[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF54367.1

[Show Plain Result]


## Summary of Sequence Search
    1::185
  658::831     8e-45  51%  842 aa  PYGM_BOVIN RecName: Full=Glycogen phosphorylase, muscle form;      
  658::831     1e-44  51%  842 aa  PYGM_SHEEP RecName: Full=Glycogen phosphorylase, muscle form;      
  658::831     3e-44  50%  850 aa  PYGL_RAT RecName: Full=Glycogen phosphorylase, liver form;       
  658::831     5e-44  50%  842 aa  PYGM_MACFA RecName: Full=Glycogen phosphorylase, muscle form;      
  658::831     5e-44  50%  842 aa  PYGM_HUMAN RecName: Full=Glycogen phosphorylase, muscle form;      
  658::831     5e-44  50%  851 aa  PYGL_BOVIN RecName: Full=Glycogen phosphorylase, liver form;       
  658::831     7e-44  50%  851 aa  PYGL_SHEEP RecName: Full=Glycogen phosphorylase, liver form;       
  658::831     7e-44  49%  850 aa  PYGL_MOUSE RecName: Full=Glycogen phosphorylase, liver form;       
  658::831     7e-44  49%  847 aa  PYGL_HUMAN RecName: Full=Glycogen phosphorylase, liver form;       
  657::828     7e-44  51%  849 aa  PHSG_SYNY3 RecName: Full=Glycogen phosphorylase;       
  658::831     9e-44  50%  843 aa  PYGM_RABIT RecName: Full=Glycogen phosphorylase, muscle form;      
  658::831     3e-43  49%  842 aa  PYGM_MOUSE RecName: Full=Glycogen phosphorylase, muscle form;      
  658::831     6e-43  49%  842 aa  PYGM_RAT RecName: Full=Glycogen phosphorylase, muscle form;        
  658::831     9e-41  48%  843 aa  PYGB_HUMAN RecName: Full=Glycogen phosphorylase, brain form;       
  658::831     2e-40  47%  838 aa  PYGB_RAT RecName: Full=Glycogen phosphorylase, brain form;       
  658::831     2e-40  47%  843 aa  PYGB_PONAB RecName: Full=Glycogen phosphorylase, brain form;       
  623::796     3e-40  49%  797 aa  PHSM_ECOLI RecName: Full=Maltodextrin phosphorylase;       
  658::831     1e-39  47%  843 aa  PYGB_MOUSE RecName: Full=Glycogen phosphorylase, brain form;       
  624::796     3e-39  49%  798 aa  PHSG_BACSU RecName: Full=Glycogen phosphorylase;       
  639::812     4e-39  48%  815 aa  PHSG_SHIFL RecName: Full=Glycogen phosphorylase;       
  639::812     4e-39  48%  815 aa  PHSG_ECOLI RecName: Full=Glycogen phosphorylase;       
  644::812     7e-39  44%  824 aa  PHSG_CHLPN RecName: Full=Glycogen phosphorylase;       
  658::826     1e-38  48%  843 aa  PYGB_BOVIN RecName: Full=Glycogen phosphorylase, brain form;       
  644::816     2e-38  45%  818 aa  PHSG_PASMU RecName: Full=Glycogen phosphorylase;       
  658::826     6e-38  47%  843 aa  PYGB_SHEEP RecName: Full=Glycogen phosphorylase, brain form;       
  644::816     4e-37  47%  821 aa  PHSG_HAEIN RecName: Full=Glycogen phosphorylase;       
  639::809     2e-36  43%  813 aa  PHSG_CHLMU RecName: Full=Glycogen phosphorylase;       
  639::813     5e-36  43%  814 aa  PHSG_CHLTR RecName: Full=Glycogen phosphorylase;       
  658::831     3e-34  42%  844 aa  PYG_DROME RecName: Full=Glycogen phosphorylase;         EC=2.4.1.1;
  664::839     5e-34  43%  841 aa  PHSH_ARATH RecName: Full=Alpha-glucan phosphorylase, H isozyme;    
  797::970     4e-33  46%  974 aa  PHSL2_SOLTU RecName: Full=Alpha-1,4 glucan phosphorylase L-2
  789::961     5e-33  47%  966 aa  PHSL1_SOLTU RecName: Full=Alpha-1,4 glucan phosphorylase L-1
  728::900     2e-32  41%  902 aa  PHSG_YEAST RecName: Full=Glycogen phosphorylase;       
  580::751     2e-32  48%  752 aa  PHSM_STRPN RecName: Full=Maltodextrin phosphorylase;       
  826::999     3e-32  46% 1003 aa  PHSL_VICFA RecName: Full=Alpha-1,4 glucan phosphorylase L isozyme,
  661::832     5e-32  42%  838 aa  PHSH_SOLTU RecName: Full=Alpha-glucan phosphorylase, H isozyme;    
  778::951     6e-32  44%  955 aa  PHSL_IPOBA RecName: Full=Alpha-1,4 glucan phosphorylase L isozyme,
  665::837     1e-31  41%  842 aa  PHSH_VICFA RecName: Full=Alpha-glucan phosphorylase, H isozyme;    
  740::908     1e-31  43%  993 aa  PHS2_DICDI RecName: Full=Glycogen phosphorylase 2;       
  674::842     2e-31  44%  853 aa  PHS1_DICDI RecName: Full=Glycogen phosphorylase 1;       
  655::830     3e-31  40%  832 aa  PHSH_WHEAT RecName: Full=Alpha-glucan phosphorylase, H isozyme;    
  408::484     7e-04  35%  519 aa  Y1631_METJA RecName: Full=Uncharacterized protein MJ1631;
    1::185

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPASDVSEQISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIFGARVEELPALRESYQ
PYGM_BOVIN      IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVERLQKGYN
PYGM_SHEEP      IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVERLQKGYN
PYGL_RAT        IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRVDDVAALKKGYE
PYGM_MACFA      IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDKLQRGYN
PYGM_HUMAN      IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDKLQRGYN
PYGL_BOVIN      IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIEDVAALKKGYE
PYGL_SHEEP      IPATDLSEQISTAGTEASGTGNMKFMQNGALTIGTMDGANVEMAEEAGEENLFIFGMRVEDVAALKKGYE
PYGL_MOUSE      IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRVDDVAALKKGYE
PYGL_HUMAN      IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALKKGYE
PHSG_SYNY3      -PAADLSEQISTAGKEASGTGNMKFSMNGALTIGTLDGANIEIREEVGAENFFLFGLTTPEVKTLAEGYQ
PYGM_RABIT      IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
PYGM_MOUSE      IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVERLQRGYN
PYGM_RAT        IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEDNFFIFGMRVEDVERLQRGYN
PYGB_HUMAN      IPAADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGAENLFIFGLRVEDVEALRKGYN
PYGB_RAT        IPAADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRVEDVEALQKGYN
PYGB_PONAB      IPAADLSQQISTAGAEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGAENLFIFGLQVEDVEALRKGYN
PHSM_ECOLI      IPAADISEQISTAGKEASGTGNMKLALNGALTVGTLDGANVEIAEKVGEENIFIFGHTVEQVKALAKGYD
PYGB_MOUSE      IPAADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRVEDVEALQKGYN
PHSG_BACSU      -PASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENYR
PHSG_SHIFL      IPAADLSEQISLAGTEASGTSNMKFALNGALTIGTLDGANVEMLDHVGADNIFIFGNTAEEVEELRQGYK
PHSG_ECOLI      IPAADLSEQISLAGTEASGTSNMKFALNGALTIGTLDGANVEMLDHVGADNIFIFGNTAEEVEELRQGYK
PHSG_CHLPN      IPGTDLSEQISTAGMEASGTGNMKFALNGALTIGTMDGANIEMAEHIGKENMFIFGLLEEQIVQLRREYC
PYGB_BOVIN      IPAADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGAENLFIFGLRVEDVEALRKGYN
PHSG_PASMU      IPAADISEQISLAGTEASGTSNMKFALNGALTIGTLDGANVEILDNVGQDHIFIFGNTVEQVESLRHGYR
PYGB_SHEEP      IPAADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGAENLFIFGLRVEDVEALRKGYN
PHSG_HAEIN      IPAADISEQISLAGTEASGTSNMKFALNGALTLGTLDGANVEILENVGEDNIFIFGNTVEQVEQLREGYR
PHSG_CHLMU      IPATDLSEQISTAGMEASGTGNMKFALNGALTIGTMDGANIEMAEHIGKEHMFIFGLLEEEISALRNEYY
PHSG_CHLTR      IPATDLSEQISTAGMEASGTGNMKFALNGALTIGTMDGANIEMAEHIGKEHMFIFGLLEEEISELRKEYY
PYG_DROME       MPAADLSEQISTAGTEASGTGNMKFQLNGALTIGTLDGANVEMAEEMGLDNIFIFGMTVDEVEALKKGYN
PHSH_ARATH      IPGSELSQHISTAGMEASGTSNMKFALNGCLIIGTLDGANVEIREEVGEENFFLFGATADQVPRLRKERE
PHSL2_SOLTU     IPGSELSQHISTAGMEASGTSNMKFSMNGCLLIGTLDGANVEIREEVGEDNFFLFGAQAHEIAGLRKKFV
PHSL1_SOLTU     IPASDLSEHISTAGMEASGTSNMKFAMNGCIQIGTLDGANVEIREEVGEENFFLFGAQAHEIAGLRKKFV
PHSG_YEAST      IPASDLSEHISTAGTEASGTSNMKFVMNGGLIIGTVDGANVEITREIGEDNVFLFGNLSENVEELRYNHQ
PHSM_STRPN      IPACDISEQISLASKEASGTGNMKFMLNGALTLGTMDGANVEIAELVGEENIYIFGEDSETVIDLKAAYK
PHSL_VICFA      IPASELSQHISTAGMEASGTSNMKFAMNGCLQIGTLDGANVEIREEVGADNFFLFGAKAREIVGLRKKFV
PHSH_SOLTU      IPGSELSQHISTAGMEASGTSNMKFALNGCLIIGTLDGANVEIREEIGEDNFFLFGATADEVPQLRKD-R
PHSL_IPOBA      IPASGLSQHISTAGMEASGQSNMKFAMNGCILIGTLDGANVEIRQEVGEENFFLFGAEAHEIAGLRKKFV
PHSH_VICFA      IPGSELSQHISTAGMEASGTSNMKFALNRVLIIGTLDGANVEIREEIGEENFFLFGATADEVPRLRKE-R
PHS2_DICDI      IPASDISQHISTAGTEASGTSNMKFSMNGGLIIGTLDGANIEIRDAIGHENMYIFGARSEEVNKVKKIIH
PHS1_DICDI      VPASDINQQISTAGTEASGTSNMKFTMNGSLIIGTLDGANVEIAEEVGQENMFIFGLRTSEVEAAREKMT
PHSH_WHEAT      IPGSELSQHISTAGMEASGTSNMKFSLNGCVIIGTLDGANVEIREEVGQDNFFLFGAKADQVAGLRKD-R
Y1631_METJA     ---SDIWLNTPKLNHEASGTSGMTASMNASIHMSTLDGWHVEIGDGVRDDDAYVANCIYNLLEEVADMY-


                         .         .         *         .         .         .         .:140
query           PYELYETVPGLKRALDALDNGTLNDNNSGLFYDLKHSLIHGYGKDASDTYYVLGDFADYRETRDRMAADY
PYGM_BOVIN      AQEYYDRIPELRHVIDQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYIKCQERVSALY
PYGM_SHEEP      AQEYYDRIPELRHIIDQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
PYGL_RAT        AKEYYEALPELKLVIDQIDNGFFSPNQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQEKVSQLY
PYGM_MACFA      AQEYYDRIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEDYIKCQEKVSALY
PYGM_HUMAN      AQEYYDRIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEDYIKCQEKVSALY
PYGL_BOVIN      AKEYYEALPELKLAIDQIDKGFFSPKQPDLFKDLVNMLFY------HDRFKVFADYEAYVKCQEKVSQLY
PYGL_SHEEP      AKEYYEALPELKLAIDQIDKGFFSPKQPDLFKDLVNMLFY------HDRFKVFADYEAYVKCQEKVSQLY
PYGL_MOUSE      AKEYYEALPELKLVIDQIDNGFFSPNQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQEKVSQLY
PYGL_HUMAN      AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFY------HDRFKVFADYEAYVKCQDKVSQLY
PHSG_SYNY3      PWEYYNNNANLKAVVDLINSGFFSHGDTALFRPLMDSLL------GQDPYLVFADFQAYVDCQNQVGEAY
PYGM_RABIT      AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYVKCQERVSALY
PYGM_MOUSE      AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH------HDRFKVFADYEEYIKCQDKVSELY
PYGM_RAT        AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMVMH------HDRFKVFADYEEYIKCQDKVSELY
PYGB_HUMAN      AREYYDHLPELKQAVDQISSGFFSPKEPDCFKDIVNMLMH------HDRFKVFADYEAYMQCQAQVDQLY
PYGB_RAT        AQEFYERLPELRQAVDQISSGFFSPKDPDCFKDVVNMLMY------HDRFKVFADYEAYIQCQAQVDHLY
PYGB_PONAB      AREYYDHLPELKQAVDQISSGFFSPKEPNCFKDIVNMLMH------HDRFKVFADYEAYMQCQAQVDQLY
PHSM_ECOLI      PVKWRKKDKVLDAVLKELESGKYSDGDKHAFDQMLHSI----GKQGGDPYLVMADFAAYVEAQKQVDVLY
PYGB_MOUSE      AREFYERLPELRQAVDQISSGFFSPKDPDCFKDVVNMLMY------HDRFKVFADYEAYIQCQAQVDRLY
PHSG_BACSU      SREYYQHDRRIRQVADQLINGFF-EGEADEFESIFDSLL-----PHNDEYFVLKDFSSYADAQERIQADY
PHSG_SHIFL      PREYYEKDEELHQVLTQIGSGVFSPEDPGRYRDLVDSLI-----NFGDHYQVLADYRSYVDCQDKVDELY
PHSG_ECOLI      PREYYEKDEELHQVLTQIGSGVFSPEDPGRYRDLVDSLI-----NFGDHYQVLADYRSYVDCQDKVDELY
PHSG_CHLPN      PQTICDKNPKIRQVLDLLEQGFFNSNDKDLFKPIVHRLLH-----EGDPFFVLADLESYIAAHENVNKLF
PYGB_BOVIN      AHEYYDRLPELRQAVDQINGGFFSPREPDCFKDVVNMLLN------HDRFKVFADYEAYVACQARVDQLY
PHSG_PASMU      PFDYYQNDEELRKVVDQIISGRFSPTDANRYHQLLQSLQY------HDYYQAFADFRSYVDMQQNVDAKY
PYGB_SHEEP      AHEYYNHLPELQQAVDQINSGFFSPREPDCFKDVVNMLLN------HDRFKVFADYEAYVACQAQVDQLY
PHSG_HAEIN      SFEYYQNDAQLRTVVDQIIEGKFSPEDPQRYHQLLQGLQY------HDYYQAFADFRSYVETQKAVDEKY
PHSG_CHLMU      PQGICNANPKIQEILDMVLQARLPEEDKDLFKPIVNRLL-----NEGDPFFVLADLESYLDAHNRVARLF
PHSG_CHLTR      PQGICNANPTIQEILDMIAQAKFSQEDKDLFKPIVNRLL-----NEGDPFFVLADLEAYINTQNRVASLF
PYG_DROME       AYDYYNANPEVKQVIDQIQGGFFSPGNPNEFKNIADIXXXXXXXXXXXXXXXXXXXQD-------LVSKT
PHSH_ARATH      D-GLFKPDPRFEEAKQFVKSGVFGSYDYGPLLD---SLEGNTGFGRGDYFLVGYDFPSYMDAQAKVDEAY
PHSL2_SOLTU     PDPRFEEVKAFIR------TGVFGTYN---YEELMGSLEGNEGYGRADYFLVGKDFPDYIECQDKVDEAY
PHSL1_SOLTU     PDERFEEVKEFVR------SGAFGSYN---YDDLIGSLEGNEGFGRADYFLVGKDFPSYIECQEKVDEAY
PHSG_YEAST      -YHPQDLPSSLDSVLSYIESGQFSPENPNEFKPLVDSI-----KYHGDYYLVSDDFESYLATHELVDQEF
PHSM_STRPN      SSEFYAR-EAIKPLVDIVSDAVLAAGNKERLERFYNELIN------KDWFMTLLDLEDYIKVKEQMLADY
PHSL_VICFA      PDPRFEEVKKFVR------SGVFGSYN---YDELIGSLEGNEGFGRADYFLVGQDFPSYLECQEEVDKAY
PHSH_SOLTU      ENGLFKPDPRFEEAKQFIRSGAFGTYD---YNPLLESLEGNSGYGRGDYFLVGHDFPSYMDAQARVDEAY
PHSL_IPOBA      PDERFEEVK------EFIKRGVFGSNT---YDELLGSLEGNEGFGRGDYFLVGKDFPSYIECQEKVDEAY
PHSH_VICFA      ENGLFKPDPRFEEAKKFIRSGVFGSYD---YNPLLDSLEGNSGYGRGDYFLVGYDFPSYMDAQEKVDEAY
PHS2_DICDI      DGK-FTPDTRWARVLTAIKEDTFGPHEQ--FQDIINSVSGG-----NDHYILSYDFGSYLDIQNSIDQDF
PHS1_DICDI      NKEV-NIDPRLQEVFLNIELGTFGPPD--VFRPILDSLIF------SDFYLSIQDFPLYLDSQ-ASVDEL
PHSH_WHEAT      ENGLFKPDPRFEEAKQFIRSGAFGTYD---YTPLLDSLEGNTGFGRGDYFLVGYDFPSYIDAQARVDEAY
Y1631_METJA     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ASDPLGWARMAWINICESGRFSSDRTIRDYATEIWKLKPTPxxxx
PYGM_BOVIN      -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPT-----
PYGM_SHEEP      -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPT-----
PYGL_RAT        MNQK-AWNTMVLRNIAASGKFSSDRTIREYAKDIWNMEPS-----
PYGM_MACFA      -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
PYGM_HUMAN      -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
PYGL_BOVIN      -MNPKAWNIMVLKNIAASGKFSSDRTIKEYARDIWNMEPS-----
PYGL_SHEEP      -MNPKAWNIMVLKNIAASGKFSSDRTIKEYARDIWNMEPS-----
PYGL_MOUSE      MNQK-AWNTMVLKNIAASGKFSSDRTIKEYAKDIWNMEPS-----
PYGL_HUMAN      -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
PHSG_SYNY3      -KDQENWARMAILNVARMGKFSSDRTIREYAEDIWAIKP------
PYGM_RABIT      -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
PYGM_MOUSE      -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPS-----
PYGM_RAT        -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGLEPS-----
PYGB_HUMAN      -RNPKEWTKKVIRNIACSGKFSSDRTITEYAREIWGVEPS-----
PYGB_RAT        -RNPKDWTKKVIRNIACSGKFSSDRTITEYAREIWGVEPS-----
PYGB_PONAB      -RNPKEWTKKVIRNIACSGKFSSDRTITEYAREIWGVEPS-----
PHSM_ECOLI      -RDQEAWTRAAILNTARCGMFSSDRSIRDYQARIWQAK-------
PYGB_MOUSE      RNSK-EWTKKVIRNIACSGKFSSDRTITEYAREIWGVEPS-----
PHSG_BACSU      -RERRKWSEHSIVNIAHSGYFSSDRTIREYAKDIWGIKP------
PHSG_SHIFL      ELQE-EWTAKAMLNIANMGYFSSDRTIKEYADHIWHIDP------
PHSG_ECOLI      ELQE-EWTAKAMLNIANMGYFSSDRTIKEYADHIWHIDP------
PHSG_CHLPN      -KEPDSWTKISIYNTAGMGFFSSDRAIQDYARDIW----------
PYGB_BOVIN      -RNPKEWTKKVIRNIACSGKFSSDRTITEYAHDIW----------
PHSG_PASMU      -QDQNAWIDSTLQNIVNMSYFSSDRTILEYAEKIWKIKP------
PYGB_SHEEP      -RNPKEWTKKVIRNIACSGKFSSDRTITEYARDIW----------
PHSG_HAEIN      KQRD-QWIESTIQNIVNMGFFSSDRTIKEYAERIWKVEP------
PHSG_CHLMU      -TQPEEWTKKSIYNVGGIGFFSSDRSITDYASNIWNV--------
PHSG_CHLTR      -KQPEEWTKKSIYNVGGIGFFSSDRSIAEYASNIWNVRPT-----
PYG_DROME       YQNQAKWLEMSINNIASSGKFSSDRTIAEYAREIWGVEPT-----
PHSH_ARATH      -KDRKGWLKMSILSTAGSGKFSSDRTIAQYAKEIWNIEACP----
PHSL2_SOLTU     -RDQKKWTKMSILNTAGSFKFSSDRTIHQYARDIWRIEP------
PHSL1_SOLTU     -RDQKRWTTMSILNTAGSYKFSSDRTIHEYAKDIWNIE-------
PHSG_YEAST      HNQRSEWLKKSVLSLANVGFFSSDRCIEEYSDTIWNVEP------
PHSM_STRPN      -EDRDAWLDKVIVNISKAGFFSSDRTIAQYNEDIWHL--------
PHSL_VICFA      -RDQKKWTRMSILNTAGSSKFSSDRTIHEYAREIWNIEP------
PHSH_SOLTU      -KDRKRWIKMSILSTSGSGKFSSDRTISQYAKEIWNI--------
PHSL_IPOBA      RDQKI-WTRMSILNTAGSYKFSSDRTIHEYAKDIWNIQP------
PHSH_VICFA      -RDKKRWLKMSILSTAGSGKFSSDRTIAQYAKEIWNIE-------
PHS2_DICDI      -KDRAKWAKKSIMASVCCGKFSSDRTIKEYAQQIWGIE-------
PHS1_DICDI      WKDQSAWVKKSIINSASTYFFSSDRAMNEYAEQIWDIKP------
PHSH_WHEAT      -KDKKKWVKMSILNTAGSGKFSSDRTIDQYAKEIWGISACP----
Y1631_METJA     ---------------------------------------------