[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF54336.1

[Show Plain Result]


## Summary of Sequence Search
    1::391
  265::579     1e-35  34%  663 aa  CMPC_SYNP6 RecName: Full=Bicarbonate transport ATP-binding protein
  265::579     1e-35  34%  663 aa  CMPC_SYNE7 RecName: Full=Bicarbonate transport ATP-binding protein
  250::589     5e-30  28%  670 aa  NRTC_SYNY3 RecName: Full=Nitrate transport ATP-binding protein
   58::371     3e-29  30%  440 aa  NRTA_ANASP RecName: Full=Nitrate transport protein nrtA;Flags:
  281::585     2e-28  32%  667 aa  CMPC_SYNY3 RecName: Full=Bicarbonate transport ATP-binding protein
   58::373     1e-27  30%  443 aa  NRTA_SYNE7 RecName: Full=Nitrate transport protein nrtA;Flags:
  283::583     6e-26  32%  659 aa  NRTC_SYNE7 RecName: Full=Nitrate transport ATP-binding protein
   62::375     9e-25  29%  446 aa  NRTA_SYNY3 RecName: Full=Nitrate transport protein nrtA;Flags:
   61::380     3e-23  29%  452 aa  CMPA_SYNY3 RecName: Full=Bicarbonate-binding protein cmpA;Flags:
   59::383     9e-17  24%  450 aa  CMPA_SYNP6 RecName: Full=Bicarbonate-binding protein cmpA;Flags:
   59::383     9e-17  24%  450 aa  CMPA_SYNE7 RecName: Full=Bicarbonate-binding protein cmpA;Flags:
   22::257     4e-05  26%  319 aa  Y4186_BRUSU RecName: Full=Putative binding protein BRA1186;Flags:
   22::257     4e-05  26%  319 aa  Y3646_BRUA2 RecName: Full=Putative binding protein BAB2_1146;Flags:
   22::257     4e-05  26%  319 aa  Y3422_BRUAB RecName: Full=Putative binding protein
   22::257     4e-05  26%  319 aa  Y3109_BRUME RecName: Full=Putative binding protein BMEII0109;Flags:
  570::676     5e-04  31%  745 aa  ANKK1_MOUSE RecName: Full=Ankyrin repeat and protein kinase
  506::635     8e-04  23% 4377 aa  ANK3_HUMAN RecName: Full=Ankyrin-3;         Short=ANK-3;AltName:
    1::391

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTHTLFDSRRFLQLGAFASLSTALAGAARYVTSTSNNEPADNTPLTIGYVPIACSAPIAIANALGLFKKH
CMPC_SYNP6      ---------------------------ARKVTTVARHG-LEKVNLEIGYVPLMACAPLVVAQEKAFFAKH
CMPC_SYNE7      ---------------------------ARKVTTVARHG-LEKVNLEIGYVPLMACAPLVVAQEKAFFAKH
NRTC_SYNY3      MVYFLNQQKRAKKVGAVSQFAEAMGGNG-----------LEKINLDLGFIPLTDCAPLVVAKEKGFFQKH
NRTA_ANASP      ----------------------------------------ETTKAKLGFIPLTDAAPLIIAKEKGFFAKY
CMPC_SYNY3      --------------------------------------------LELGYXXXXXXXXXXXXQEKGFFAKH
NRTA_SYNE7      --------------------------------------------VTLGFIALTDAAPVIIALEKGLFAKY
NRTC_SYNE7      ----------------------------------------------LGFLPGNDCAPLAIAQELGLFQDL
NRTA_SYNY3      ------------------------------------------TTAKLGFIALTDAAPLIIAKEKGFYAKY
CMPA_SYNY3      --------------------------------------------IKLGYIPIVEAAPLIIAQEKGFFAKY
CMPA_SYNP6      --------------------------------------------IKLGYIPIFEAAPLIIGREKGFFAKY
CMPA_SYNE7      --------------------------------------------IKLGYIPIFEAAPLIIGREKGFFAKY
Y4186_BRUSU     ---------------------------------------ADNIPVRVGYIADYWGTSIAIASEKGLWEKH
Y3646_BRUA2     ---------------------------------------ADNIPVRVGYIADYWGTSIAIASEKGLWEKH
Y3422_BRUAB     ---------------------------------------ADNIPVRVGYIADYWGTSIAIASEKGLWEKH
Y3109_BRUME     ---------------------------------------ADNIPVRVGYIADYWGTSIAIASEKGLWEKH
ANKK1_MOUSE     -------------------------------------------------------SPLHIAAARGIFKRY
ANK3_HUMAN      ---------------------SARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDH


                         .         .         *         .         .         .         .:140
query           GVNVTLKKYSGWSDLWTAYATEQLDVAHMLSPMTVAINAGVTNASRPMELSFTQNTNGQAITLASKHYGS
CMPC_SYNP6      GLDVSLVRETSWRGIVDGLTENYLDAAQMPAGMPVWMSVGGQGGSPPIVSSLTMSRNGNGITLSKALYDE
CMPC_SYNE7      GLDVSLVRETSWRGIVDGLTENYLDAAQMPAGMPVWMSVGGQGGSPPIVSSLTMSRNGNGITLSKALYDE
NRTC_SYNY3      GLEVNLVKEPSWQAIADGIRERRLDGAQMVAGMPLALTLGMGGKTPPMVTAMVMSRNGNAITLSKKFAAG
NRTA_ANASP      GMDIEVIKQKSWDNLKIGSSGGGIDGAHILSPMPYLMTI---NDKVPMYILARLNTNGQAISVAEK-FKE
CMPC_SYNY3      GLDVSLVRETSWRGIVDGIAGGYLDGAQMPAGMPTWLTAGYREQSIPVVSALTMTRNGNAITLSKKLYDQ
NRTA_SYNE7      GLPDTVVKQTSWANLELGSDRGGIDGAHILSPMPYLLTAGTITKSQPMYILARLNTQGQGISLSNEFLAE
NRTC_SYNE7      GLSVELQSFLTWEALEDSIRLGQLEGALMMAAQPLAMTMGL-GGHRPFAIALTVSRNGGAIALSRRYLNA
NRTA_SYNY3      GMDVEVLKQASWGNLVLGSASGGIDGAHILTPMPYLITMGTVTDGKPMYILARLNVNGQGIQLGNKDLKV
CMPA_SYNY3      GMTVEVSKQANWANVTXXXXXXXXXXXXWQMPMPHLITEGITNGNKPMYVLAQLITQGNGIAVAPMHEGK
CMPA_SYNP6      GLDVEVSKQASWANVILXXXXXXXXXXQWQMPMPALLTEGISNGQKPMYVLACLSTQGNGIAVSNKAQNL
CMPA_SYNE7      GLDVEVSKQASWANVILXXXXXXXXXXQWQMPMPALLTEGISNGQKPMYVLACLSTQGNGIAVSNKAQNL
Y4186_BRUSU     GLDADTRVFTNGPIQVQALGAGSLDFGYIGPGALWLPASGKAKIVAINSVGFSDRVIAQE---------G
Y3646_BRUA2     GLDADTRVFTNGPIQVQALGAGSLDFGYIGPGALWLPASGKAKIVAINSVGFSDRVIAQE---------G
Y3422_BRUAB     GLDADTRVFTNGPIQVQALGAGSLDFGYIGPGALWLPASGKAKIVAINSVGFSDRVIAQE---------G
Y3109_BRUME     GLDADTRVFTNGPIQVQALGAGSLDFGYIGPGALWLPASGKAKIVAINSVGFSDRVIAQE---------G
ANKK1_MOUSE     GASLELRTQQGWTPLHLATYKGHLEIIHQLAKSHVDLDALGSMQWTPLHLAAFQGEEG--VMLALLQCGA
ANK3_HUMAN      GASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLASPHAAA


                         +         .         .         .         .         *         .:210
query           VNSAADLKGMVLGIPFEYSVHALLLRDYLASNAVDPIADLKLRLLPPADMVAQLTVEGIAGFIGPEPFNE
CMPC_SYNP6      LRSTAD-KQHIMGIVHPASMHNLLLRYWLAANQIDPDRDVQLRTIPPAQMVADLKDGTIDGYCIGEPWNA
CMPC_SYNE7      LRSTAD-KQHIMGIVHPASMHNLLLRYWLAANQIDPDRDVQLRTIPPAQMVADLKDGTIDGYCIGEPWNA
NRTC_SYNY3      VKTLEDLRLKLLGMVHPASMQNLLLRYWLASGSIDPDQDINLMRLPPPQMVSNLEAGNIDGFCVGEPWNS
NRTA_ANASP      LNVNLEXXXXXMGITFPGGTHDLWMRYWLAAGGINPDQDVVLEAVPPPQMVANMKVNTVDGFCVGEPWNA
CMPC_SYNY3      IYTAEDFRQLLLGMVHPSSMHNLLLRYWLAAHNINPDRDVHLKTIPPAQMVADLKAGTIDGYCVSEPWNL
NRTA_SYNE7      LKAIADQKGKLLAVTFPGGTHDLWMRYWLAANGIDPNNDADLVVIPPPQMVANMQTGTMDTFCVGEPWNA
NRTC_SYNE7      VRSLEDLQRLRLAIPDPIAMPALLLRYWLASAGLNPEQDVELVGMSPYEMVEALKAGDIDGFAAGEMRIA
NRTA_SYNY3      GTDAAPLKEAFVAMTFPGGTHDMWIRYWLAAGGMEPGKDFSTIVVPPAQMVANVKVNAMESFCVGEPWPL
CMPA_SYNY3      ITKAADIKGFTNGRKFK-AAHTFWIRYWFAAGGVDPDTDIDLLAVPPAETVQGMRNGTMDAFSTGDPWPY
CMPA_SYNP6      GLKLAPNRDFILNYPFPNANQDFWIRYWFAAGGIDPDKDIELLTVPSAETLQNMRNGTIDCFSTGDPWPS
CMPA_SYNE7      GLKLAPNRDFILNYPFPNANQDFWIRYWFAAGGIDPDKDIELLTVPSAETLQNMRNGTIDCFSTGDPWPS
Y4186_BRUSU     FKSMADLKGKKIGVP-EGTSGDMLLRLALGKAGM-KLDDVQVIKMDPSTVVSAFASKQIAGIWYPLIGTI
Y3646_BRUA2     FKSMADLKGKKIGVP-EGTSGDMLLRLALGKAGM-KLDDVQVIKMDPSTVVSAFASKQIAGIWYPLIGTI
Y3422_BRUAB     FKSMADLKGKKIGVP-EGTSGDMLLRLALGKAGM-KLDDVQVIKMDPSTVVSAFASKQIAGIWYPLIGTI
Y3109_BRUME     FKSMADLKGKKIGVP-EGTSGDMLLRLALGKAGM-KLDDVQVIKMDPSTVVSAFASKQIAGIWYPLIGTI
ANKK1_MOUSE     NPNAAEQSGWT---PLHLAVH-------------------------------------------------
ANK3_HUMAN      KNGYTPL---------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RAISNGSGRIWLLTKQVWDKHPCCAVAKAKEWKAEHPTAAQGVLNALEEVSAILSNPAQFDSSARTLSQE
CMPC_SYNP6      WAAQKEIGFTIASDLEIWNGHPGKVLGVREDWANRYPNSHVALVKALLEACQYCEDPANWDELRELLSDR
CMPC_SYNE7      WAAQKEIGFTIASDLEIWNGHPGKVLGVREDWANRYPNSHVALVKALLEACQYCEDPANWDELRELLSDR
NRTC_SYNY3      YAVKQNLGYVIATDLDIWNGHPEKVLGMREEWVNKYPATHLALVKALLEACEYCDDRRHRQEILDYLALP
NRTA_ANASP      QLVNQKIGYSALVTGELWKDHPEKAFSMRQDWIEQNPNAAQAILMAILEAQQWCDKAENKEEMCKICSDR
CMPC_SYNY3      RASMEGAGFSIATDLEIWQNHPGKVLGVREDWAIAHPNTHVALVKALLEACAYCADPNHEMEIRELLATR
NRTA_SYNE7      RLVNKKLGYTAAVTGELWKFHPEKALTIRADWADKNPKATMALLKAVQEAQIWCEDPANLDELCQITAQD
NRTC_SYNE7      LAVQAGAAYVLATDLDIWAGHPEKVLGLPEAWLQVNPETAIALCSALLKAGELCDDPRQRDRIVEVLQQP
NRTA_SYNY3      QTVNQGVGYQALTTGQLWKDHPEKAFGMRADWVDQNPKAAKALLMAVMEAQQWCDQAENKEEMCQILSKR
CMPA_SYNY3      RIVTENIGYMAGLTAQIWPYHPEEYLAIRADWVDKNPKATKALLKGIMEAQQWIDDPKNRPEVVQIVSGR
CMPA_SYNP6      RIAKDDVGYQAALTGQMWPYHPEEFLALRADWVDKHPKATLALLMGLMEAQQWCDQKANRAEMAKILSGR
CMPA_SYNE7      RIAKDDIGYQAALTGQMWPYHPEEFLALRADWVDKHPKATLALLMGLMEAQQWCDQKANRAEMAKILSGR
Y4186_BRUSU     KEHVPGMVELAANSDFFPDKTFPSAFIARNEIVAENPEAVKRMIAVIEEAEDFTANPEQVDITAKFLKVD
Y3646_BRUA2     KEHVPGMVELAANSDFFPDKTFPSAFIARNEIVAENPEAVKRMIAVIEEAEDFTANPEQVDITAKFLKVD
Y3422_BRUAB     KEHVPGMVELAANSDFFPDKTFPSAFIARNEIVAENPEAVKRMIAVIEEAEDFTANPEQVDITAKFLKVD
Y3109_BRUME     KEHVPGMVELAANSDFFPDKTFPSAFIARNEIVAENPEAVKRMIAVIEEAEDFTANPEQVDITAKFLKVD
ANKK1_MOUSE     ----------------------------------------------------------------------
ANK3_HUMAN      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KYLNQPAALLDGPFSGMYQDWHGQTHTDHERMSFGDPTDPTAIIWMATQIARWGLGGDVLxxxxxxxxxx
CMPC_SYNP6      RYLSCPKEYIQ--FS---QSTADDLAVPHHRFAGAGVNRPTEHLWMMTQLARWG----------------
CMPC_SYNE7      RYLSCPKEYIQ--FS---QSTADDLAVPHHRFAGAGVNRPTEHLWMMTQLARWG----------------
NRTC_SYNY3      QYVGTSTEYISPGFLTEYNDAEAEMLLDFNQFYVKQSNYPSRSLWILTQLARWG----------------
NRTA_ANASP      KYFNVAAADIIERAKGNYGDGRKEQNFAHRMKFWADNASKSHDIWFLTEDIRWG----------------
CMPC_SYNY3      QYLNIDYIHLGDPEGRTCRLGNPVEYSHH--LFFGDQPSRTEHLWMMTQMARWG----------------
NRTA_SYNE7      KYFKTSVEDIKPRLQGDIDYGDGRSVKNSDRMRFWSENAKSHDLWFLTEDIRWG----------------
NRTC_SYNE7      QYLGSAA----GTVLQRYFDFFNQFHVD--QANYPNPLEGT---WLLTQLCRWGL---------------
NRTA_SYNY3      EWFKVPFEDIIDRSKGIYNFGNGQTFEDQEIMQVDNASYPSHDQWFLTENIRWG----------------
CMPA_SYNY3      NYFNVPTTILESPFKGQYTMGDGQPAIDYWKDGIGNVSYPSHDLWFLTESIRWG----------------
CMPA_SYNP6      NFFNVPVSILQPILEGQIKDGKDLNNFDAGPLFWKSPRGSVSTLWFLVESIRWGFNKQVL----------
CMPA_SYNE7      NFFNVPVSILQPILEGQIKDGKDLNNFDAGPLFWKSPRGSVSTLWFLVESIRWGFNKQVL----------
Y4186_BRUSU     K---------------------------------------------------------------------
Y3646_BRUA2     K---------------------------------------------------------------------
Y3422_BRUAB     K---------------------------------------------------------------------
Y3109_BRUME     K---------------------------------------------------------------------
ANKK1_MOUSE     ----------------------------------------------------------------------
ANK3_HUMAN      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CMPC_SYNP6      -----------------------------------------
CMPC_SYNE7      -----------------------------------------
NRTC_SYNY3      -----------------------------------------
NRTA_ANASP      -----------------------------------------
CMPC_SYNY3      -----------------------------------------
NRTA_SYNE7      -----------------------------------------
NRTC_SYNE7      -----------------------------------------
NRTA_SYNY3      -----------------------------------------
CMPA_SYNY3      -----------------------------------------
CMPA_SYNP6      -----------------------------------------
CMPA_SYNE7      -----------------------------------------
Y4186_BRUSU     -----------------------------------------
Y3646_BRUA2     -----------------------------------------
Y3422_BRUAB     -----------------------------------------
Y3109_BRUME     -----------------------------------------
ANKK1_MOUSE     -----------------------------------------
ANK3_HUMAN      -----------------------------------------