
ATPG_ACAM1      MPNLKSIRDRISTVKNTKKITEAMRLVAAAKVRRAQEQVTATRPFADRLAQVLYGLQAREEVELPLLQER
ATPG_HERAR      MASGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQERMHAARPYSDKIRNIAANLSQANEYTHPFLVKS
ATPG_GEOUR      MASLKSIKKRIVSVKNTRQITKAMKMVSAAKLRRAQENVVAARPYAKKLGEVLERLSKSQDVDSPLMEKR
ATPG_STRPZ      --SLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLLKSEGSDNPMLVSR
ATPG_PHEZH      MASLKEMRNRIGSVKATQKITKAMQMVXXXXXXXXXXXXXNARPYAQRMASVIANLAAGVSGDGPKLLAG
ATPG_NEIMA      MAVGKEILTKIRSVQNTQKITKAMQMVSTSKMRKTQERMRLARPYAEKVRMVMSHLAQTNT-DHPLLESH
ATPG_NEIM0      MAVGKEILTKIRSVQNTQKITKAMQMVSTSKMRKTQERMRLARPYAEKVRMVMSHLAQTNT-DHPLLESH
ATPG_LARHH      MAVGKEIRSKIKSVQSTQKITRAMQMVATSKMRKTQERMRSARPYAEKIREVMAHVAETNDFKHPALERR
ATPG_CLOCE      ---MREIKSRIKSINQMRQITKAMKLISASKLKKARAQLEETLPYYNKVKETIDILAHSAEVESRFIREE
ATPG_STRPM      --SLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLLKSEGSDNPMLVSR
ATPG_STRPG      --SLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLLKSEGSDNPMLVSR
ATPG_STRPF      --SLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLLKSEGSDNPMLVSR
ATPG_STRPD      --SLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLLKSEGSDNPMLVSR
ATPG_STRPC      --SLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLLKSEGSDNPMLVSR
ATPG_STRPB      --SLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLLKSEGSDNPMLVSR
ATPG_STRP8      --SLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLLKSEGSDNPMLVSR
ATPG_STRP6      --SLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLLKSEGSDNPMLVSR
ATPG_STRP1      --SLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLLKSEGSDNPMLVSR
ATPG_STRA3      --SLSEIKDKILSTEKTSKITSAMQMVSSAKLVKSEQAARDFQVYASKIRQITTNLLKSSGSDNPMLASR
ATPG_NEIMF      MAVGKEILTKIRSVQNTQKITKAMQMVSTSKMRKTQERMRLARPYAEKVRMVMSHLAQTNT-DHPLLESH
ATPG_NEIMB      MAVGKEILTKIRSVQNTQKITKAMQMVSTSKMRKTQERMRLARPYAEKVRMVMSHLAQTNT-DHPLLESH
ATPG_NEIG2      MAVGKEILTKIRSVQNTQKITKAMQMVSTSKMRKTQERMRLARPYAEKVRMVMSHLAQTNT-DHPLLESH
ATPG_MAIZE      --SLRELRTRIDSVRNTQKITEAMKLVAAAKVRRAQEAVVSSRPFSEALVEVLYNMIQTEDIDLPLTRTR
ATPG_CHLRE      VAGLKEVRDRIASVKNTQKITDAMKLVAAAKVRRAQEAVVNGRPFSENLVKVLNQRVRQEDVDSPLCAVR
ATPG_HERA2      MASAREIRRRIKSVKNTGKITKAMELVSASKMRRAQRNVLATRPYADRLYDVMGELTLRSGTKHPLLQPH
ATPG_BUCAP      MASKKEIKDQIISVTNTKKITKAMEMVAVSKMRKTEERMRLGRPYSEIIKKVIHHVLQGSLEYKHSYLEK
ATPG_STRTR      --SLREIKAKIASIKQTSHITGAMQMVSASKLTRSEQAAKDFQIYASKIRQITTDLLHSELVNNPMLDAR
ATPG_STRTD      --SLREIKAKIASIKQTSHITGAMQMVSASKLTRSEQAAKDFQIYASKIRQITTDLLHSELVNNPMLDAR
ATPG_STRT2      --SLREIKAKIASIKQTSHITGAMQMVSASKLTRSEQAAKDFQIYASKIRQITTDLLHSELVNNPMLDAR
ATPG_STRT1      --SLREIKAKIASIKQTSHITGAMQMVSASKLTRSEQAAKDFQIYASKIRQITTDLLHSELVNNPMLDAR
ATPG_BURCM      MAGMKEIRGKIKSVQNTRKITKAMEMVAASKXXXXXXXXXXXXPYADKVRAIAAHMSRANEYRHPFMVAN
ATPG_BURA4      MAGMKEIRGKIKSVQNTRKITKAMEMVAASKXXXXXXXXXXXXPYADKVRAIAAHMSRANEYRHPFMVAN
ATPG_STRP3      --SLSEIKAKIISTEKTSKITSAMRMVSSAKLVRSEQAARDFQIYASKIRQITTDLLKSEGSDNPMLVSR
ATPG_AZOSB      MASGKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQDRMRAARPYADKIRRLAANLSQANVTDHPFLVRK
ATPG_ANAVT      MPNLKSIRDRIQSVKNTKKITEAMXXXXXXXXXXXQEQVIATRPFADRLAQVLYGLQTREDVDLPLLKKR
ATPG_STRA5      --SLSEIKDKILSTEKTSKITSAMQMVSSAKLVKSEQAARDFQVYASKIRQITTNLLKSSGSDNPMLSSR
ATPG_STRA1      --SLSEIKDKILSTEKTSKITSAMQMVSSAKLVKSEQAARDFQVYASKIRQITTNLLKSSGSDNPMLSSR
ATPG_TOBAC      ---LRDLRDRIESVKNTQKITEAMKLVAAAKVRRAQEAVVGARPFSETLVEVLYNILQTDDIDVP-LTXX
ATPG_PEA        ---LKDLKNRIDSVKNTQKITEAMKLVAAAKVRRAQEAVVNGRPFSETLVEVLYSILQTDDIESPLTKLR
ATPG_BURCJ      MAGMKEIRGKIKSVQNTRKITKAMEMVAASKXXXXXXXXXXXXPYADKVRAIAAHMSRANEYRHPFMVAN
ATPG_ANASP      MPNLKSIRDRIQSVKNTKKITEAMXXXXXXXXXXXQEQVIATRPFADRLAQVLYGLQTREDVDLPLLKKR
ATPG_PSYIN      MAGDKEIRNKIASVKNTQKITGAMEMVAASKMRRAQLRMNSSLSYAKSMRKVIGHIALGEEYHHAYLEER
ATPG_DESAP      MPALRDFRRRIKSVKSTQKICKXXXXXXXXXXXXXXXXXVAARPYARQLHEVLGRVASAADVQNPLLTVR
ATPG_BURTA      MAGMKEIRGKIKSVQNTRKITKAMEMVAASKXXXXXXXXXXXXPYAEKVRAIAAHMSRANEYRHPFMVAN
ATPG_SYNAS      MAALKDIKRKVAAVEKTKQITRAMNMVAASKFRTSQTRMESFRPYAMKFMEVLSSLAVRVSPDHPLLAAR
ATPG_LEPBP      MATPREIKKRINSVKNTRKITRTMEMVSXXXXXXXXXXXXXXXPYADLTREVXXXXXXXXXXXXPYLRKP
ATPG_LEPBA      MATPREIKKRINSVKNTRKITRTMEMVSXXXXXXXXXXXXXXXPYADLTREVXXXXXXXXXXXXPYLRKP
ATPG_BDEBA      MASLKDIRAQIESTKNTQQITKAMKLVSAAKLRKAQNNIVNMRPYALALRQVIADIAVTNKVSHPLMEKK
ATPG_BARBK      MASLKDLRDRIASVKATQKITKAMQMVAAAKLHRAQEAVEAGRSYTQRMDALVTNISKDVDLDAPLLMRG
ATPG_RHOFD      MATGKEIRGKIKNFESTKKITKAMEMISVSKMRKAQERMRAARPYADKVRNIAANLGQANEYIHAFMKTN
ATPG_LACRJ      -ASLAAVKHKIDSTKSTRQITSAMQMVSTAKLNQIQHHTQTYEVYAEKVKQMLSDLVSAASQDYAALFKK
ATPG_LACRD      -ASLAAVKHKIDSTKSTRQITSAMQMVSTAKLNQIQHHTQTYEVYAEKVKQMLSDLVSAASQDYAALFKK
ATPG_HAMD5      MISAKEIRSKIASVKSTQKITKAMEMVAASKMRKSQESMSATRPYAEMIRKVIGHLALGNEYKHPYLQER
ATPG_BURPS      MAGMKEIRGKIKSVQNTRKITKAMEMVAASKXXXXXXXXXXXXPYAEKVRAIAAHMSRANEYRHPFMVAN
ATPG_BURP6      MAGMKEIRGKIKSVQNTRKITKAMEMVAASKXXXXXXXXXXXXPYAEKVRAIAAHMSRANEYRHPFMVAN
ATPG_BURP1      MAGMKEIRGKIKSVQNTRKITKAMEMVAASKXXXXXXXXXXXXPYAEKVRAIAAHMSRANEYRHPFMVAN
ATPG_BURP0      MAGMKEIRGKIKSVQNTRKITKAMEMVAASKXXXXXXXXXXXXPYAEKVRAIAAHMSRANEYRHPFMVAN
ATPG_BURMS      MAGMKEIRGKIKSVQNTRKITKAMEMVAASKXXXXXXXXXXXXPYAEKVRAIAAHMSRANEYRHPFMVAN
ATPG_BURMA      MAGMKEIRGKIKSVQNTRKITKAMEMVAASKXXXXXXXXXXXXPYAEKVRAIAAHMSRANEYRHPFMVAN
ATPG_BURM9      MAGMKEIRGKIKSVQNTRKITKAMEMVAASKXXXXXXXXXXXXPYAEKVRAIAAHMSRANEYRHPFMVAN
ATPG_BURM7      MAGMKEIRGKIKSVQNTRKITKAMEMVAASKXXXXXXXXXXXXPYAEKVRAIAAHMSRANEYRHPFMVAN
ATPG_BUCDN      MASIKEIKTQITSVVNTKKITKAMEMVAISKMRKTEERMSSGRPYSEIIRKVINHVAQGHEYKHSYLETR
ATPG_RHOBL      MPSLKDLKNRIGSVKNTRKITKAMQMVAAAKLRRAQDSAEAARPYAERMGAVIASLASGQGAGAPRLLAG
ATPG_BUCAT      MTSTKEIKNKIVSVTNTKKITKAMEMVAVSKMRKTEERMRSGRPYSDIIRKVIDHVTQGNEYKHSYLEER
ATPG_BUCAI      MTSTKEIKNKIVSVTNTKKITKAMEMVAVSKMRKTEERMRSGRPYSDIIRKVIDHVTQGNEYKHSYLEER
ATPG_BUCA5      MTSTKEIKNKIVSVTNTKKITKAMEMVAVSKMRKTEERMRSGRPYSDIIRKVIDHVTQGNEYKHSYLEER
ATPG_BARQU      MASLKDLRDRIASVKATQKITKAMQMVAAARLHRVQEAAQSARPYAQRMAAILANVATVDTIDVPPLMRG
ATPG_SULNB      MANLKEIKRKISSVKNTQKTTNAMKLVSSAKLKRTEELAKRSRVYAAKLTELIEEIASAEGLDNIFFQEN
ATPG_ALKMQ      ---MQDIKRRIKSVNSTKQITKAMELVXXXXXXXXXXXXEKTRPYFKVVEETINDIVSSTQIRHDLITPR
ATPG_SILPO      MPNLKDLKNRIASVKSTRKITKAMQMVAAAKLRRAQESAEAARPYAERFNAVMAGLAASGSDSAPLLLRG
ATPG_PHATR      ------IRDRITSVKNTRKITMAMKLVAAPKVRRAQDAVLATRPFSETLQSVIQRLGG-ESVDLPLLTER
ATPG_PARUW      MASLREIRKRLQSIQNIQQLTKAMEMVAASRLHQVQIKVKQAKPYVVKLSEILDRLSQITQIKHPLLEQR
ATPG_LACLS      ----------------------AMQMVSAAKLQKAESHAKAFQTYAEKVRKITTDLVSSDNAKNPMMIKR
ATPG_STRMU      --SLSEIKVRITSTQKTGKITSAMKMVSSAKLVKSEQAAKDFQIYASKIRQITTDLLHSDGSSNPMLISR
ATPG_LACC3      --SLMDIKRKIASTKKTGQITQAMQMVSGAKLSQIEKRAKKYQIYSDKVRQIVTHLAAGQLLELASLLQK
ATPG_LEUMM      MASLQDIQRRISSTKKTRQITSAMQMVSTAKLSQIQKYSAGYGSYAARLEAVVEHLVSAADADHIPLIAQ
ATPG_LACCB      --SLMDIKRKIASTKKTGQITQAMQMVSGAKLSQIEKRAKKYQIYSDKVRQIVTHLAAGQLLELASLLQK
ATPG_DESPS      MPSLKEVKTKITGVKKTSQITKAMNMVAASRLRGAQDKMESFRPYASKFSEAMSNLSGGGNTNAFPLMDV
ATPG_SYNJA      MANLKRIRDRIKAVKNTRKITXXXXXXXXXXXXXXXXXXXXTRPFADRLAQVFYRLQTRLRLDLPLLKQR
ATPG_NOSP7      MANLKAIRDRIQSVKNTKKITXXXXXXXXXXXXXXXXXXXXTRPFADRLAQVLYGLQSRLRFEEPLLRKR
ATPG_POLSQ      MASTKEIRSKIKSVQNTRKITKAMEMVAASKMRRAQERMRNARPYAEKIREIVANLSKANPEFRPAYMEA
ATPG_LACLM      ----------------------AMQMVSAAKLQKAESHAKAFQTYAEKVRKITTDLVSSDNAKNPMMIKR
ATPG_BAUCH      MSNTKEIRSQIICIQNTKKITKAMEMVAVSKMRKTQERMLASLPYAEIIHKVIKHLTLGNEYKHPYFHER
ATPG_LACLA      ----------------------AMQMVSAAKLQKAESHAKAFQIYAEKVRKITTDLVSSDKAKNPMMIKR
ATPG_FLAPJ      MANLKEIRNRITSVSSTMQITSAMKMVSAAKLKKAQDAITAMRPYAEKLTELLQNLSATLDGDAEFTKQR
ATPG_BACV8      MASLKEVKGRIASVNNTRKITSAMKMVASAKLHKAQAAIENMLPYERRLNHILTNFLSADSVESPFIVKR
ATPG_ENTHR      -ASLNEIKTRIASTKKTSQITRAMQMVSASKLTKSEASSQKFQIYANKVREIVTHLTATQASDNPMLISR
ATPG_DESAH      MATLKEVQLKIGSVKKTRQITSAMKMVATSRLRGSQEKMDRFKPYASKFSEVLGSIAGKAGEESPLLVPR
ATPG_RHOCS      MPSLKDIRNRIGSVKSTQKITSAMKMVAASKLRRAQEQAEAGRPFADRMARMLASLAASGATGGPRLMTG
ATPG_LAWIP      MASLKDVKIKIAGVRKTKQITKAMNMVASAKLRGAQIKIEHFRPYAEKFQDVISNLATRSDETHKLLEKR
ATPG_FLAJ1      MANLKEIRNRITSVSSTMQITSAMKMVSAAKLKKAQDAITAMRPYAEKLTELLQNLSATGEVGGAYTTQR
ATPG_STRU0      --SLSEIKAKINSTEKTSKITSAMRMVSSAKLVKSEQSARDFQIYASKIRQITTDLLKASGSTNPMLVSR
ATPG_LEUCK      MASLQDIQRRISSTKKTRQITSAMQMVSTAKLSQIQRYGRGYQAYAARLEAVVEHLVAAHLFDNPLIAQR
ATPG_GRABC      MASLKALRGRITSVKSTQKITSAMKMVAASKLXXXXXXXXXXXPYAELMQRMLAALADAGSPSAPRILVG
ATPG_ACEWO      ---VQDIKPRIKSVNSTMQITHAMELVASAKLRKSRELAEGRRPYFEAMIESIGRIVEKSGNARNIFMDQ
ATPG_SYNJB      MANLKRIRDRIKAVKNTRKITXXXXXXXXXXXXXXXXXXXXTRPFADRLAQVFYRLQTRLRLEDPLLKQR
ATPG_BARHE      MASLKDLRDRIASVKATQKITKAMQMVXXXXXXXXXXXXXSARPYAKRMAAILANLANVDPIDAPSLMRG
ATPG_GEOMG      MASLKSIKKRIVSVKNTRQITKAMKMVSAAKLRRAQENVVAARPYAKKLGEVLDRLAKSQDGSSSPLLQK
ATPG_RHORU      MASLKDLRSRITSVKSTQKITSAMKMVAASRLRRAQDTAEAARPYTQRMERMLGNLAASTAGASPLLGGT
ATPG_RHORT      MASLKDLRSRITSVKSTQKITSAMKMVAASRLRRAQDTAEAARPYTQRMERMLGNLAASTAGASPLLGGT
ATPG_PELLD      MPTLKDIRVRIKGVKSTQQVTXXXXXXXXXXXXXXQERAVMARPYAAKLKEMLGSLSGVDTSASPLLADR
ATPG_LACS1      -ASLQEVKRRIESTKKTSQITSAMQMVSTAKLSQIQKHATSYQVYATKIRSVITHLSKSHLLDSVMLRQR
ATPG_BACA2      MASLRDXXXXXXXXXXXXXXXXAMQMVSAAKLNRAETNAKSFAPYMDKIQEVVFNVGKAKNAKHPMLVSR
ATPG_DESVH      MPSLKDVKVKIAGVKKTKQITKAMNMVASAKLRGAQQRIERFRPYAEKFYGMLGDLASADGSAHPLLEVR
ATPG_CHLP8      MPTLKDIRIRLKGIKSTQQVTXXXXXXXXXXXXXXQDRAIQARPYAGKLKEMLASLSTKVDTSNPLLSPR
ATPG_MAGSA      MASLKDLRMKIVSVKSTRKITSAMKMVAASKLRRAQTAAEAARPFAERMERMLGTLAAAGQSGAPRMISG
ATPG_DEHE1      ------------------KITRAMEMIAASKMKKAQERGLAGRPYSEKITEVIAALAASGEILHPLL-ER
ATPG_CLOPA      ------IKRRIQSITNTRKITKAMGLIATSTLRKARRNLDANLSYYSSFEDVMKKVSSGI-LGENIYTNG
ATPG_ACIF5      MANAKEIRGQIKSVKNTRKITRAMEMVAASKXXXXXXXXXXXXPYAEKIREVLGHLAQAHEYEHPLMQVR
ATPG_ACIF2      MANAKEIRGQIKSVKNTRKITRAMEMVAASKXXXXXXXXXXXXPYAEKIREVLGHLAQAHEYEHPLMQVR
ATPG_ROSDO      MPSLKDLKNRIESVKSTRKITKAMQMVXXXXXXXXXXXXXXSRPYTERFNAVMAGLAASGSDSAPKLLSG
ATPG_STRSV      --SLNDIKNKIASTKNTSQITNAMQMVSAAKLGKSEEAAKNFQVYAQKVRKLVTDMLHGHEAEHSMLISR
ATPG_STRSA      --SLNDIKNKIASTKNTSQITNAMQMVSAAKLGKSEEAAKNFQVYAQKVRKLVTDMLHGHEAEHSMLISR
ATPG_RHOCA      MPSLKDLKNRIVSVKNTRKITKAMQMVAAANIRRAQESAEAARPYAERMNAVMSSLAGASTDGAPRLLAG
ATPG_LACF3      -ASLAAVKRRIQSTKSTRQITSAMQMVSTAKLNQIQHHTKTYQVYAEKVQAILVSLVSADSLKYEQLFSK
ATPG_CHLPD      MPTLKDIRVRIKGVKSTQQVTXXXXXXXXXXXXXXQERAIMARPYARKLKEMLGSLSDKVDTSNPLLSNR
ATPG_SORC5      ----------------TQKITRAMKMVAGAKLNKAQLRITELRPYAVKVQEVLSAITRDXXXXHPLLVTR
ATPG_PROVI      MPTLKDIRVRIKGVTSTQQVTXXXXXXXXXXXXXXQERAVMARPYAAKLSEMLGSLAKVDTSENPLLSGR
ATPG_LACSS      --SLMDIKRRIASTKKTGQITSAMQMVSGAKLSQIEKNSVAYQVYTDKIREIVTHLAASQLIDSNLLVER
ATPG_STRR6      --SLNDIKTKIASTKNTSQITNAMQMVSAAKLGRSEEAARNFQVYAQKVRKLLTDILGAGASTNPMLISR
ATPG_STRPN      --SLNDIKTKIASTKNTSQITNAMQMVSAAKLGRSEEAARNFQVYAQKVRKLLTDILGAGASTNPMLISR
ATPG_STRP2      --SLNDIKTKIASTKNTSQITNAMQMVSAAKLGRSEEAARNFQVYAQKVRKLLTDILGAGASTNPMLISR
ATPG_RHOBA      ------------------------ELIATXXXXXXXXXXXXXXXXXEQITKIVSRLADAGDVQHPLLEQR
ATPG_GLOVI      MPNLRGIRDRIKSVKNTQKITKXXXXXXXXXXXXXXXXXXXGRPFADXXXXXXXXXXXXXXFEDVQLMER
ATPG_STREM      --SLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLLKSTGSDNPMLVSR
ATPG_METNO      MASLKDLRNRIASVKATQKITKAMQMVXXXXXXXXXXXXENARPYAERMAAVLGNLATTPGAETPRLLAG
ATPG_CALS8      ----RWIKSRIKSVNETKKITRAMYLISASKMKRSRDRLDSTRPYFEKINEFMKDLVVHGMQTNHILFEK
ATPG_FRAP2      MSNAREIRSKVQSVKNTQKITGAMELVAASKMRGAIVKMNNVRPYVESANTIIKNVTMASDYPNPYLFDR
ATPG_STRZT      --SLNDIKTKIASTKNTSQITNAMQMVSAAKLGRSEEAARNFQVYAQKVRKLLTDILGAGASTNPMLISR
ATPG_STRZP      --SLNDIKTKIASTKNTSQITNAMQMVSAAKLGRSEEAARNFQVYAQKVRKLLTDILGAGASTNPMLISR
ATPG_STRZJ      --SLNDIKTKIASTKNTSQITNAMQMVSAAKLGRSEEAARNFQVYAQKVRKLLTDILGAGASTNPMLISR
ATPG_STRPS      --SLNDIKTKIASTKNTSQITNAMQMVSAAKLGRSEEAARNFQVYAQKVRKLLTDILGAGASTNPMLISR
ATPG_STRPJ      --SLNDIKTKIASTKNTSQITNAMQMVSAAKLGRSEEAARNFQVYAQKVRKLLTDILGAGASTNPMLISR
ATPG_STRPI      --SLNDIKTKIASTKNTSQITNAMQMVSAAKLGRSEEAARNFQVYAQKVRKLLTDILGAGASTNPMLISR
ATPG_STRP7      --SLNDIKTKIASTKNTSQITNAMQMVSAAKLGRSEEAARNFQVYAQKVRKLLTDILGAGASTNPMLISR
ATPG_NITWN      MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQNAAEAARPYAEKMDTVXXXXXXXXXXXXXXXXXX
ATPG_LACPL      --SLMDVKRRIDSTKKTHQITSAMQMVSTSKLNQIQKHTSTYQVYASKVESIVSHLAKAHTISVSELLAQ
ATPG_FRATT      MSNAREIRSKVQSVKNTQKITGAMELVAASKMRGAIVKMNNVRPYVESANTIIKNVTAASDYPNPYLFDR
ATPG_FRAT1      MSNAREIRSKVQSVKNTQKITGAMELVAASKMRGAIVKMNNVRPYVESANTIIKNVTAASDYPNPYLFDR
ATPG_STRGC      --SLNDIKNKIASTKNTSQITNAMQMVSAAKLGKSEEAAKNFQIYASKVRKLLTDLLHGHEAEHPMLTSR
ATPG_JANSC      MPNLKDLKNRIASVKSTRKITKAMQMVXXXXXXXXXXXXXMARPYAEKMEAVMSGLASANSEGAPRLLAG
ATPG_GEOSF      MASLKSIKKRIVSVKNTGQITKAMKMVSAAKLRRAQENVVAARPYAAKLGEVLGRLSRNQDADSPLMIKR
ATPG_FRATM      MSNAREIRSKVQSVKNTQKITGAMELVAASKMRGAIVKMNNVRPYVESANTIIKNVTAASDYPNPYLFDR
ATPG_BACTN      MASLKEVKTRINSVKSTRKITSAMKMVASAKLHKAQGAIENMLPYERKLNKILTNFLSADPVESPYIKAR
ATPG_METPB      MPSLKDLRNRITSVKATQKITKAMQMVXXXXXXXXXXXXENGRPYAEKMASVLANLAGIGGVGAPRLLSG
ATPG_DESAD      MASLKDVQNQIVSIKKTKQITKAMNMVASAKLRGAQDRIERFRPYADKFYEMLGDLAAADSSVHPLLEVH
ATPG_CAUCR      MASLKEMRNRISSVKATQKITKAMQMVAAAKLRRSQDAAESARPYARRLASVIANLAAGVSGDAPKLLAG
ATPG_CAUCN      MASLKEMRNRISSVKATQKITKAMQMVAAAKLRRSQDAAESARPYARRLASVIANLAAGVSGDAPKLLAG
ATPG_NITHX      MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQSAAEAARPYAEKMDQVISNIXXXXXXXXXXXVLL
ATPG_FRATO      MSNAREIRSKVQSVKNTQKITGAMELVAASKMRGAIVKMNNVRPYVESANTIIKNVTAASDYPNPYLFDR
ATPG_FRATN      MSNAREIRSKVQSVKNTQKITGAMELVAASKMRGAIVKMNNVRPYVESANTIIKNVTAASDYPNPYLFDR
ATPG_FRATF      MSNAREIRSKVQSVKNTQKITGAMELVAASKMRGAIVKMNNVRPYVESANTIIKNVTAASDYPNPYLFDR
ATPG_THIFE      MANAKEIRGQIKSVKNTRKITRAMEMVAASKXXXXXXXXXXXXPCAEKIREVLGHLAQAHEYEHPLMQVR
ATPG_SULSY      ----RDIKRKINGIKNTQRITKAMKAVSAAKLRKAQALLYATRPYSNKLYELIEDLAVYIDREHPLLEKR
ATPG_STRS7      --SLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLLKSTGSDNPMLVSR
ATPG_STRE4      --SLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLLKSTGSDNPMLVSR
ATPG_PELPB      MPTLKDIRVRIKGVKSTQQVTXXXXXXXXXXXXXXQERAVMARPYAKKLKEMLGSLAKVDTSRNPMLSGR
ATPG_CHLTE      MPTLKDIRIRLKGVKSTQQVTXXXXXXXXXXXXXXQDRAIQARPYAGKLKEMLASLSTKVDTSNPLLSPR
ATPG_AGRRK      MPSLKDLKNRIASVKATQKITKAMKMVXXXXXXXXXXXXXXXXPYSQRMGAVLANITAASDADGPLLMTG
ATPG_PELUB      MATLDDLKKRIASVKSTQKITKAMKMVAAAKLRRAQENAEKGRPYSEKMNNIILNLSSGISENAPKLLSG
ATPG_LACDB      -ASLLELKKRIASVKQTSKITEAMHMVSAAKLNQTEKRDKGYQEYNRLLHQTVSRLMSASVINHDMIKPR
ATPG_LACDA      -ASLLELKKRIASVKQTSKITEAMHMVSAAKLNQTEKRDKGYQEYNRLLHQTVSRLMSASVINHDMIKPR
ATPG_GRAFK      MANLKELRSRITSVSSTMQITKAMKMVSASKLSKAQDAITQMRPYSEKLTQLLQDLSATLDDDSKYAEER
ATPG_FRATW      MSNAREIRSKVQSVKNTQKITGAMELVAASKMRGTIVKMNNVRPYVESANTIIKNVTAASDYPNPYLFDR
ATPG_BRUC2      MPSLKDLRNRIASVKATQKITKAMQMVXXXXXXXXXXXXXXXXPYSQRMGAVLANIANVSGEDAPALMVG
ATPG_BLOFL      MSSIKEVREKIESIRNIQKLSKAMEMIAASKMKKAQRLMLVSQPYTKAIRKVIDHISLGKEYRHVYLMNR
ATPG_RHOPT      MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQMAAEAARPYAEKMEXXXXXXXXXXXXXXXXXXXX
ATPG_RHOPA      MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQMAAEAARPYAEKMEXXXXXXXXXXXXXXXXXXXX
ATPG_FRATH      MSNAREIRSKVQSVKNTQKITGAMELVAASKMRGAIVKMNNVRPYVESANTIIKNVTAASDYPNPYLFDR
ATPG_BACFN      MASLKEVKTRINSVQSTRKITSAMKMVASAKLHKAQGAIENMLPYQRKLNKILTNFLSADPVESPFCVER
ATPG_STREI      --SLSEIKGKIISTQKTSHITGAMQMVSAAKLTKSEQAAKDFQVYASKIRQITTDLLKSELVNNPMLAAR
ATPG_MARMM      MASLKDLKNRIGSVKSTQKITKAMQMVXXXXXXXXXXXXXXXXXXXXXXXXVMANLSTAMSGTSPLLVGT
ATPG_GLUOX      MASLKELRGRITGVKSTRKITNAMKMVAASKLRRAQMQAEAARPYXXEDAASLPRLLAGTGKDQTHL---
ATPG_CHLL2      MPTLKDIRVRIKGIKSTQQVTXXXXXXXXXXXXXXQERAIMARPYAGKLKEMLGSLAKVDTSLNPLLSSR
ATPG_BRUSU      MPSLKDLRNRIASVKATQKITKAMQMVXXXXXXXXXXXXXXXXPYSQRMGAVLANIANVSGEDAPALMVG
ATPG_BRUSI      MPSLKDLRNRIASVKATQKITKAMQMVXXXXXXXXXXXXXXXXPYSQRMGAVLANIANVSGEDAPALMVG
ATPG_BRUO2      MPSLKDLRNRIASVKATQKITKAMQMVXXXXXXXXXXXXXXXXPYSQRMGAVLANIANVSGEDAPALMVG
ATPG_NAUPA      MATLKELKQKISSVKNTQKTTRAMKLVSTAKLKRAEEAIMRSREYARKIDEVMHEISAASVKDSIELRKI
ATPG2_ARATH     -AGIRELRERIDSVKNTQKITEXXXXXXXXXXXXXXXXXIKGRPFTETLVEILYSIAQLEDIDFP-LSIX
ATPG_RHIE6      MPSLKDLKNRIASVKATQKITKAMKMVXXXXXXXXXXXXXXXXPYSQRMNTVLANIAKADADGAPVLMTG
ATPG_WIGBR      MYNIKDIRQKIIGIKKTQSITSAMEKISAIKMKKSQNLLNSTKPYYEKISLLLNKLLFQNKYKHPYLKKR
ATPG_RHOP2      MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQMAAEAARPYAEKMDSXXXXXXXXXXXXXXXXXXX
ATPG_BACFR      MASLKEVKTRINSVQSTRKITSAMKMVASAKLHKAQGAIENMLPYQRKLNKILTNFLSADPVESPFCVER
ATPG_DESVM      MPSLKDVKVKIAGVKKTKQITKAMNMVASAKLRGAQQRIERFRPYAAKFYDMLGDLASADSSVHPLLEVR
ATPG1_ARATH     -ASLRELRDRIDSVKNTQKITEAMKLVAAAKVRRAQEAVVNGRPFSETLVEVLYNILQTDDVDVP-LTXX
ATPG_RHILW      MPSLKDLKNRIASVKATQKITKAMKMVXXXXXXXXXXXXXXXXPYSQRMGAVLANIAKADADGAPTLMTG
ATPG_CLOAB      ------IKRRIKSITNTKKITNAMGLIATSNLRKSRQNLEANKAYYEAFNDXXXXXXXXXXXXXLYVAGN
ATPG_RHISN      MPSLKDLKNRIASVKATQKITKAMKMVXXXXXXXXXXXXXXXXPYSQRMAAVLANIAQAVGADDPALMTG
ATPG_RHIL3      MPSLKDLKNRIASVKATQKITKAMKMVXXXXXXXXXXXXXXXXPYSQRMGAVLANIAKADADGAPTLMTG
ATPG_BRUME      MPSLKDLRNRIASVKATQKITKAMQMVXXXXXXXXXXXXXXXXPYSQRMGAVLANIANVSGEDAPALMVG
ATPG_BRUMB      MPSLKDLRNRIASVKATQKITKAMQMVXXXXXXXXXXXXXXXXPYSQRMGAVLANIANVSGEDAPALMVG
ATPG_BRUAB      MPSLKDLRNRIASVKATQKITKAMQMVXXXXXXXXXXXXXXXXPYSQRMGAVLANIANVSGEDAPALMVG
ATPG_BRUA2      MPSLKDLRNRIASVKATQKITKAMQMVXXXXXXXXXXXXXXXXPYSQRMGAVLANIANVSGEDAPALMVG
ATPG_BRUA1      MPSLKDLRNRIASVKATQKITKAMQMVXXXXXXXXXXXXXXXXPYSQRMGAVLANIANVSGEDAPALMVG
ATPG_SOLUE      MPSLIDIRRRIRSVKNTQQITKAMKMVSAAKLRRAQDRTIAARPYGTLLRKVLGXXXXXXXXXXXXXXXX
ATPG_RHOPS      MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQMAAEAARPYAEKMDXXXXXXXXXXXXXXXXXXXX
ATPG_MYCPU      MPSLQKTKNRIALIDNIKKITKAMELVATSKMKKTQKHFLEVNEFSQSVLDIFSKIVS--QIDPQIKLYP
ATPG_RHIME      MPSLKDLKNRIASVKATQKITKAMKMVXXXXXXXXXXXXXXXXPYSQRMAAVLANIAQAVGADDSAPRLM
ATPG_PARL1      MASLKDLRNRIASVKATQKITKAMQMVXXXXXXXXXXXXXXXXXXXXXMDRVLANLATGMTSDAPALLAG
ATPG_SILST      MPSLKDLKNRISSVKNTRKITKAMQMVXXXXXXXXXXXXXDARPYAERFNAVMAGLAASQSDTAPKLLAG
ATPG_PROA2      MATLKDIRTRIKGVKSTQQVTXXXXXXXXXXXXXXQESAVQARPYAAKLKEMLGSLSTKVDTSNPMLSAR
ATPG_AKKM8      MGNLRDIRRRIKSVKNTSQITRAMQMVASAKMRRAQDQAVKGRPYIRALAEVLYHLQDEIDTSNSPLMQT
ATPG_STRSY      ----------------------AMQMVSASKLAKSEQLAQSFQIYASKVRQITTDLLRASDTSNPMLIRR
ATPG_STRS2      ----------------------AMQMVSASKLAKSEQLAQSFQIYASKVRQITTDLLRASDTSNPMLIRR
ATPG_CLOPS      -AGLLEIKRRIKSIKNTRKITKAMGLVATSKLRKARQKLTENNQYFSSLDEIARELIGXXXXXXXXXXXX
ATPG_CLOPE      -AGLLEIKRRIKSIKNTRKITKAMGLVATSKLRKARQKLTENNQYFSSLDEIARELIGXXXXXXXXXXXX
ATPG_CLOP1      -AGLLEIKRRIKSIKNTRKITKAMGLVATSKLRKARQKLTENNQYFSSLDEIARELIGXXXXXXXXXXXX
ATPG_ZYMMO      MPSLKSLKTRVSSIKSISKITRAMQMVXXXXXXXXXXXXXXXXPYAKRMAQVMSLLAARAAGTPPLLNGR
ATPG_SINMW      MPSLKDLKNRIASVKATQKITKAMKMVXXXXXXXXXXXXXXXXPYSQRMAAVLSNIAQAVGADDPRLMTG
ATPG_DINSH      MPNLKDLKNRIESVKSTRKITKAMQMVXXXXXXXXXXXXXXSRPYTERFNAVLAGLAASDSDSGPRLLVG
ATPG_METC4      MPSLKDLRNRITSVKATQKITKAMQMVXXXXXXXXXXXXENGRPYAERMAQVLGNLAGIGGVGAPRLLSG
ATPG_AZOC5      MASLKDLRNRIASVKATQKITKAMQMVXXXXXXXXXXXXXXXXXXXXXMDSVLGNIASGVTLDTPLLLSG
ATPG_SULDN      MANLKDIQRQIKSVSNTQKTTRAMKLVSTAKLRRAEELAKRSRLYAAKMNQVIAEIAGVGGIDNRCFSKI
ATPG_BACSU      MASLRDXXXXXXXXXXXXXXXXAMQMVSAAKLNRAENNAKSFVPYMDKIQEXXXXXXXXXXXXHPMLLSR
ATPG_ANATD      ----RWIKSRIRSVNETKKITRAMYLISASKVKRLRDRLDSTRPYFEKVNEFMKDLILHGIKTPHILFEK
ATPG_AQUAE      ----RDIKRKIQGIKNTKRITNAMKVVSAAKLRKAQELVYASRPYSEKLYELVGHLAAVDTEDNPLFDVR
ATPG_BUCSC      -------------ISNTKKITKAMEMVSIAKMKKSEIKMKSRKPYLDIIKTIISHLYNHIKYRHLYLNNR
ATPG_AGRVS      MPSLKDLKNRIASVKATQKITKAMKMVXXXXXXXXXXXXXXXXPYSQRMGAVLANIAQAVGSDDGVSTLM
ATPG_BLOPB      MSGLKEIRGKIDSIRNIQKIAKAMEMISVAKIYQTQRRMLISKPYAETIRKVIDHISSGTEYKHSYFLER
ATPG_MESSB      MPSLKDLRNRIASVKATQKITKAMQMVXXXXXXXXXXXXXXXXXXXXXMDAVLANVASISGADAPPLMAG
ATPG_BUCBP      MIGIREIRSKMKSINNTKKITKAMEMVSISKLRKIKKRMCSSRPYFNIINQVISHVITGNLEHYHTYFNQ
ATPG_THETN      ----RDIALRIKSVKEVRKITRAMYLISASKFQKAKGMLDRVRPYYYRVQTVMKDIVTSRYLEKKDVPEK
ATPG_RHILO      MPSLKDLRNRIASVKATQKITKAMQMVXXXXXXXXXXXXXXXXPYSERMGSVLANITQAGGGDAPALMTG
ATPG_LACAC      -ASLLELKRKIASVKQTGKITEAMRMVSASKLNQTENRDKDYTVYNDHVRKTISHLISSQVVDSDMIQPR
ATPG_HELP2      MANLRDIRKKIGSVKNTQKITHAMKLVSTSKLRKAEEVARNSRAYALKLDAVFDDVLSKEDIQSKYFREL
ATPG_PERMH      ----RDIKRKIQGIKNTQRITKAMKAVSXXXXXXXXXXXXXTRPYSERLYDLINDLAMFVDRDHPLLKIR
ATPG_CHLCH      MATLKDIRVRIKGVKSTQQVTXXXXXXXXXXXXXXQDRAIMARPYASKLKEMLASLAKVDTSVNPLFAVR
ATPG_ARCB4      MANLKEIKLKIGSVKNTQKTTKAMKLVSSAKLTRTRQLSEQARSYAHKINDVLSDIAARVSKVQDSFLQN
ATPG_MAGSM      MANLKALKVRIGSVKNTRQITKAMKMVAAAKLRKATEQAESARPYSKRMSRMMHSLAAAAGRDNELLVGR
ATPG_HELPY      MANLRDIRKKIGSVKNTQKITHAMKLVSTSKLRKAEEVARNSRAYALKLDAVFDDVLSKEDIQSKYFREL
ATPG_HELPG      MANLRDIRKKIGSVKNTQKITHAMKLVSTSKLRKAEEVARNSRAYALKLDAVFDDVLSKEDIQSKYFREL
ATPG_PARD8      MGSLKEIKVRIASIRSTQKITAAMKMVSSAKFHHAQTQTEHTLTYANKLSAILNGLLSAEDLDSPYTEQR
ATPG_CLOB8      -AGLLEIKKRIKSVENTRKITNAMGLVATSKLRKTKNELAVNNKFIDITEPVVRNLATTAGEEGSNVYEG
ATPG_CLONN      -------------------------LVATSKLRKARQKLELNNAYYSSVNEIMNGILADKNLEKGIYFKD
ATPG_HELPJ      MANLRDIRKKIGSVKNTQRITHAMKLVSTSKLRKAEEVARNSRAYALKLDAVFDDVLSKEDIQSKYFREL
ATPG_GLUDA      MASLKDLRARIGSVKSTRKITSAMKMVAAAKLRRXXXXXXXXXXXXXXXXXXXXELGASNEAGLPQLLAG
ATPG_BART1      MASLKDLRDRIASVKATQKITKAMQMVXXXXXXXXXXXXXSARPYAKRMADILSXXXXXXXXXXPALMRG
ATPG_METEP      MPSLKDLRNRITSVKATQKITKAMQMVXXXXXXXXXXXXENGRPYAERMAQVLGNLAGIGGVGAPRLLTG
ATPG_LACH4      -ASLLELKKKIASVKQTGKITEAMRMVSASKLNQTEDRDKGYTIYNNHVRKTISRLISSQVVDSDMIQPR
ATPG_HELPS      MANLRDIRKKIGSVKNTQKITHAMKLVSTSKLRKAEEVARNSRAYALKLDAVFDDVLSKEDIQSKYFREL
ATPG_HELPH      MANLRDIRKKIGSVKNTQKITHAMKLVSTSKLRKAEEVARNSRAYALKLDAVFDDVLSKEDIQSKYFREL
ATPG_CAMC5      MSNLKDIKRKIKSVQNTQKTTRAMKLVSTAKLRKAEEAARYSRVYALKINEVLSEIAYKINQYASVVSEK
ATPG_BRAJA      MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQTAAEAARPYADKMSAVISNIXXXXXXXXXXXXXX
ATPG_MYCS5      MSNLINIKNRINVVTNTRKITNAMQLVSTSKLHRIINLTKNIKAYQNLVETTFDNIVSKITQENEIFPPK
ATPG_HELAH      MANLRDIRKKIGSVKNTQKITHAMKLVSTSKLRKAEEVARNSRAYALKLDAVFDDVLSKKDIQSKYFREL
ATPG_WOLSU      -SNLKEIRKKITSVKNTQKTTKAMKLVSTSKLKKAEEMAKRSRVYAERITAVFQEIKAKSGLESPYFTAG
ATPG_MYCPE      MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKS
ATPG_LACBA      --SIHDVQRRINSTKATRQITSAMHMVSTAKLNKIQKQAVGYQDYVSKVKAVVMXXXXXXXXXXXXXXXX
ATPG_CLOK5      ------IKRRIKSITSTQKITKAMGLIATSKLRKVRKKLEANNKYCELFSSIVNELAMEAEQNNIYIKGN
ATPG_CLOK1      ------IKRRIKSITSTQKITKAMGLIATSKLRKVRKKLEANNKYCELFSSIVNELAMEAEQNNIYIKGN
ATPG_RHOSK      MPSLKDLKNRIGSVKNTRKITKAMQMVXXXXXXXXXXXXXXXXXXXXXMTAVMTGLAGSSSESAPRLLAG
ATPG_RHOS1      MPSLKDLKNRIGSVKNTRKITKAMQMVXXXXXXXXXXXXXXXXXXXXXMTAVMTGLAGSSSESAPRLLAG
ATPG_RHOS4      MPSLKDLKNRIGSVKNTRKITKAMQMVXXXXXXXXXXXXXXXXXXXXXMTAVMTGLAGSSSESAPRLLAG
ATPG_METS4      MPSLKDLRNRIASVKATQKITKAMQMVXXXXXXXXXXXXENARPYAERMAAVLGNLATTPGAETPRLLSG
ATPG_RHOS5      MPSLKDLKNRIGSVKNTRKITKAMQMVXXXXXXXXXXXXXXXXXXXXXMTAVMTGLAGSSSESAPRLLAG
ATPG_NITSB      MANLKDIKRKIGSVKNTQKTTRAMKLVSTAKLRRTEELAKRTKYFEDAINATLRQIASSGGIKGRYFEEP
ATPG_CAUSK      MASLKEMRNRIASVKATQKITKAMQMVAAAKLRRSQDAAEAARPYARRLAAVIANLAAGVTGDPPMLAGT
ATPG_PARDP      MPSLKDLKNRIGSVKNTRKITKAMQMVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPRLLAG
ATPG_AMOA5      MPNIKEIVSRINSVHSTQQITKAMKMVAAAKLTKAQHQLLQLRPYAGGLSDILNHVIYSTEAELTKYTQK
ATPG_AGRT5      MPSLKDLKNRIASVKATQKITKAMKMVXXXXXXXXXXXXXXXXPYSQRMSAVLANIATAVEADAPALMTG
ATPG_ACICJ      MASLKALRNRIASVKSTQKITKAMKMVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL
ATPG_UREPA      ------MKRKINSVQTTAKITNAMKLVATAKLKRQRDRLAAIKEYCHDYYDVIGLLLSVVD-DVEFLKIP
ATPG_UREP2      ------MKRKINSVQTTAKITNAMKLVATAKLKRQRDRLAAIKEYCHDYYDVIGLLLSVVD-DVEFLKIP
ATPG_OCHA4      MPSLKDLRNRIASVKATQKITKAMQMVXXXXXXXXXXXXXXXXPYSQRMGAVLANIANVTGEDAPALMAG
ATPG_CLOBA      -AGLIEIKRRIKSVESTRKITNAMGLVATSKLRKTRKELXXXXXXXXXXXXXXXXLASTISQDDDSIYFK
ATPG_CAMC1      MSNLKDIKRKIKSVQNTQKTTRAMKLVSTAKLRKAEEAARYSRVYALKINEVLSEIAASVMTESKFFNTT
ATPG_SPHWW      MASLKALKVRITSVKSTQKITKAMKMVXXXXXXXXXXXXXXGRPYAERLDAVMSSLASKVTVQSPKLLAG
ATPG_CAMFF      MSNLKDIKRKIKSVQNTQKTTKAMKLVSTAKLKKAEEAARHSRVYALKINEVLSEIAKIVGKDDKFFDLK
ATPG_CLOBB      -AGLIEIKRRIKSVESTRKITNAMGLVATSKLRKTRKELXXXXXXXXXXXXXXXXLASTISQDDDSIYFK
ATPG_UREU1      ------IKRKISSVQTTAKITNAMKLVATAKLKRQRDRLAAIKEYCHDYYDVIGLLLSVVN-DIEFLKIP
ATPG_PEDPA      ----QDVKRRIDSTKKTSQITTAMQMVSTAKLSQIQRHTVGYQVYAQKVESIVAHLASDQAISAADLLAQ
ATPG_OPITP      MASTRDIRRRIKSVKNTRQITKAMELXXXXXXXXXXXXXXXGRPYAELMAQMLATLGDVEEAQHPFLVQR
ATPG_CLOTH      MAHINEIKLRMKSIRETRQITNXXXXXXXXXXXXXXXXXXXXSPYFEKVRSTMDILLRSGKIENKYFRDE
ATPG_CAMHC      MANLKDIKLKIKSVSNTEKTTKAMKLVSNVKLKKAKDFAKQSKAYAIKINELLSEISAKSFADDKFFDTN
ATPG_AZOPC      MPSLKEIKERITSIKSTQKITSAMKMLASSKLKKAQYQMNCFLPYQRKLNAMLNSFLFCITDFKSDLTKK
ATPG_HYDS0      ----RDIKSKIAGIKNTMRITNAMKVVSAAKLRKAQEAIFKARPYSDKLYELMAHLAHIDTYSHPLFKRR
ATPG_MESFL      MANLSNLKTQISNTQDIGKITNAMQLVASAKLRRIGKKVTETQEYVSEVYAIFNEIIKHSSESIYLKNSA
ATPG_HELHP      ---LKNIKRQISSTKNTQKTTKAMKLVSSSKLKKAEELARRSKVYAKQLSAVFHRVRGLDNINSRYFAKS
ATPG_CAMLR      MSNLKEIKRKIKSVHNTQKTTNAMKLVSTXXXXXXXXXXXXXXXXXQKIDEVLSEIAQYEGLDDPFFRKK
ATPG_HYPNA      MPSLKDLKNRIGSVKSTQKITKAMQLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTGQGGPKLLTG
ATPG_BEII9      MPSLKDLRNRIASVKATQKITKAMQMVASXXXXXXXXXXXXXXXXXXXMDEVLASLASGTGPDAPKLLAG
ATPG_OENOE      MASLQDIRRRIDSTKKTSQITSAMQMVSSSKLIQIQKHTSGYLDYANXXXXXXXXXXNGSSI--PFITQR
ATPG_OENOB      MASLQDIRRRIDSTKKTSQITSAMQMVSSSKLIQIQKHTSGYLDYANXXXXXXXXXXNGSSI--PFITQR
ATPG_WOLWR      MKSLKELSLRIKNIRSVQKTTKIMQMVSAAKLLQSQKKLSNSKLYISKLHSIISSLML--SVDQELLAKI
ATPG_RHOPB      MASLKDMRVRIASTKATQKITKAMQMVAASKXXXXXXXXXXXXXXXXXMDXXXXXXXXXXXXXXXXXXXX
ATPG_MYCMS      MPNLKGLKTEILSVKNISRITNAMQLVALAKLRKISKKVIDTHNYVSEVYSLFNDIISQVDKSVFLKDSN
ATPG_ERYLH      MASLKELKDRIGSVKSTQKITKAKQMVXXXXXXXXXXXXXXXXXXXXXLADVMASLAGKVSGDSPRLLAG
ATPG_WOLPM      MKSLKELSLRIKNIRSVQKTTKIMQMVSAAXXXXXXXXXXXXXXYVSKLHNIIFSLML--SVDQELLAKI
ATPG_RHOP5      MASLKDMRVRIASTKATQKITKAMQMVAASKXXXXXXXXXXXXXXXXXMDXXXXXXXXXXXXXXXXXXXX
ATPG_LACGA      --SLLELKKKIASIQKTGQITEAMRMVSGVKLNRTEKLDQEYTIYNDKVRATVSHLMSSASIDYSLVQPR
ATPG_METI4      MATTXXXXXXXXXXKNTAQITKAMQMVAASKMRKAQQRAIEGRPYHSLFQEIVHSLIQAGQLIHPLLEAR
ATPG_BRASB      MASLKDMRVRIASTKATQKITKAMQMVAASKLXXXXXXXXXXXXXXEKMDAVIXXXXXXXXXXXXXXKLL
ATPG_WOLTR      MKSLKELSLRIKNIRSVQKTTKIMQMVSAAKLLQSQKKLSNSKLYISKLHDIISSIMS--SADQELLAKT
ATPG_EHRCR      MANLKALLLRIKSVKSIQKTTKVMQMISAAKLHRVQQKLENAKKHLLELSSIVDYVPSDGVHNCASIAKK
ATPG_XANP2      MASLKDLRNRIASVKATQKITKAMQMVXXXXXXXXXXXXXXXXXXXXXMDTVLGNLAAGGAGQAPVLIAG
ATPG_BRASO      MASLKDMRVRIASTKATQKITKAMQMVAASKLXXXXXXXXXXXXXXEKMDAVIXXXXXXXXXXXXXXKLL
ATPG_DICTD      MPTLQGLRRKVKTIQNISHIIHSMETLSMVKIRALQDKSLRLKPYTEELNNILMELITREYLNHPLIRER
ATPG_EHRCJ      MANLKALLLRIKSVKSIQKTTKVMQMISAAKLHRVQQKLENARKHLLEISNVIDSVDKDNVSDVFSKHKK
ATPG_CAMJE      MSNLKEIKRKIKSVHNTQKTTNAMKLVSTXXXXXXXXXXXRSKIYAQKIDEILSEISNEDDVRLSLFHKK
ATPG_RICCK      MSNLKQLRTRIKSVKSTQKITKAMQLVSASKMTKIKSQIANSNFYIEAISKMMSAILAIDSIEGQKFFNT
ATPG_CLOBJ      ------IRRRIKSVTNIRKITKAMGLVSTAKLRKARVNLEINKKYYNEYKIILKDIINFIE-DSNIYIDG
ATPG_RICTY      MSNLKQLRTRIKSVKSTQKITKAMQLVSASKMTKIKTQIANSNFYIEAINKMMSNIFSMTSIEEQKFFNT
ATPG_MYCGA      MASMQDLKRRMESITVTHKITKAMKMLSTVKLNRFKATLGKTKEFYQEFYEVIGAVIXXXXXXXXXXXXX
ATPG_DICDI      MATLKDLKIRLGTVKTISKLTKTLHMVASSKLRSAEKKAEESGPYSVGPQKVLGVVETADAFNTATEPIE
ATPG_CLOBH      ------IRRRIKSVTNIRKITKAMGLVSTAKLRKARVNLEINKKYYNEYKIILKDIINFIE-DSNIYIDG
ATPG_CLOB1      ------IRRRIKSVTNIRKITKAMGLVSTAKLRKARVNLEINKKYYNEYKIILKDIINFIE-DSNIYIDG
ATPG_MYCCT      MPNLSGLKTEISSVRNISKITNAMQLVASAKLRKISKKVIDTHNYVSEVYSLFNDIIRQTDKSVFLKESN
ATPG_EHRRG      MANLKALFLRMKSVKSIQKTTKVMQMISAAKLRQVQQRLNNARMHMLELSKIIDTNVVSKNNE---CTDR
ATPG_CLOB6      ------IRRRIKSVTNIRKITKAMGLVSTAKLRKARVNLEINKKYYNEYKIILKDIINFIE-DRNIYIDG
ATPG_CLOBL      ------IRRRIKSVTNIRKITKAMGLVSTAKLRKARVNLEINKKYYNEYKVILKDIINFIE-DSNIYIDG
ATPG_CLOBK      ------IRRRIKSVTNIRKITKAMGLVSTAKLRKARVNLEINKKYYNEYKVILKDIINFIE-DSNIYIDG
ATPG_SPHAL      MASLKELKGRIVSVKSTQKITKAKKMVXXXXXXXXXXXXXXXXXXXXXXXGVVASLASGASDSAPKLLSG
ATPG_CLOBM      ------IRRRIKSVTNIRKITKAMGLVSTAKLRKARLNLEINKKYYNEYKVILKDIINFIE-DSNIYIDG
ATPG_NOVAD      MASLKELKGRINSVKSTQKITKAKQMVXXXXXXXXXXXXXXXXXXXXXXXEVMGSLAAAGQDNGPLLMRG
ATPG_RICPR      MSNLKQLRTRIKSVKSTQKITKAMQLVSASKMTKIKTQIANSNFYIEAINKMMSDICSMTSCELSIEEQK
ATPG_HALOH      METMRDIKRRINSIKNTQKITXXXXXXXXXXXXXXXXXXENARPFFEKTRSILIDVARRTRQKHPLLREK
ATPG_CAMJR      MSNLKEIKRKIKSVHNTQKTTNAMKLVSTXXXXXXXXXXXRSKIYAQKIDEILSEISNEDDVRLSLFHKK
ATPG_CAMJ8      MSNLKEIKRKIKSVHNTQKTTNAMKLVSTXXXXXXXXXXXRSKIYAQKIDEILSEISNEDDVRLSLFHKK
ATPG_LACJO      --SLLELKKKIASIQKTGQITEAMRMVSGVKLNRTEKLDQEYTIYNDKVRATVSHLMSSSNIDYSLVQPR
ATPG_WOLPP      MKSLKELSLRIKNIKSVQKITKIMQMVSAAKLLQSQKKLSNXXXXXXXXQELLARILNINNEDSFL----
ATPG_CAMJJ      MSNLKEIKRKIKSVYNTQKTTNAMKLVSTXXXXXXXXXXXRSKIYAQKIDEILSEISQINKIVHNLFHKK
ATPG_CAMJD      MSNLKEIKRKIKSVHNTQKTTNAMKLVSXXXXXXXXXXXXRSKIYAQKIDEILSEISNEDDMRLSLFHKK
ATPG_RICCN      MSNLKQLRTRIKSVKSTQKITKAMQLVSASKMAKIKSQIANSNFYIEAVSKMMSAILSIDSIEEQKFFNT
ATPG_RICBR      MSNLKQLRTRIKSVKSTQKITKAMQLVSASKLTKIKNQIAHSNFYVEAISKMMSTVLSADIYDFPIEAQK
ATPG_EHRRW      MANLKALFLRMKSVKSIQKTTKVMQMISAAKLRQVQQRLNNARMHMLELSKIIDTNVVTKNNECTGPHNK
ATPG_RICRS      MSNLKQLRTRIKSVKSTQKITKAMQLVSASKMAKIKSQIANSNFYIEAVSKMMSAILSIDSIEEQKFFNT
ATPG_RICRO      MSNLKQLRTRIKSVKSTQKITKAMQLVSASKMAKIKSQIANSNFYIEAVSKMMSAILSIDSIEEQKFFNT
ATPG_RICFE      MSNLKQLRTRIKSVKSTQKITKAMQLVSASKMAKIKSQIANSNFYIEAISKMMSDILSIDSIEEQKFFNT
ATPG3_ARATH     ------VRNRMKSVKNIQKITKAMKMVAASKLRAVQGRA--------ENSRGLWQPFTALLGDNPSI---
ATPG_RICAE      MSNLKQLRTRIKSVKSTQKITKAMQLVSASKMAKIKSQIANSNFYIEAVSKMMSAILSIDSIEEQKFFNT
ATPG_MACFA      MATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARIYG---------LGSLALYEKADIKVP
ATPG_ELUMP      MESLKDIRDNIKSVQSTQQVMVTMKMISSARIKKAQNAMLNARPFSLGLEGVIDDLRKDNSFKDPDLKPD
ATPG_PONAB      MATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARIYG---------LGSLALYEKADIKGP
ATPG_RICPU      MSNLKQLRTRIKSVKSTQKITKAMQLVSASKMAKIKSQIANSNFYIEAVSKMMSAILSIDSIEEQKFFNT
ATPG_RICAH      MSHLKQLRTRIKSVKSTQKITKAMQLVSASKMAKIKSQIAKSNFYIEAISKMMSDIVSIDSIEEQKFFNT
ATPG_MOUSE      MATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYG---------TGSLALYEKADIKAP
ATPG_KLULA      -ATLREIETRLKSIKNIEKITKTMKIVASTRLSKAERAKNSAKEYA------LADAAFYKNAETVPLEDA
ATPG_HUMAN      MATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARIYG---------LGSLALYEKADIKGP
ATPG_RICB8      MSNLKQLRTRIKSVKSTQKITKAMQLVSASKLTKIKNQIAHSNFYVEAISKMMSTVLSADIYDFPIEAQK
ATPG_MYCMO      MAELQKLSSRLKSVKVTRKITKAMELVAASKIRRAKESFFSNKEYFQIIQDIFDNLASKTELKKQMKFDK
ATPG_MYCGE      MAFIQEIKRRMNTVKSTIKITNAMKMVSRAXXXXXXXXXXEISLFFNEFYKAVGQVVV--SLKEP--KKK
ATPG3_IPOBA     ------VRNRMKSVKNIQKITKAMKMVAASKLRAIQTRA--------ENSRGLWQPFTALLGDTPSVDV-
ATPG_RAT        -ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYG---------TGSLALYEKAEIKGP
ATPG_BOVIN      MATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYG---------VGSLALYEKADIKTP
ATPG_BUCMH      MSEIKEVRNKIKCITNTQKITKAMEMVSISKMKKAEVKMNSGRPYLKTIKEIINNFISNNTRYQHVYLEQ
ATPG_MYCAP      MSSIQSIQSRIKTVQSIRKITHAMELVSYSKLKKAKTAFDEVEKYNLLIDQTFNKIFENISHDKELMKSR
ATPG_DROME      MATLKMISIRLKSVKNIQKITQSMKMVSAAKYARAERDLKAARPYGIGAQQFFEKT--------EIQPDE
ATPG_DICT6      MPTLQTLRRKVKTIQNITHIVHSMETLSMVKIRALQDRSLRLKPYTEELNNILMELVKRLSLNHPLVKER
ATPG_YEAST      -ATLKEVEMRLKSIKNIEKITKTMKIVASTRLXXXXXXXXXXXXM-DEAEQLFYKNAETKNLD--VEATE
ATPG_SCHPO      -ATLKEIEQRLKSXXXXXXXXXXXXXVAQTKLTRAQRAMEASNKY----YRVSDEVFKEAGTKAP-----
ATPG_VIGUN      ----------------------------------------------------------------------
ATPG_MYCPN      MAFIQEIKRKMTTVQSTIKITNAMKMVSRAKFVRFKKQFKEVNYFFNEFYKAVGQVVSLKKMPKPL----


                         .         .         *         .         .         .         .:140
query           EGGKRAAVLVVTSDRGMAGGYNHNVXXXXXXXXXXXXXSGYEVVRYVTGKKGVDYYKFRAEDVAGAWTGF
ATPG_CORGB      EGGKRAAVLVVTSDRGMAGGYNHNVXXXXXXXXXXXXXSGYEVVRYVTGKKGVDYYKFRAEDVAGAWTGF
ATPG_CORGL      EGGKRAAVLVVTSDRGMAGGYNHNVXXXXXXXXXXXXXSGYEVVRYVTGKKGVDYYKFRAEDVAGTWTGF
ATPG_COREF      EGGKRAAVLVVSSDRGMAGGYNHNVFXXXXXXXXXXXXQGYEVVRYVTGSKGVGYYKFREDYVAGAWTGF
ATPG_CORDI      EGGKRAAVLVVSSDRGMAGGYNYNVFXXXXXXXXXXXXNGYEVVRYVTGNKGVGYYKFRGQEVAGAWTGF
ATPG_CORJK      TDASRAAILVVSSDRGMCGGYNNNVFKKTAELRKRLENEGKDVVLYVSGNKGISYYNFRGEDIAGAWSGY
ATPG_CORU7      KDPKRAAILVVSSDRGMCGGYNNNVFKTTAELRKLLEDEGKEVVLYVLGSKGVTYYNFRNENISGSWTGH
ATPG_NOCFA      PNPRRAAVLVITSDSGMCGGYNSNVLKRAEELMTTLRNEGKEPVLYVMGAKGLTYYTFRNRPFVSAWTGF
ATPG_RHOSR      TDPKRAAVLVVTSDRGMCGGYNSNVLKEAEELFQLLRSEGKDPVIYVLGSKGLGYYTFRGRDLGGAWTGF
ATPG_RHOOB      TDPKRAAVLVVTSDRGMCGGYNSNVLKEAEELFQLLRSEGKDPVIYVLGSKGLGYYTFRDRDLGGAWTGF
ATPG_SACEN      ENPKRAGVLVVTSDRGFCGGYNANVLRAAEELQTLLREQGKTPVLYVVGRKGEAYYRFRQREIAKSWTGF
ATPG_MYCVP      ENPRRAAVLVVSSDRGLCGAYNANVLRQAEELFSLLREEGKEPVLYTVGRKALGYFSFRQREVVESWAGF
ATPG_MYCS2      KQPKRAGVLVVSSDRGLCGAYNANVLRRAEELFSLLRDEGKDPVLYVVGRKALGYFSFRQRTVVESWTGF
ATPG_MYCTU      PEPKRAGVLVVSSDRGLCGAYNANIFRRSEELFSLLREAGKQPVLYVVGRKAQNYYSFRNWNITESWMGF
ATPG_MYCTA      PEPKRAGVLVVSSDRGLCGAYNANIFRRSEELFSLLREAGKQPVLYVVGRKAQNYYSFRNWNITESWMGF
ATPG_MYCBT      PEPKRAGVLVVSSDRGLCGAYNANIFRRSEELFSLLREAGKQPVLYVVGRKAQNYYSFRNWNITESWMGF
ATPG_MYCBP      PEPKRAGVLVVSSDRGLCGAYNANIFRRSEELFSLLREAGKQPVLYVVGRKAQNYYSFRNWNITESWMGF
ATPG_MYCBO      PEPKRAGVLVVSSDRGLCGAYNANIFRRSEELFSLLREAGKQPVLYVVGRKAQNYYSFRNWNITESWMGF
ATPG_STRGG      ETPTRAAVLLVTSDRGLAGGYSSNAIKAAERLRERLASEGKEVDTYIVGRKGVAYYGFRERKVEDSWTGF
ATPG_STRAW      ETVTRSAVLLLTSDRGLAGAFNSNAIKAAEQLTARLEAEGREVDTYIVGRRGAAHYNFRERKVTELWTGF
ATPG_NOCSJ      ENSQRVAMLIVTSDRGLAGAYSSSVLKEAERLAEKLRGEGKTIDVYLCGRKGEAYHRFRNRPVVRSWTGF
ATPG_MYCGI      ENPRRAAVLVVSSDRGLCGAYNANVLRQSEELFALLREEGKEPVVYTVGRKAQGYFNFRQREVTESWSGF
ATPG_STRCO      DSPSRAAVLLLTSDRGLAGAFNSNSIKAAEQLTERLEREGRQVDTYIVGRRGLAHYNFRERKVVESFAGF
ATPG_MYCMM      PQPKRAGVLVVSSDRGLCGAY