[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF54313.1

[Show Plain Result]


## Summary of Sequence Search
    1::123
    1::123     2e-50 100%  123 aa  RBSD_CORGB RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::123     4e-47  97%  123 aa  RBSD_CORGL RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::127     1e-24  47%  127 aa  RBSD_PROAC RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     5e-21  43%  131 aa  RBSD_CLONN RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     9e-21  42%  131 aa  RBSD_CLOTE RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     2e-20  46%  131 aa  RBSD_CLOBB RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     7e-19  52%  131 aa  RBSD_CLOBA RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::129     9e-19  41%  129 aa  RBSD_BACHD RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     1e-18  54%  136 aa  RBSD_GEOKA RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::129     6e-18  39%  129 aa  RBSD_BACSK RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     7e-18  41%  139 aa  RBSD_PHOPR RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     9e-18  41%  131 aa  RBSD_COPPD RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     3e-17  41%  139 aa  RBSD_VIBF1 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     5e-17  41%  139 aa  RBSD_VIBFM RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     5e-17  39%  131 aa  RBSD_BACCR RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::130     6e-17  38%  130 aa  RBSD_BACP2 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     6e-17  39%  131 aa  RBSD_BACC4 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::130     8e-17  38%  130 aa  RBSD_THETN RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::130     8e-17  38%  130 aa  RBSD_THEPX RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::130     8e-17  38%  130 aa  RBSD_THEP3 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     8e-17  37%  131 aa  RBSD_LACPL RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     8e-17  51%  131 aa  RBSD_CLOPS RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     8e-17  53%  131 aa  RBSD_CLOP1 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     1e-16  42%  139 aa  RBSD_VIBPA RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::129     1e-16  39%  129 aa  RBSD_STAHJ RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     1e-16  51%  132 aa  RBSD_GEOTN RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     1e-16  38%  131 aa  RBSD_BACC2 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     2e-16  53%  131 aa  RBSD_CLOPE RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-16  41%  139 aa  RBSD_ALISL RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     3e-16  38%  139 aa  RBSD_VIBVY RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     3e-16  38%  139 aa  RBSD_VIBVU RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     3e-16  37%  131 aa  RBSD_BACCN RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     4e-16  38%  139 aa  RBSD_VIBCH RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     4e-16  38%  139 aa  RBSD_VIBC3 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     4e-16  46%  131 aa  RBSD_BACC1 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     5e-16  37%  131 aa  RBSD_LACAC RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     5e-16  38%  131 aa  RBSD_BACWK RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     9e-16  41%  139 aa  RBSD_SHEHH RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::138     9e-16  38%  138 aa  RBSD_PSYIN RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::130     9e-16  44%  130 aa  RBSD_HELMI RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     9e-16  39%  139 aa  RBSD_ERWCT RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     9e-16  40%  139 aa  RBSD_ECO27 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     9e-16  40%  131 aa  RBSD_BACHK RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     9e-16  50%  131 aa  RBSD_BACCZ RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     9e-16  40%  131 aa  RBSD_BACCQ RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     9e-16  40%  131 aa  RBSD_BACC7 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     9e-16  40%  131 aa  RBSD_BACC0 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     9e-16  40%  131 aa  RBSD_BACAN RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     9e-16  40%  131 aa  RBSD_BACAC RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     9e-16  40%  131 aa  RBSD_BACAA RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::129     9e-16  47%  129 aa  RBSD1_RUBXD RecName: Full=D-ribose pyranase 1;         EC=5.5.1.n1;
    1::131     1e-15  42%  131 aa  RBSD_LARHH RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::135     2e-15  37%  135 aa  RBSD_RHOBA RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::129     2e-15  37%  129 aa  RBSD_EXIS2 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_SHISS RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_SHIFL RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_SHIF8 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_SHIBS RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_SHIB3 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_ESCF3 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_ECOSM RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_ECOLU RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_ECOLI RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_ECOLC RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_ECOL6 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_ECOHS RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_ECODH RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_ECOBW RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_ECO7I RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_ECO5E RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_ECO57 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-15  40%  139 aa  RBSD_ECO55 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     2e-15  40%  131 aa  RBSD_BACC3 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     2e-15  39%  131 aa  RBSD_BACAH RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     3e-15  42%  139 aa  RBSD_PROMH RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     3e-15  36%  131 aa  RBSD_PEDPA RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     3e-15  39%  139 aa  RBSD_HAEIN RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     3e-15  39%  139 aa  RBSD_HAEIG RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     3e-15  40%  139 aa  RBSD_ECOSE RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     3e-15  41%  139 aa  RBSD_ECOL5 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     3e-15  40%  139 aa  RBSD_ECO8A RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     3e-15  41%  139 aa  RBSD_ECO81 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     3e-15  40%  139 aa  RBSD_ECO24 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::132     3e-15  40%  132 aa  RBSD_CHRVO RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     3e-15  37%  139 aa  RBSD_DESAD RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     4e-15  38%  132 aa  RBSD_LACLM RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     4e-15  34%  131 aa  RBSD_ENTFA RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     6e-15  39%  139 aa  RBSD_VIBHB RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::129     6e-15  37%  129 aa  RBSD_STAS1 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     6e-15  37%  131 aa  RBSD_OCEIH RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     6e-15  38%  132 aa  RBSD_LACLA RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     6e-15  36%  131 aa  RBSD_LACF3 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::130     7e-15  38%  132 aa  RBSD_STRU0 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     7e-15  40%  139 aa  RBSD_SERP5 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::129     1e-14  37%  129 aa  RBSD_EXISA RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     1e-14  39%  139 aa  RBSD_ECOUT RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     1e-14  39%  139 aa  RBSD_ECOK1 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     1e-14  39%  139 aa  RBSD_ECO45 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-14  37%  139 aa  RBSD_CITK8 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-14  40%  139 aa  RBSD_SHEPA RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::130     3e-14  36%  132 aa  RBSD_STRA5 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::130     3e-14  36%  132 aa  RBSD_STRA3 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     3e-14  42%  139 aa  RBSD_PECCP RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::135     3e-14  35%  135 aa  RBSD_NATTJ RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     3e-14  36%  139 aa  RBSD_ENT38 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::130     4e-14  35%  132 aa  RBSD_STRA1 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     4e-14  38%  139 aa  RBSD_HAEIE RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     4e-14  38%  139 aa  RBSD_HAEI8 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::129     5e-14  33%  129 aa  RBSD_STRCO RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     5e-14  37%  132 aa  RBSD_LACLS RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     5e-14  37%  139 aa  RBSD_HAEPS RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     5e-14  37%  139 aa  RBSD_EDWI9 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     6e-14  38%  139 aa  RBSD_YERPY RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     6e-14  38%  139 aa  RBSD_YERPS RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     6e-14  38%  139 aa  RBSD_YERPP RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     6e-14  38%  139 aa  RBSD_YERPN RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     6e-14  38%  139 aa  RBSD_YERPG RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     6e-14  38%  139 aa  RBSD_YERPE RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     6e-14  38%  139 aa  RBSD_YERPB RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     6e-14  38%  139 aa  RBSD_YERPA RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     6e-14  38%  139 aa  RBSD_YERP3 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::128     6e-14  41%  128 aa  RBSD_THEAB RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     1e-13  34%  131 aa  RBSD_OENOB RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     1e-13  37%  131 aa  RBSD_BACLD RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     1e-13  36%  131 aa  RBSD_BACA2 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     1e-13  37%  139 aa  RBSD_KLEP7 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     1e-13  37%  139 aa  RBSD_KLEP3 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     1e-13  36%  139 aa  RBSD_ACTSZ RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-13  37%  139 aa  RBSD_SALTY RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-13  37%  139 aa  RBSD_SALSV RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-13  37%  139 aa  RBSD_SALPK RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-13  37%  139 aa  RBSD_SALPC RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-13  37%  139 aa  RBSD_SALPA RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-13  37%  139 aa  RBSD_SALNS RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-13  37%  139 aa  RBSD_SALHS RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-13  37%  139 aa  RBSD_SALG2 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-13  37%  139 aa  RBSD_SALEP RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-13  37%  139 aa  RBSD_SALDC RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-13  37%  139 aa  RBSD_SALCH RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     2e-13  37%  139 aa  RBSD_SALA4 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     2e-13  33%  131 aa  RBSD_LACRJ RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     2e-13  33%  131 aa  RBSD_LACRD RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     3e-13  36%  139 aa  RBSD_SALAR RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::130     3e-13  33%  130 aa  RBSD_LACCB RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::130     3e-13  33%  130 aa  RBSD_LACC3 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     4e-13  45%  139 aa  RBSD_SALTI RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::58      4e-13  52%  139 aa  RBSD_PASMU RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     4e-13  33%  131 aa  RBSD_LACBA RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     4e-13  37%  139 aa  RBSD_ENTS8 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     4e-13  37%  131 aa  RBSD_CHLAD RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     5e-13  40%  139 aa  RBSD_ACTP7 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     7e-13  37%  139 aa  RBSD_YERE8 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::132     7e-13  39%  132 aa  RBSD_PSEPW RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     7e-13  39%  139 aa  RBSD_ACTPJ RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     7e-13  39%  139 aa  RBSD_ACTP2 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     9e-13  36%  139 aa  RBSD_SALPB RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     9e-13  38%  139 aa  RBSD_PHOLL RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     9e-13  31%  131 aa  RBSD_LACSS RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     9e-13  36%  139 aa  RBSD_HAES2 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::132     1e-12  36%  132 aa  RBSD_VARPS RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     1e-12  37%  134 aa  RBSD_PSEE4 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::130     2e-12  43%  130 aa  RBSD_DESRM RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     2e-12  35%  131 aa  RBSD_BACSU RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     2e-12  46%  131 aa  RBSD_SYMTH RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     2e-12  36%  134 aa  RBSD_PSEU2 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     2e-12  34%  134 aa  RBSD_PSEPF RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     2e-12  36%  134 aa  RBSD_PSE14 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     3e-12  36%  134 aa  RBSD_PSESM RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     3e-12  37%  139 aa  RBSD_AERS4 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::132     5e-12  37%  132 aa  RBSD_PSEPG RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::132     8e-12  36%  132 aa  RBSD_PSEPK RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::132     8e-12  36%  132 aa  RBSD_PSEP1 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     8e-12  33%  131 aa  RBSD_LACJO RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     1e-11  36%  134 aa  RBSD_PSEFS RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     1e-11  35%  139 aa  RBSD_HAES1 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     2e-11  33%  131 aa  RBSD_LACGA RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     4e-11  36%  134 aa  RBSD_PSEF5 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::131     4e-11  31%  131 aa  RBSD_PETMO RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::139     9e-11  36%  139 aa  RBSD_AERHH RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::51      9e-11  57%  129 aa  RBSD2_STRGG RecName: Full=D-ribose pyranase 2;       
    1::58      2e-10  47%  151 aa  RBSD1_STRGG RecName: Full=D-ribose pyranase 1;       
    1::132     4e-10  40%  140 aa  RBSD_THELT RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     6e-10  33%  134 aa  RBSD_STAAT RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     6e-10  33%  134 aa  RBSD_STAA3 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     7e-10  33%  134 aa  RBSD_STAAW RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     7e-10  33%  134 aa  RBSD_STAAS RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     7e-10  33%  134 aa  RBSD_STAAR RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     7e-10  33%  134 aa  RBSD_STAAN RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     7e-10  33%  134 aa  RBSD_STAAM RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     7e-10  33%  134 aa  RBSD_STAAE RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     7e-10  33%  134 aa  RBSD_STAAC RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     7e-10  33%  134 aa  RBSD_STAAB RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     7e-10  33%  134 aa  RBSD_STAA9 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     7e-10  33%  134 aa  RBSD_STAA8 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     7e-10  33%  134 aa  RBSD_STAA2 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     7e-10  33%  134 aa  RBSD_STAA1 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     1e-09  30%  134 aa  RBSD_STACT RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::135     2e-09  31%  135 aa  RBSD_THENN RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::135     2e-09  31%  135 aa  RBSD_THEMA RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::130     4e-09  39%  130 aa  RBSD_ACIAC RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::58      4e-09  41%  154 aa  RBSD2_RUBXD RecName: Full=D-ribose pyranase 2;       
    1::132     5e-09  37%  132 aa  RBSD_KOSOT RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     1e-08  32%  134 aa  RBSD_STAES RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::134     1e-08  32%  134 aa  RBSD_STAEQ RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::49      2e-07  41%  135 aa  RBSD_THEP1 RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
    1::129     4e-07  32%  129 aa  RBSD_STRAW RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;
   10::36      8e-04  52%  154 aa  CJ125_HUMAN RecName: Full=Protein fucU homolog;
    1::123

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKSGLLNPDLCYAIARLGHTDTWAVADCGLPIPEHVEIIDLALVFGIPTFEQVLNALKPXXXXXXXXXX
RBSD_CORGB      MKKSGLLNPDLCYAIARLGHTDTWAVADCGLPIPEHVEIIDLALVFGIPTFEQVLNALKPXXXXXXXXXX
RBSD_CORGL      MKKSGLLNPDLCYAIARLGHTDTWAVADCGLPIPEHVEIIDLALVFGIPTFEQVLNALKXXXXXXXXXXX
RBSD_PROAC      MKKSGLLNPQLCAAVARLGHTQTFVVADAGLPIPHEVPVIDLAVVLGTPRFQEVFDAILDEVVVDGATIA
RBSD_CLONN      MKKTPLLNSSICEVVSKMGHTDMIAIGDSGLPIPDDTKRIDLALIKGVPTFMQTLKAVLLEQQVEEVIIA
RBSD_CLOTE      MKKIGILNNEISHVISKMGHTDSLAIGDCGLPIPEETKRIDLALIKNIPTFMDTLKSVMMELQVEEVQIA
RBSD_CLOBB      MRKTALLNSDLSSVISKMGHTDMIAIGDCGLPIPAESERIDLALIKGIPTFMQTLKTLQIEEVILAKETE
RBSD_CLOBA      MRKTALLNSNLSSVISKMGHTDMIAIGDCGLPIPDESERIDLALIKGIPTFMXXXXXXXXXXXXXXXXXX
RBSD_BACHD      MKKHGVLNRDIARILASLGHTDQIVIADCGLPIPEDVECIDVSLKQGVPSFVEVLAEILADMEVEGLIAA
RBSD_GEOKA      MKKSGILNKELNTLLASLGHTDTIVIADCGLPIPNEQARIDLSLVKGFPPFLSVLDAVVDXXXXXXXXXX
RBSD_BACSK      MKKLGILNRDIARVLASLGHTDQIVIADCGLPIPSNVECIDLSIRLGVPNFTEVLADMEVELMMAATEVR
RBSD_PHOPR      MKKNALINAELSYVVATLGHTDEITICDAGLPIPDETQRIDLALIPGVPTFKAVLGEMQIEGVVMAEEFA
RBSD_COPPD      MKKTILINSRLSEVIASMGHTDTIAIADSGLPIPKGVERIDLALTRDIPRFLDTLRVILSELCVEEAIIA
RBSD_VIBF1      MKKNTLLNSELSYVIATLGHTDEITICDAGLPIPDASQRIDLALIQGIPTFKATLTEMQIEGVIVAEEFK
RBSD_VIBFM      MKKNTLLNSELSYIIATLGHTDEITICDAGLPIPDASQRIDLALIQGIPTFIDTVKAMQIEGVIVAEEFK
RBSD_BACCR      MKKHGVLNSEIAAVLASLGHTDTVVIADCGLPIPDGVKRIDLAVEIGKPSFLEVLQVVATLAEEVIINNA
RBSD_BACP2      MKKNGILNSHIAKVLADLGHTDTIVIADCGLPIPEGPVKIDLSLTIGTPSFQEVTSLLLQEMAVEHITVA
RBSD_BACC4      MKKHGVLNSEIAAVLASLGHTDTIVIADCGLPIPDGVKRIDLAVEIGKPSFLDVLQVVATLAEEVIINNA
RBSD_THETN      MKKTELLNSEISEVVARLGHKDLLVIADSGLPIPDNVKRIDIALTKGIPSFRDTLNTVKAYVAREMIDKN
RBSD_THEPX      MKKTYLLNSEISEVVARLGHTDLLVIADSGLPIPDGVKRIDIALTKGIPSFKDTLNTVLTELGVEKAYIA
RBSD_THEP3      MKKTYLLNSEISEVVARLGHTDLLVIADSGLPIPDGVKRIDIALTKGIPSFKDTLNTVLTELGVEKAYIA
RBSD_LACPL      MKKTKVINSDLSRVIATMGHFDKLSIGDAGMPVPSSTEKIDLAVDNGIPSFMQVLNELEVQRIYLAEEIK
RBSD_CLOPS      MRKTXXXXXXXXXXXXKMGHTDMLAIGDCGLPIPKETERIDLALIKGVPGFIETLKAIXXXXXXXXXXIA
RBSD_CLOP1      MRKTXXXXXXXXXXXXKMGHTDMLAIGDCGLPIPKETERIDLALIKGVPGFIETLKAIXXXXXXXXXXIA
RBSD_VIBPA      MKKSTLINSGISYLVATLGHTDEITICDAGLPIPDHVQRIDLALTHGVPSFRVILSESQIEGVIIAEEFS
RBSD_STAHJ      MYKTGILNSDISKVLSDLGHTDQIVIADCGLPVPKDVKKIDLALTLGQPSFLEVYEVLKQHMEIEHVTIA
RBSD_GEOTN      MKKNGILNKELNTLLASLGHTDTIVIADCGLPIPNEEARIDLALVKGFPPFLSVLDXXXXXXXXXXXXXX
RBSD_BACC2      MKKHGVLNSEIAAVLASLGHTDTVVIADCGLPIPDGVKRIDLAVEIGKPSFLEVLQVVATLAEEVIINNA
RBSD_CLOPE      MRKTXXXXXXXXXXXXKMGHTDMLAIGDCGLPIPKETERIDLALIKGVPGFIETLKAIXXXXXXXXXXIA
RBSD_ALISL      MKKNTLLNAELSYIIASLGHTDEITICDAGLPIPDRSQRIDLALIQGIPTFIDTVKAMQIEGVIVAQEFK
RBSD_VIBVY      MKKSALLNSELSYLVATLGHTDEITICDAGLPIPDGVSRIDLALTHGVPSFIETVRVMEVSPELYQALVA
RBSD_VIBVU      MKKSALLNSELSYLVATLGHTDEITICDAGLPIPDGVSRIDLALTHGVPSFIETVRVMEVSPELYQALVA
RBSD_BACCN      MKKHGVLNSEIAAILAALGHTDTIVIADCGLPIPDSVKRIDLAVELGKPSFLDVLQVVIEDMAIEKVTVA
RBSD_VIBCH      MKKSTLLNSELSYLVATLGHTDEITICDAGLPIPDEVTRIDLALTHGVPSFLETVRVIQVSPVLHEALYR
RBSD_VIBC3      MKKSTLLNSELSYLVATLGHTDEITICDAGLPIPDEVTRIDLALTHGVPSFLETVRVIQVSPVLHEALYR
RBSD_BACC1      MKKHGVLNSEIASILASLGHTDTIVIADCGLPIPDGVKRIDLAVEIGKPSFLDVLQVVADDMAIEKVTLA
RBSD_LACAC      MKKTGILNSDISRVVADMGHMDWLGIGDAGTPVPKTTEKIDLAVSAGMPSFKEVLKELQVQKIYVADEIK
RBSD_BACWK      MKKHGVLNSEIAAVLASLGHTDTIVIADCGLPIPDGVKRIDLAVEIGKPSFLDVLQVVADLAEEVIINNA
RBSD_SHEHH      MNKHALLNADMNYLVATLGHTDEVAICDAGLPIPAAVQRIDLALTHGVPSFEGVVLAQEVSPECHQALLV
RBSD_PSYIN      MKKTALLNAELSYLVASLGHFDEITICDAGLPIPNETQRIDLALTHGVPAFRVILSEMQITGVLLASEFK
RBSD_HELMI      MKKQGILHRDLAALIASLGHGDLVVVADSGLPVPPGVPCIDLAVTKGVPSFLPVLEALKPNEQIIEALAG
RBSD_ERWCT      MKKAALLNSDISSVIARLGHTDSLVIGDAGLPIPETTTRIDLALTHNVPTFLQVVNVVTSEMQVEAAILA
RBSD_ECO27      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAVIIAEEIK
RBSD_BACHK      MKKHGVLNSEIAAVLASLGHTDTIVIADCGLPIPDGVKRIDLAVEIGKPSFLDVLQVVADDMAIEKVTLX
RBSD_BACCZ      MKKHGVLNSEIAAVLASLGHTDTIVIADCGLPIPDGVKRIDLAVEIGKPSFLDVLQVVATXXXXXXXXXX
RBSD_BACCQ      MKKHGVLNSEIAAVLASLGHTDTIVIADCGLPIPDGVKRIDLAVEIGKPSFLDVLQVVADDMAIEKVTLX
RBSD_BACC7      MKKHGVLNSEIAAVLASLGHTDTIVIADCGLPIPDGVKRIDLAVEIGKPSFLDVLQVVADDMAIEKVTLX
RBSD_BACC0      MKKHGVLNSEIAAVLASLGHTDTIVIADCGLPIPDGVKRIDLAVEIGKPSFLDVLQVVADDMAIEKVTLX
RBSD_BACAN      MKKHGVLNSEIAAVLASLGHTDTIVIADCGLPIPDGVKRIDLAVEIGKPSFLDVLQVVADDMAIEKVTLX
RBSD_BACAC      MKKHGVLNSEIAAVLASLGHTDTIVIADCGLPIPDGVKRIDLAVEIGKPSFLDVLQVVADDMAIEKVTLX
RBSD_BACAA      MKKHGVLNSEIAAVLASLGHTDTIVIADCGLPIPDGVKRIDLAVEIGKPSFLDVLQVVADDMAIEKVTLX
RBSD1_RUBXD     MKRGGIVNAQLAGALARLGHTDTLVVCDAGLPIPHGPEVVDLAFRLGIPGFXXXXXXXXXXXXXXXXXXX
RBSD_LARHH      MKKNGILNAPLSRVIAELGHTDYIVIADCGLPIPPGVERIDLALKPGLPAFELVLADMQVERAVFANEIS
RBSD_RHOBA      MKRTRLLNSELSYEISRIGHTASITLCDAGLPIPSGVKRIDLAIEEGYPTFLRTLDAILSELKVEEIVIA
RBSD_EXIS2      MKRHGILNSQISKVLADLGHTDTIVIADCGLPIPAGVARIDLALELGTPSFVDVVRAVEQVTLATEIKAA
RBSD_SHISS      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_SHIFL      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_SHIF8      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_SHIBS      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_SHIB3      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_ESCF3      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_ECOSM      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_ECOLU      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_ECOLI      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_ECOLC      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_ECOL6      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAVIIAEEIK
RBSD_ECOHS      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_ECODH      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_ECOBW      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_ECO7I      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_ECO5E      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_ECO57      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_ECO55      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_BACC3      MKKHGVLNSEIASVLASLGHTDTIVIADCGLPIPAGVKRIDLAVEIGKPSFLDVLQVVADDMAIEKVTLX
RBSD_BACAH      MKKHGVLNSEIASVLASLGHTDTIVIADCGLPIPAGVKRIDLAVEIGKPSFLDVLQVVADDMAIEKVTLA
RBSD_PROMH      MKKGVLLNSSISSVIARLGHTDKITIADAGLPIPSSVERIDLALTQGIPDFMSVLQTINPLLFSEITRYL
RBSD_PEDPA      MKKTKMINSDMSRVIAQMGHFDKLSIGDAGMPVPMGIEKIDLAVDNGIPSFMQVLNVLEELEVQRIYLAE
RBSD_HAEIN      MKKTALLNAQLSHCIATLGHTESLTICDAGLPIPLSVERIDLALTAGVPSFLQTLNVVTNEMYVERVVIA
RBSD_HAEIG      MKKTALLNAQLSHCIATLGHTESLTICDAGLPIPLSVERIDLALTAGVPSFLQTLNVVTNEMYVERVVIA
RBSD_ECOSE      MKKGTVLNSDISSMISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_ECOL5      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSATRIDMALTQGVPSFMQVLNEMQVEAVIIAEEIK
RBSD_ECO8A      MKKGTVLNSDISSMISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_ECO81      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSATRIDMALTQGVPSFMQVLNEMQVEAVIIAEEIK
RBSD_ECO24      MKKGTVLNSDISSMISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAAIIAEEIK
RBSD_CHRVO      MKKHGHLNRDIARILASMGHTDSLVIADCGLPIPPGVECVDLSLKLGQPGFIETLDAVFAIECRQHNPAV
RBSD_DESAD      MKRTGLLNSELSYIISKLGHFDALTVCDAGLPIPEGVQRIDLAVSEGIPSFIDVVKXXXXSSDRHDELIS
RBSD_LACLM      MKKEGILNSELAKIADDLGHTDQVCIGDLGLPVPSGVKKIDLALTRGKPTFQEVLDIILVEKIYLADEIK
RBSD_ENTFA      MKKTKVINSDISRVIAQMGHFDKLSIGDAGMPVPRTTEKIDLAVTNGVPSFMEVLNELAVQRIYLAEEIK
RBSD_VIBHB      MKKSTLINSEVSRLIATLGHTDEITICDAGLPIPDHVQRIDLALAHGIPTVRVILSESQIEGVIIAEEFA
RBSD_STAS1      MYKTGILNSDISKLLSDLGHTDEIMIADCGLPIPNGVKKIDLALDFGKPSFLDVFHAIEKMTLASEMKTE
RBSD_OCEIH      MKKKGMLNSEISKVLSDLGHTDQIVIADAGLPVPEGVTKIDVALTPGTPSFLDVLKAVKADMVIEGVTLA
RBSD_LACLA      MKKEGILNSELAKIADDLGHTDQVCIGDLGLPVPSGVKKIDLALTRGKPSFQEVLDIILVEKVYLAEEIK
RBSD_LACF3      MKKSGILNSEVASVVAGMGHMDWLSIGDAGMPVPMGTKKIDLCVDKELPTFENVLKEMKIQKIYLADEIK
RBSD_STRU0      MKKHGILNSDLAKIVDDLGHTDRVCIGDLGLPIPSGVRKIDLSLKAGFPSFQDLLDVVLVEKIILAEEIK
RBSD_SERP5      MKKGVLLNADVSAVVSRLGHTDQIVICDAGLPIPAATQRIDLALTQGVPTFLQVLGVVKQNPQLHRALLA
RBSD_EXISA      MKKQGILNSHLAKIFADLGHTDRVVIADCGLPIPDGVKRVDLSLRIGEPSFXXXXXXXXXITIAEEILTH
RBSD_ECOUT      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAVIIAEEIK
RBSD_ECOK1      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAVIIAEEIK
RBSD_ECO45      MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLNEMQVEAVIIAEEIK
RBSD_CITK8      MKKGAVLNSDISSVISRLGHTDTLVVCDAGLPVPSSTTRIDMALTQGVPSFMQVLDVVTREMQVEAAILA
RBSD_SHEPA      MNKHALLNADMNYLAATLGHTDEVTICDAGLPIPAQVKRIDLALTHGVPSFKVWLATSQIEGIVLAQEFA
RBSD_STRA5      MKKTGILNSHLAKLADDLGHTDRVCIGDLGLPVPNGIPKIDLSLTSGIPSFQEVLDIILVEKVILAEEIK
RBSD_STRA3      MKKTGILNSHLAKLADDLGHTDRVCIGDLGLPVPNGIPKIDLSLTSGIPSFQEVLDIILVEKVILAEEIK
RBSD_PECCP      MKKAALLNSDISSVVSRLGHTDSLVIGDAGLPIPETTTRIDLALTHNVPTFLQVVSVVTSEMQVXXXXXX
RBSD_NATTJ      MKKTTLLNSEISRVTSQMGHTDGLTISDAGPPIPQESERIDLALKEGVPAFETVLSELQVEAVVLTTETR
RBSD_ENT38      MKKGTVLNSEISSVISRLGHTDTLVVCDAGLPVPHSTTRIDMALTQGVPSFMQVLDVVTAEMQVETAILA
RBSD_STRA1      MKKTGILNSHLAKLADDLGHTDQVCIGDLGLPVPNGIPKIDLSLTSGVPSFQEVLDIILVEKVILAEEIK
RBSD_HAEIE      MKKTMLLNAQLSRCIASVGHTESLTICDAGLPIPLSVERIDLALTAGVPSFLQTLNVVTNEMYVERVVIA
RBSD_HAEI8      MKKTMLLNAQLSRCIASVGHTESLTICDAGLPIPLSVERIDLALTAGVPSFLQTLNVVTNEMYVERVVIA
RBSD_STRCO      MKKAGILNRHLAGALAELGHGDGVLVCDAGMPVPDGPRVVDLAFRAGVPSFAEVVDGLLAELVVEGATAA
RBSD_LACLS      MKKEVILNSELAKIADDLGHTDQVCIGDLGLPVPSGVKKIDLALTRGKPTFQEVLDIILVEKIYLADEIK
RBSD_HAEPS      MKKTTILNAQLSHVIATMGHTDGLTICDAGLPIPTEQHCIDLALTKGIPDFLSVLQAVSSELFIEKIVLA
RBSD_EDWI9      MKKGTVLNSELSALISRLGHTDSVTVGDAGLPVPDGIQRIDLALTHGIPRFMQVIETMQVERAVLAQEMV
RBSD_YERPY      MKKGVLLNADISAVISRLGHTDQIVIGDAGLPIPATTTRIDLALTRGVPGFLQVVDVVKNNPQLHEALLV
RBSD_YERPS      MKKGVLLNADISAVISRLGHTDQIVIGDAGLPIPATTTRIDLALTRGVPGFLQVVDVVKNNPQLHEALLV
RBSD_YERPP      MKKGVLLNADISAVISRLGHTDQIVIGDAGLPIPATTTRIDLALTRGVPGFLQVVDVVKNNPQLHEALLV
RBSD_YERPN      MKKGVLLNADISAVISRLGHTDQIVIGDAGLPIPATTTRIDLALTRGVPGFLQVVDVVKNNPQLHEALLV
RBSD_YERPG      MKKGVLLNADISAVISRLGHTDQIVIGDAGLPIPATTTRIDLALTRGVPGFLQVVDVVKNNPQLHEALLV
RBSD_YERPE      MKKGVLLNADISAVISRLGHTDQIVIGDAGLPIPATTTRIDLALTRGVPGFLQVVDVVKNNPQLHEALLV
RBSD_YERPB      MKKGVLLNADISAVISRLGHTDQIVIGDAGLPIPATTTRIDLALTRGVPGFLQVVDVVKNNPQLHEALLV
RBSD_YERPA      MKKGVLLNADISAVISRLGHTDQIVIGDAGLPIPATTTRIDLALTRGVPGFLQVVDVVKNNPQLHEALLV
RBSD_YERP3      MKKGVLLNADISAVISRLGHTDQIVIGDAGLPIPATTTRIDLALTRGVPGFLQVVDVVKNNPQLHEALLV
RBSD_THEAB      MKKTGIFNSEISRVIAKLGHKDKIAIVDLGFPIPSHVERIDIVLDFGRPTFXXXXXXXXXXXXXXXXXXA
RBSD_OENOB      MKKTTVINSEISSVIAGMGHMDWLGIGDAGMPVPLGTKKIDLALTKNLPSFKNVLTELEVQKIYLADEIK
RBSD_BACLD      MKKHGILNSHIAKLLADLGHTDTIVIADAGLPVPPGVPKIDLALTLGTPGFREVTKLIADEKVTAAQEIE
RBSD_BACA2      MKKHGMLNSHIAKVLADLGHTDLIAIADAGLPVPDGAPKIDLSLTAGVPAFRDVTSEMAVEKVIAASEIK
RBSD_KLEP7      MKKGTVLNADISAVISRLGHTDTLVVCDAGLPVPRSSTRIDMALTQGVPSFMQVLEVVTTEMQVEAAVIA
RBSD_KLEP3      MKKGTVLNADISAVISRLGHTDTLVVCDAGLPVPRSSTRIDMALTQGVPSFMQVLEVVTTEMQVEAAVIA
RBSD_ACTSZ      MKKTTIINAQLSYAIATLGHTETLTLCDAGLPIPNSSNRIDLALTKGIPSFLETLYAVTSEMFVERAILA
RBSD_SALTY      MKKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSTARIDMALTQGVPSFMQVVDVVTREMQVEAAILA
RBSD_SALSV      MKKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSTARIDMALTQGVPSFMQVVDVVTREMQVEAAILA
RBSD_SALPK      MKKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSTARIDMALTQGVPSFMQVVDVVTREMQVEAAILA
RBSD_SALPC      MKKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSTARIDMALTQGVPSFMQVVDVVTREMQVEAAILA
RBSD_SALPA      MKKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSTARIDMALTQGVPSFMQVVDVVTREMQVEAAILA
RBSD_SALNS      MKKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSTARIDMALTQGVPSFMQVVDVVTREMQVEAAILA
RBSD_SALHS      MKKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSTARIDMALTQGVPSFMQVVDVVTREMQVEAAILA
RBSD_SALG2      MKKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSTARIDMALTQGVPSFMQVVDVVTREMQVEAAILA
RBSD_SALEP      MKKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSTARIDMALTQGVPSFMQVVDVVTREMQVEAAILA
RBSD_SALDC      MKKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSTARIDMALTQGVPSFMQVVDVVTREMQVEAAILA
RBSD_SALCH      MKKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSTARIDMALTQGVPSFMQVVDVVTREMQVEAAILA
RBSD_SALA4      MKKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSTARIDIALTQGVPSFMQVVDVVTREMQVEAAILA
RBSD_LACRJ      MKKTGIINSEVSAVVANMGHMDWLSIGDAGMPVPFGTKKIDLAVDKELPSFMDVLNEMKVQKIYLAEEIK
RBSD_LACRD      MKKTGIINSEVSAVVANMGHMDWLSIGDAGMPVPFGTKKIDLAVDKELPSFMDVLNEMKVQKIYLAEEIK
RBSD_SALAR      MKKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSAARIDMALTQGVPSFMQVVDVVTREMQVEAAILA
RBSD_LACCB      MKKGTVINTQLSQVIADMGHFDLLGIGDAGMPVPEDTWKIDLAVSKNLPSFKNVLSELQVQKVYLAEEIK
RBSD_LACC3      MKKGTVINTQLSQVIADMGHFDLLGIGDAGMPVPEDTWKIDLAVSKNLPSFKNVLSELQVQKVYLAEEIK
RBSD_SALTI      MKKGTVLNSEISSVISRLGHTDTLVVCDAGLPIPNSTARIDMALTQGVPSFMQVVDVVQQNPXXXXXXXX
RBSD_PASMU      MKKTALLNAPLSQVIATLGHTDSLTICDAGLPIPKQIERVDLALSAGVPSFLQTFHAV------------
RBSD_LACBA      MKKTTVINSELSTVIAGMGHMDWLSIGDAGMPVPMGTQKIDLALTKQLPSFQNVLSELAVQKIYLAEEIK
RBSD_ENTS8      MKKGTVLHSGISSVISRLGHTDTVVVCDAGLPIPSTTERIDLALTQGVPGFLQVVDVVTQEMQVEAAILA
RBSD_CHLAD      MKKTLLLNSVLSELIASLGHGDMVVIGDAGLPIPPETRRIDLALCRGIPPLLETVRVIASEMQVEKALIA
RBSD_ACTP7      MKKTAVLNAQLSGVIASLGHTDGLTICDAGLPIPSEQQCVDLALTKGIPSFEVVLTELFVERILLAEEIK
RBSD_YERE8      MKKGALLNSDISAVISRLGHTDQIVIGDAGLPIPATTTRIDLALTQGVPGFLQVFEVVKNNPQLHETLLA
RBSD_PSEPW      MKKTALLNIALSRTIAGLGHGDILVIGDAGLPVPPGVELIDLALTPGIPDFASVLRAMQVERHVLAEEMQ
RBSD_ACTPJ      MKKTAVLNAQLSGVIASLGHTDGLTICDAGLPIPSEQQCVDLALTKGVPSFEVVLTELFVERILLAEEIK
RBSD_ACTP2      MKKTAVLNAQLSGVIASLGHTDGLTICDAGLPIPSEQQCVDLALTKGVPSFEVVLTELFVERILLAEEIK
RBSD_SALPB      MKKGTVLNSEISSVISHLGHTDTLVVCDAGLPIPNSTARIDMALTQGVPSFMQVVDVVTREMQVEAAILA
RBSD_PHOLL      MKKGVLLNSEISAVISQLGHTDQITIGDAGLPIPSLAQRIDLALTQGIPSFISVLNVVNPLIHQLILTQI
RBSD_LACSS      MRKTKVINTQISSVISDMGHFDTLSIGDAGMPVPVGTKKIDVAIENGVPSFIQVLSELEVQKVYLANEIK
RBSD_HAES2      MKKTKLLNASLSHYIATLGHTDSLVICDAGLPISNQVERVDLALEAGVPGFLQTVDVVISEMFVEHAVVA
RBSD_VARPS      MKRTALLHAELSQVIAALGHGDMLVIGDAGLPIPDGPRRIDLALTPGIPRVADVLKVVLSEMQVERALIA
RBSD_PSEE4      MKKTPLLNIALSRTIAGLGHGDILVIGDAGLPVPPGVELIDLALTPGIPDFTSVLHVLAEEMFQAAPLGL
RBSD_DESRM      MKKQGVLHRDLAALIASLGHRDAIVVADSGLPVPPGVNCIDLAVTKGXXXYEMVVDELQVNQSLVKSIAD
RBSD_BACSU      MKKHGILNSHLAKILADLGHTDKIVIADAGLPVPDGVLKIDLSLKPGLPAFQDTAAVLAEEMAVEKVIAA
RBSD_SYMTH      MKKTTLLNQALSEVVAGMGHGDLLVIGDYGLPCPKGVRRIDLALRPGIPAFLDVVETIXXXXXXXXXXXX
RBSD_PSEU2      MKKTPLLNIALSRVIASLGHGDILMIVDAGMPVPAGVELIDLALTRGVPDFDVVLSEMQVESHVLANEMA
RBSD_PSEPF      MKKTPLLNVALSRLIASLGHGDVVVIGDAGLPVPPGVELIDLALTHGVPDFVSTLHALAKEIFDKQPTAL
RBSD_PSE14      MKKTPLLNIALSRVIASLGHGDILMIVDAGMPVPAGVELIDLALTRGVPDFDVVLSEMQVESHVLSNEMA
RBSD_PSESM      MKKTPLLNIALSRVIASLGHGDILMIVDAGMPVPPGVELIDLALTRGVPDFDVVLSEMQVESHVLAREMA
RBSD_AERS4      MKRGVLLNAPLSALVAQMGHTDEITVCDAGLPIPAGPERIDLALMAGTPNLQTVLKALKVIMASEIKLIS
RBSD_PSEPG      MKKTPLLNVALSRVIAGMGHGDILVIGDAGLPVPPGVEMIDLAVTPGLPDFASVLRALQVERHVLAEEMQ
RBSD_PSEPK      MKKTPLLNVALSRVIAGMGHGDILVIGDAGLPVPPGVELIDLAITPGLPDFASVLSELQVERHVLAEEMQ
RBSD_PSEP1      MKKTPLLNVALSRVIAGMGHGDILVIGDAGLPVPPGVELIDLAITPGLPDFASVLSELQVERHVLAEEMQ
RBSD_LACJO      MKKTGVMNSNISRVIADMGHMDWLGVGDAGTPVPAETEKIDLSVRPGLPSFXXXXXXXXXQKMYIAEEIK
RBSD_PSEFS      MKKTPLLNIALSRVIASLGHGDILVIGDAGLPVPPGVELIDLALTQGIPDFRIVLSEMQVESHVLAEEIL
RBSD_HAES1      MKKTKLLNASLSHHIATLGHTESLVICDAGLPISNQVERIDLALEAGVPGFLQTVDVVISEMFVEHAVVA
RBSD_LACGA      MKKTGVMNSNISRVIADMGHMDWLGVGDAGTPVPAETEKIDLSVRPGLPSFXXXXXXXXXQKIYIAEEIK
RBSD_PSEF5      MKKTPLLNIALSRLIASLGHGDIVVIGDAGLPVPPGVELIDLALTHGVPDFLTTLKVLERHVLAEEILLK
RBSD_PETMO      MKKQGIFNSQISYFVASMGHKDMLSIVDMGYPIPKDATFVDLVFDKGIPNFKMVLYELEVEKVIIAGEME
RBSD_AERHH      MKRGVLLNAPLSALVARMGHTDEITVCDAGLPIPAGPERIDLALMAGTPSXEKVIMAKQISPAAHQALVD
RBSD2_STRGG     MKKSGILNRHLAGAIAELGHGDTVLVCDAGMPIPPGPRVIDLAFRAGTPSF-------------------
RBSD1_STRGG     MKRSGILNAELGEALATLGHTDLLLVVDAGFPVPRDAHRIDLALAENLPDLRTVLGLI------------
RBSD_THELT      MKKNGILNRELSYLIASMGHGDILSIVDSGFPISEDVFCVDLSLIAGXPKYHQKLLSIFPKNVQIEYIPH
RBSD_STAAT      MKKSAILNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFATVLEEMEIQKIYLAEEIK
RBSD_STAA3      MKKSAILNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFATVLEEMEIQKIYLAEEIK
RBSD_STAAW      MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFATVLEEMEIQKIYLAEEIK
RBSD_STAAS      MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFATVLEEMEIQKIYLAEEIK
RBSD_STAAR      MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFATVLEEMEIQKIYLAEEIK
RBSD_STAAN      MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFATVLEEMEIQKIYLAEEIK
RBSD_STAAM      MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFATVLEEMEIQKIYLAEEIK
RBSD_STAAE      MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFATVLEEMEIQKIYLAEEIK
RBSD_STAAC      MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFATVLEEMEIQKIYLAEEIK
RBSD_STAAB      MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFATVLEEMEIQKIYLAEEIK
RBSD_STAA9      MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFATVLEEMEIQKIYLAEEIK
RBSD_STAA8      MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFATVLEEMEIQKIYLAEEIK
RBSD_STAA2      MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFATVLEEMEIQKIYLAEEIK
RBSD_STAA1      MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVTKNLPRFATVLEEMEIQKIYLAEEIK
RBSD_STACT      MKKTPLLNSQVSQAVATIGHFDLLTINDAGMPIPNDERRIDLAVTKALPRFETVVTEMEIQKIYLAEEIK
RBSD_THENN      MKKVGILNSEISKIVADMGHMDTLAVVDLGFPIPQGVKKVDLVVDRGKPGLMEVIEILLRELKVERIILA
RBSD_THEMA      MKKVGILNSEISKIVADMGHMDTLAVVDLGFPIPQGVKKVDLVVDRGKPGLMEVIEILLRELKVERIILA
RBSD_ACIAC      MKRTALLHADLSRAIAALGHGDMIVIGDAGLPIPPGPLRIDLAVTPGXXXXXXXXXXXXSEMQVERALVA
RBSD2_RUBXD     MKRSGILNQPLSNILASFGHTDLLVVCDAGFPIPRDAQRVDLAIAPDLPDLRTVLSLI------------
RBSD_KOSOT      MKRSGXXXXXXXXXXXXMGHMDRITVCDCGFPIPDGAKVVDLSIIKGFPRLIDVXXXXXXXXXXXXXXXV
RBSD_STAES      MKKTAVLNSHISSAISTLGHYDLLTINDAGMPIPNDDKRIDLAVTKSLPRFETVLTEMEIQKVYLAEEIK
RBSD_STAEQ      MKKTAVLNSHISSAISTLGHYDLLTINDAGMPIPNDDKRIDLAVTKSLPCFETVLTEMEIQKIYLAEEIK
RBSD_THEP1      MKRVGILNSTISEMVANMGHTDMLAIVDMGFPIPDGAKKVDLVVDKGKP---------------------
RBSD_STRAW      MKKAGILNRXXXXXXXXXXXXXXVLVCDAGMPIPVGPRVVDLAFRAGVPSFAXXXXXXXXXXXXXXATAA
CJ125_HUMAN     -----LLSPELLYALARMGHGDEIVLADLNFP--------------------------------------


                         .         .         *         .         .         .         .:140
query           XXTPERIRXXXXXXXXXXXXXXLKAQLAECAFVIRTGETTAYANVIFKSGVAF
RBSD_CORGB      XXTPERIRXXXXXXXXXXXXXXLKAQLAECAFVIRTGETTAYANVIFKSGVAF
RBSD_CORGL      XXXXXRIRXXXXXXXXXXXXXXLKAQLAECAFVIRTGETTAYANVIFKSGVAF
RBSD_PROAC      HEAPESWVRERIEEVHTVSHEDLKKALPNVSFVVRTGETTPYSNVIVRCGVPF
RBSD_CLONN      HETPETFKEIGDVKITFISHEELKKELSNCKAVIRTGEQTPYANIILKSGVVF
RBSD_CLOTE      NETKEIKKQLGHAKITFISHEELKNNLKHCKAVIRTGEQTPYANIILKSGVVF
RBSD_CLOBB      AVSPEEIKVIGDVKITFITHEELKTTLKSCKAVVRTGEQTPYANIILKSGVVF
RBSD_CLOBA      XXTKEEIKVIGDVKITFITHEELKTTLKSCKAVVRTGEQTPYANIILKSGVVF
RBSD_BACHD      EEVKERALTGTNIPIHYLPHEQFKDTTCKAKAVIRTGEVTPYANVILRSGVIF
RBSD_GEOKA      XXXKESIRRMGGVPVQFVPHEQFKAMTKQAKAVIRTGEATPYANIILRSGVSF
RBSD_BACSK      TESPHQELENRQISIRYLPHDELKAETSKAKAIIRTGECAPYANVILRAGVIF
RBSD_PHOPR      QVSPEELLCGKKITLSYVSHEAFKVHTQDSKAVIRTGECTPYANVIFQSGVVF
RBSD_COPPD      TEMKEKLKILGNIPIKEVSHEELKVMTKECVAVVRTGEYTPYCNIILRSGVVF
RBSD_VIBF1      TVSPEEAQCSKSITVSYIPHEEFKIHTRESKAIVRTGECTPYANVIFQSGVVF
RBSD_VIBFM      TVSPEEAQCGKSITVSYIPHEEFKIHTRESKAIVRTGECTPYANVIFQSGVVF
RBSD_BACCR      EVNKEIERKLIEPAFEYVSHEQFKEHTKKAKAIIRTGEATPYANVILHAGVIF
RBSD_BACP2      SEIQEALKKAFSKPLHDVDHETFKDMTKQAKAVIRTGEATPYANCILHAGVIF
RBSD_BACC4      EVNKEIEQKLIEPAFEYVSHEQFKAHTKKAKAIIRTGEATPYANVILHAGVIF
RBSD_THETN      KKLYLELSEQFGDKLVIIDHEQLKEMCKNAKAVIRTGEYTPYANIVLESGVEF
RBSD_THEPX      KEMIDKLLELFGEKLIIISHEDLKAMSKNARAIIRTGEYKPYANIILESGVEF
RBSD_THEP3      KEMIDKLLELFGEKLIIISHEDLKAMSKNARAIIRTGEYKPYANIILESGVEF
RBSD_LACPL      VQNPKMLKRLPDTPITFIPHEEMKKDLADCKAFVRTGEMTPYSNILLESGVTF
RBSD_CLOPS      KETPEXXXXXXXXXXXFISHEELKKELKDCKAVVRTGEQTPYANIILKSGVVF
RBSD_CLOP1      KETPEXXXXXXXXXXXXXSHEELKKELKDCKAVVRTGEQTPYANIILKSGVVF
RBSD_VIBPA      DVSPXXXXXXXXIEIKYVSHEAFKARTEQSRAVVRTGECTPYANVIFQAGVVF
RBSD_STAHJ      EEMEEQV-TKDFSEIEQVNHETFKALTKNAKAIIRTGEATPYANIILQSGVIF
RBSD_GEOTN      XXXKESIKRMSDVPIQFVRHEEFKEMTKQAKAVIRTGEATPYANIILRSGVNF
RBSD_BACC2      EVNKEIEQKLIEPAFEYVSHEQFKEHTKKAKAIIRTGEATPYANVILHAGVIF
RBSD_CLOPE      KETPEXXXXXXXXXXXXXSHEELKKELKYCKAVVRTGEQTPYANIILKSGVVF
RBSD_ALISL      TVSPEEELRGKPITISYIPHEEFKSHSHQSKAIVRTGECTPYANVIFQSGVVF
RBSD_VIBVY      ELQCEEEKTGKVLSLTHVSHEEFKQRTESSKAVVRTGECTPYANVIFQAGVVF
RBSD_VIBVU      ELQCEEEKTGKVLSLTHVSHEEFKQRTESSKAVVRTGECTPYANVIFQAGVVF
RBSD_BACCN      EEITTNNRRLKEANFEYVLHEEFKEKTKQAKAIIRTGEATPYANIILHAGVIF
RBSD_VIBCH      ELKAEEQLCGKPIAIQYISHEAFKQRTLQSRAVVRTGECTPYANVIFQAGVVF
RBSD_VIBC3      ELKAEEQLCGKPIAIQYISHEAFKQRTLQSRAVVRTGECTPYANVIFQAGVVF
RBSD_BACC1      XXXXXXXXXXXXXXXLKLVEPALKEHTKKAKAIIRTGEATPYANVILHAGVIF
RBSD_LACAC      DSNPKQLRILPDVEIKFIPHTQLKKNLSEAKAFIRTGEETPFSNVILESGVIF
RBSD_BACWK      EVNKEVEMRLIEPAFEYVSHKEFKEHTKRAKAIIRTGEATPYANVILHAGVIF
RBSD_SHEHH      EIEAEQLATGRTFSIEYVSHEAFKQRTHNSRAVIRTGECTPYANVIFKTGVVF
RBSD_PSYIN      QVSPDLHRAGSRIELIYISHEAFKERTSNSKAVVRTGECTPYANVIFQSGVVF
RBSD_HELMI      RLKPVQLHFINHES--------LKTCCRQARAVIRTGEWTPYANILLYAGVAF
RBSD_ERWCT      EEMIEKQHQGNSIALHYVSHEEFKTQSGKSRAIIRSGECSPYANVILCAGVTF
RBSD_ECO27      QHNPQQKHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_BACHK      XXXXXXXXKLIEPAFEYVCHEQFKEHTKKAKAIIRTGEATPYANVILHAGVIF
RBSD_BACCZ      XXXXXXXXXXXXPVFEYVCHEQFKEHTKKAKAIIRTGEATPYANVILHAGVIF
RBSD_BACCQ      XXXXXXXXKLIEPAFEYVSHEQFKEHTKKAKAIIRTGEATPYANVILHAGVIF
RBSD_BACC7      XXXXXXXXKLIEPAFEYVSHEQFKEHTKKAKAIIRTGEATPYANVILHAGVIF
RBSD_BACC0      XXXXXXXXKLIEPAFEYVCHEQFKEHTKKAKAIIRTGEATPYANVILHAGVIF
RBSD_BACAN      XXXXXXXXKLIEPAFEYVCHEQFKEHTKKAKAIIRTGEATPYANVILHAGVIF
RBSD_BACAC      XXXXXXXXKLIEPAFEYVCHEQFKEHTKKAKAIIRTGEATPYANVILHAGVIF
RBSD_BACAA      XXXXXXXXKLIEPAFEYVCHEQFKEHTKKAKAIIRTGEATPYANVILHAGVIF
RBSD1_RUBXD     XXNPDALLASRLPELKLVPHWELKLRAADARLVVRTGEATPYSNVILRCGVPF
RBSD_LARHH      QHNPVIEHAATSMLDGKPIGHVPHAEFKQLSAVIRTGEASPYANVILYSGVIF
RBSD_RHOBA      SEIHDHNQMLFEQMMKLFEAHRMAPKITEVSHVVRTGECTPYANVILKSGVVF
RBSD_EXIS2      NPVALEAVMKLDVPQDYVSHEAFKELTKQAKVIIRTGEATPYANVILHAGVIF
RBSD_SHISS      QHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_SHIFL      QHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_SHIF8      QHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_SHIBS      QHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_SHIB3      QHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_ESCF3      QHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_ECOSM      QHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_ECOLU      QHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_ECOLI      HHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_ECOLC      QHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_ECOL6      QHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_ECOHS      QHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_ECODH      HHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_ECOBW      HHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_ECO7I      QHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_ECO5E      HHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_ECO57      HHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_ECO55      QHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_BACC3      XXXXXXXXKLIEPAFEYVCHEQFKEHTKKAKAIIRTGEATPYANVILHAGVIF
RBSD_BACAH      XXXXXXXXKLIEPAFEYVCHEQFKEHTKKAKAIIRTGEATPYANVILHAGVIF
RBSD_PROMH      HLLEQQQK--KPIEIIYVTHEEFKTQLPDNKAVIRTGECSPYANIVLFSGVTF
RBSD_PEDPA      EIKTENPKMLENIKALMPETPIMKQDLNNCHAFVRTGEMTPYSNIILESGVVF
RBSD_HAEIN      EEIKEKSHQGNQIQVEFVSHETFKKFTLESKAIVRTGECSPYANVILYSGVPF
RBSD_HAEIG      EEIKEKSHQGNQIQVEFESHETFKKFTLESKAIVRTGECSPYANVILYSGVPF
RBSD_ECOSE      QHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_ECOL5      QHNPXXXXXGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_ECO8A      QHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_ECO81      QHNPXXXXXGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_ECO24      QHNPXXXHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVTF
RBSD_CHRVO      QDKAERM-AQAGAALDFVSHEEFKQRCQAARAVIRTGECTPYANVILHSGVIF
RBSD_DESAD      VLEMESAQRGKDIPVDYVRHVNFKLNTKKSVAIVRTGEFTPYANITFKAGVVF
RBSD_LACLM      ENNPEQLKLSADVEVVFVSHETLKLMNHDVKAVVRTGENTPYSNIILQSGVA-
RBSD_ENTFA      TENPDMLTRLPETPISFIPHTEMKQELNNCHAFIRTGEMTPYANILLESNVVF
RBSD_VIBHB      TVSPESGLTGKPIAINYVSHEDFKVRTSQSRAVVRTGECTPYANVILQAGVVF
RBSD_STAS1      NESLYNVLKEEEIKFTTESHELLKQHSKHVKAIIRTGEAKPYANVILASDVLF
RBSD_OCEIH      REIKQIQEVINDIPITYVTHEQFKALSKQAKAIIRTGEITPYANCILQSGVFF
RBSD_LACLA      ENNPEQLKLSADVEIVFVSHETLKLMNHEVKAVVRTGENTPYSNIILQSGVA-
RBSD_LACF3      DQNPEQLQALPDVEIEFMPHTDLKKNLAKTHAFIRTGEMTPYSNIILESGVTF
RBSD_STRU0      EQNPEQLKLDDGVTVEYVSHEQLKALNQDVKAVIRTGENTPYSNIILQSGV--
RBSD_SERP5      QLTELGQHQGNTISVSYISHSAFKAQTEHSRAVIRSGECSPYANVILCAGVTF
RBSD_EXISA      NSTIADSLKERYTSIDMCSHEDFKREVAKAKVVIRTGEATPYANVILHAGVIF
RBSD_ECOUT      QHNPXXXHQGNTIEIRYTTHEQFKQQTAGSQAVIRSGECSPYANIILCAGVTF
RBSD_ECOK1      QHNPXXXHQGNTIEIRYTTHEQFKQQTAGSQAVIRSGECSPYANIILCAGVTF
RBSD_ECO45      QHNPXXXHQGNTIEIRYTTHEQFKQQTAGSQAVIRSGECSPYANIILCAGVTF
RBSD_CITK8      TEIKEQQHQGNTIEIRYTTHEHFKKLTADSQAVIRSGECSPYANVILCAGVTF
RBSD_SHEPA      DVSPEXXXTGRTFSVEYISHEAFKQRTGHSRAVIRTGECTPYANVIFKTGVVF
RBSD_STRA5      EANPDQLKLDNSVSIEYVSHNHLKQMTQDVKAVIRTGENTPYSNIILQSGV--
RBSD_STRA3      EANPDQLKLDNSVSIEYVSHDHLKQMTQDVKAVIRTGENTPYSNIILQSGV--
RBSD_PECCP      XXXXXKQHQGNSIALHYVSHEEFKTQSGKSRAIIRSGECSPYANVILCAGVTF
RBSD_NATTJ      EVSPQTYHKIVDLLKQYNPDIQIKKEVSNTKAVVRTGECTPFSNIILKSGVVF
RBSD_ENT38      TEIKQQQHQGNTIEIRYTTHEQFKQQTADSQAVIRSGECSPYANIILCAGVTF
RBSD_STRA1      EANPDQLKLDNSVSIEYVSHDHLKQMTQDVKAVIRTGENTPYSNIILQSGV--
RBSD_HAEIE      EEIKEKSHQGNQIQVEFVSHETFKKFTLESKAIVRTGECSPYANVILYSGVPF
RBSD_HAEI8      EEIKEKSHQGNQIQVEFVSHETFKKFTLESKAIVRTGECSPYANVILYSGVPF
RBSD_STRCO      TEVREALLDGLFPALALVPHERLKELSAGARLIVRTGEARPYANVLLRCGVFF
RBSD_LACLS      ENNPEQLKLSADVEVVFVSHETLKLMNHDVKAVVRTGENTPYSNIILQSGVA-
RBSD_HAEPS      EEIKNEVQQKNTIKIEYIPHNEFKHQSNQAKAVVRTGECSPYANVILYSGVPF
RBSD_EDWI9      EANPDIHRQGNAIHIDYVSHGQFKALSGESKAIVRSGECSPYANVLLYAGVTF
RBSD_YERPY      LLTQLEQRQENQIALRYISHEAFKEQTKQSRAVIRSGECSPFANIILGSGVTF
RBSD_YERPS      LLTQLEQRQENQIALRYISHEAFKEQTKQSRAVIRSGECSPFANIILGSGVTF
RBSD_YERPP      LLTQLEQRQENQIALRYISHEAFKEQTKQSRAVIRSGECSPFANIILGSGVTF
RBSD_YERPN      LLTQLEQRQENQIALRYISHEAFKEQTKQSRAVIRSGECSPFANIILGSGVTF
RBSD_YERPG      LLTQLEQRQENQIALRYISHEAFKEQTKQSRAVIRSGECSPFANIILGSGVTF
RBSD_YERPE      LLTQLEQRQENQIALRYISHEAFKEQTKQSRAVIRSGECSPFANIILGSGVTF
RBSD_YERPB      LLTQLEQRQENQIALRYISHEAFKEQTKQSRAVIRSGECSPFANIILGSGVTF
RBSD_YERPA      LLTQLEQRQENQIALRYISHEAFKEQTKQSRAVIRSGECSPFANIILGSGVTF
RBSD_YERP3      LLTQLEQRQENQIALRYISHEAFKEQTKQSRAVIRSGECSPFANIILGSGVTF
RBSD_THEAB      HESSKKFENIPRVEFLKISHEELKKLTNDVVAVIRTGDVVPYSNAILVSGVIF
RBSD_OENOB      TKNPEQLQLMPNVEIEFVPHSELKKDLAKTHAFIRTGEMTAFSNIILESGVVF
RBSD_BACLD      SVNPGQAAEFSNQKIDYIPHEAFKKATSQAKAVIRTGEATPYANCILHAGVIF
RBSD_BACA2      DANPENASHFSAQTIEYMSHEEFKRLTQKAKAVIRTGEMTPYANCILQAGVIF
RBSD_KLEP7      EEIKTHXXXGNTIEIRYTSHELFKKQTADSQAVIRSGECSPFANIILCAGVTF
RBSD_KLEP3      EEIKTHXXXGNTIEIRYTSHEQFKKQTADSQAVIRSGECSPFANIILCAGVTF
RBSD_ACTSZ      SEIKEKTKQGNQIPVEFVSHEKFKKLTHDSKGIVRSGECSPYANIILVSGVPF
RBSD_SALTY      TEIKQQXXXGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGVTF
RBSD_SALSV      TEIKQQXXXGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGVTF
RBSD_SALPK      TEIKQQXXXGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGVTF
RBSD_SALPC      TEIKQQXXXGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGVTF
RBSD_SALPA      TEIKQQXXXGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGVTF
RBSD_SALNS      TEIKQQXXXGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGVTF
RBSD_SALHS      TEIKQQXXXGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGVTF
RBSD_SALG2      TEIKQQXXXGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGVTF
RBSD_SALEP      TEIKQQXXXGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGVTF
RBSD_SALDC      TEIKQQXXXGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGVTF
RBSD_SALCH      TEIKQQXXXGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGVTF
RBSD_SALA4      TEIKQQXXXGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGVTF
RBSD_LACRJ      DQNPAQLKALPDVEVAFMPHSELKKSLTKTHAFIRTGEMTPYSNIILESGVTF
RBSD_LACRD      DQNPAQLKALPDVEVAFMPHSELKKSLTKTHAFIRTGEMTPYSNIILESGVTF
RBSD_SALAR      TEIKQQXYQGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGVTF
RBSD_LACCB      TENPEQIQQLIDVPIAFIPHDQMKQDLSKTKAFVRTGEMTPYSNILLESGVVF
RBSD_LACC3      TENPEQIQQLIDVPIAFIPHDQMKQDLSKTKAFVRTGEMTPYSNILLESGVVF
RBSD_SALTI      XXXXXXXXXGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVIICAGVTF
RBSD_PASMU      -----------------------------------------------------
RBSD_LACBA      TQNPEQLALLPDVEVAFVPHSQLKQDLAKTHAFVRTGEMTPFSNIILESGVTF
RBSD_ENTS8      EEIKERLQQGNTITVRYVSHEQFKLKTADSQAVIRSGECSPYANIILCAGVTF
RBSD_CHLAD      TETGQRSQLLPNTPFEEVSHEQLKALCRQARAVVRTGEYTPYANVILVAGVVF
RBSD_ACTP7      QANPEMINKLAQTQGRQIEIEYVKQRSNQAKAVVRTGECSPYANVILYSGVPF
RBSD_YERE8      QLSQLEQHQGNQIALHYISHEAFKEQTKQSRAVIRSGECSPFANIILCSGVTF
RBSD_PSEPW      KVVPERLR-GKLGKREWLSHEQFKVLSRSARAVVRTGECQPYSNIALIAGVTF
RBSD_ACTPJ      QANPEMINKLAQTQGRQIEIEYVKQRSNQAKAVVRTGECSPYANVILYSGVPF
RBSD_ACTP2      QANPEMINKLAQTQGRQIEIEYVKQRSNQAKAVVRTGECSPYANVILYSGVPF
RBSD_SALPB      TEIKQQXXXGNTIKISYTTHEQFKKLTADSQAVIRSGECSPYANVILCAGVTF
RBSD_PHOLL      KELEK--QQGNSITVDYISHNVLKEKTKHSRAVIRTGEHSPYANIILGAGVTF
RBSD_LACSS      TANPEQLAAIKALIGETPIEFIMKQDLNKAKAFVRTGEMTPYSNIILESGVVF
RBSD_HAES2      KEIREKEQQGNCIAVEYVEHEEFKVLSSESKAAVRTGEFSPYANIILYSGVPF
RBSD_VARPS      REAPAWCEGQLAALPETVSHEELKRLSARAKAVIRTGECTPYANIVLYAGVTF
RBSD_PSEE4      IEVEQMHARGEIGQREVMNHADFKALTRQARAVIRTGECRPYSNIALVAGVTF
RBSD_DESRM      EVTPVSLE--------VVSHEQLKSLSQRARAVIRTGEWTPYANVILYSGVAF
RBSD_BACSU      AEIKASNQENAKFLENLFSEQEIKLLTKDAKAVIRTGEFTPYANCILQAGVLF
RBSD_SYMTH      XXXXXXTRLLGGVPVTTVSHEELKEISARAVALVRTGECTPYANVILRAGVTF
RBSD_PSEU2      EVKPPALQEDQLGQQRWISHEDLKVLSRKAKAIIRTGECQPYSNVALVSGVVF
RBSD_PSEPF      STLDELNDEGSLGRRDLLSHEQFKVLSRQARAIVRTGECQPYCNIVLVAGVTF
RBSD_PSE14      EVKPPALQDDQLGQQRWISHEDLKVLSRKAKAIIRTGECQPYSNVALVSGVVF
RBSD_PSESM      DIKPPALQDDQLGQQRWISHEDLKALSRTAKAIIRTGECQPYSNLALVSGVVF
RBSD_AERS4      PDTHQSLEQGKPIAIEYCLHEEFKTRSRQSKAIVRSGEITPYANLILCAGVAF
RBSD_PSEPG      KVVPERLK-GKLGKREWLSHENFKVLSRSARAVVRTGECQPYSNIALISGVTF
RBSD_PSEPK      KVVPERLK-GKLGKREWLTHEDFKVLSRSARAVVRTGECQPYSNIALISGVTF
RBSD_PSEP1      KVVPERLK-GKLGKREWLTHEDFKVLSRSARAVVRTGECQPYSNIALISGVTF
RBSD_LACJO      TENPKQLRTVPNVEIEFIPHSELKKDLKSSKAFIRTGEETPYSNVILESGVVF
RBSD_PSEFS      LKQPPALNEAALGERRLVSHEAFKQLSRKARAVVRTGECQPYCNIALVSGVTF
RBSD_HAES1      KEIREKEQQGNCIAVEYVEHEEFKVLSSESKVAVCTGEFSPYANIILYSGVPF
RBSD_LACGA      TENPKQLKTLPNVEIEFIPHSELKKDLKTSKAFIRTGEETPYSNVILESGVTF
RBSD_PSEF5      QPTPGMTAGGELGQRQLMNHEDFKVLSRQARAVIRTGECQPYCNIALIAGVTF
RBSD_PETMO      VNNLKNYQKVIDIFSNIEIEKKSHEEFKDIAFFIRTGECTPFSNIILVSGVIF
RBSD_AERHH      QLEAHAAAQGKPITIEYCLHEAFKARSHQSKAIVRSGEVTPYANLILCAGVAF
RBSD2_STRGG     -----------------------------------------------------
RBSD1_STRGG     -----------------------------------------------------
RBSD_THELT      EKFKDRVR--------------------ESKGVVRTGEQTSYSSVILVGGVTY
RBSD_STAAT      EHNPTQLQISSEIEIIFIPHEEMKSNLAHPLNKIRTGETTPYSNIALESNVTF
RBSD_STAA3      EHNPTQLQISSEIEIIFIPHEEMKSNLAHPLNKIRTGETTPYSNIALESNVTF
RBSD_STAAW      EHNPTQLQISSEIEIIFIPHEEMKSNLAHPLNKIRTGETTPYSNIALESNVTF
RBSD_STAAS      EHNPTQLQISSEIEIIFIPHEEMKSNLAHPLNKIRTGETTPYSNIALESNVTF
RBSD_STAAR      EHNPTQLQISSEIEIIFIPHEEMKSNLAHPLNKIRTGETTPYSNIALESNVTF
RBSD_STAAN      EHNPTQLQISSEIEIIFIPHEEMKSNLAHPLNKIRTGETTPYSNIALESNVTF
RBSD_STAAM      EHNPTQLQISSEIEIIFIPHEEMKSNLAHPLNKIRTGETTPYSNIALESNVTF
RBSD_STAAE      EHNPTQLQISSEIEIIFIPHEEMKSNLAHPLNKIRTGETTPYSNIALESNVTF
RBSD_STAAC      EHNPTQLQISSEIEIIFIPHEEMKSNLAHPLNKIRTGETTPYSNIALESNVTF
RBSD_STAAB      EHNPTQLQISSEIEIIFIPHEEMKSNLAHPLNKIRTGETTPYSNIALESNVTF
RBSD_STAA9      EHNPTQLQISSEIEIIFIPHEEMKSNLAHPLNKIRTGETTPYSNIALESNVTF
RBSD_STAA8      EHNPTQLQISSEIEIIFIPHEEMKSNLAHPLNKIRTGETTPYSNIALESNVTF
RBSD_STAA2      EHNPTQLQISSEIEIIFIPHEEMKSNLAHPLNKIRTGETTPYSNIALESNVTF
RBSD_STAA1      EHNPTQLQISSEIEIIFIPHEEMKSNLAHPLNKIRTGETTPYSNIALESNVTF
RBSD_STACT      MHNPDQLKAIKGLIAEDVEIEFIHSQMKEYLSNVRTGEITPFSNIILESNVTF
RBSD_THENN      KEMDEKSKMNGPVEVVTVPHKEFKEMSKNVKGIIRTGADIPYSNVILVGGVIF
RBSD_THEMA      KEMDEKSKMNGPVEVVTVPHKEFKEMSKNVKGIIRTGADIPYSNVILVGGVIF
RBSD_ACIAC      TEAVERXXXXXXXXXQTLSHEEFKRLTRDARAVVRTGECTPYANVILCAGVTF
RBSD2_RUBXD     -----------------------------------------------------
RBSD_KOSOT      DKNPEMHNAILKLFSDAAVDYVEHSEFKKIAAVIRTGEATPYSNVILSSGVDF
RBSD_STAES      TANAQQLKVEIKFIAHSEMKEMLKSPLNKGN--IRTGEITPFSNIILESNVTF
RBSD_STAEQ      TANAQQLKVEIKFIAHSEMKEMLKSPLNKGN--IRTGEITPFSNIILESNVTF
RBSD_THEP1      -----------------------------------------------------
RBSD_STRAW      REVREALLQTRFPALELVPHEELKSLSANARLIVRTGEARPYANVLLRCGVFF
CJ125_HUMAN     -----------------------------------------------------