[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF54563.1

[Show Plain Result]


## Summary of Sequence Search
    1::140
    1::126     4e-10  32%  133 aa  ARSC1_STAHJ RecName: Full=Protein arsC 1;AltName: Full=Arsenate
    6::132     6e-10  31%  139 aa  ARSC_BACSK RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::127     6e-10  27%  131 aa  ARSC2_STAHJ RecName: Full=Protein arsC 2;AltName: Full=Arsenate
    5::127     8e-10  29%  131 aa  ARSC_STAAB RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::133     8e-10  31%  140 aa  ARSC_GEOTN RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::126     1e-09  30%  131 aa  ARSC_STAAU RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::126     1e-09  30%  131 aa  ARSC_STAAR RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::126     1e-09  30%  131 aa  ARSC_STAAN RecName: Full=Protein arsC;AltName: Full=Arsenate
    5::127     1e-09  28%  131 aa  ARSC_STAAT RecName: Full=Protein arsC;AltName: Full=Arsenate
    5::127     1e-09  28%  131 aa  ARSC_STAAE RecName: Full=Protein arsC;AltName: Full=Arsenate
    5::127     1e-09  28%  131 aa  ARSC_STAAC RecName: Full=Protein arsC;AltName: Full=Arsenate
    5::127     1e-09  28%  131 aa  ARSC_STAA8 RecName: Full=Protein arsC;AltName: Full=Arsenate
    5::127     1e-09  28%  131 aa  ARSC_STAA3 RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::126     1e-09  28%  131 aa  ARSC_MACCJ RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::126     1e-09  28%  131 aa  ARSC2_STAS1 RecName: Full=Protein arsC 2;AltName: Full=Arsenate
    1::127     2e-09  26%  131 aa  ARSC_STAES RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::127     2e-09  26%  131 aa  ARSC2_STAEQ RecName: Full=Protein arsC 2;AltName: Full=Arsenate
    1::127     4e-09  29%  131 aa  ARSC_STAXY RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::126     4e-09  30%  131 aa  ARSC1_STAS1 RecName: Full=Protein arsC 1;AltName: Full=Arsenate
    1::126     4e-09  27%  132 aa  ARSC1_STAEQ RecName: Full=Protein arsC 1;AltName: Full=Arsenate
    1::127     1e-08  29%  134 aa  ARSC_BREBN RecName: Full=Protein arsC;AltName: Full=Arsenate
    6::132     1e-08  29%  139 aa  ARSC_BACHD RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::132     2e-08  29%  139 aa  ARSC_BACLD RecName: Full=Protein arsC;AltName: Full=Arsenate
    6::132     8e-08  29%  139 aa  ARSC_BACSU RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::127     2e-07  28%  134 aa  ARSC_BACCQ RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::127     3e-07  28%  134 aa  ARSC_BACC7 RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::127     4e-07  28%  134 aa  ARSC_BACHK RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::127     4e-07  28%  134 aa  ARSC_BACAN RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::127     4e-07  28%  134 aa  ARSC_BACAC RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::127     4e-07  28%  134 aa  ARSC_BACAA RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::127     5e-07  28%  134 aa  ARSC_BACCZ RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::127     5e-07  28%  134 aa  ARSC2_BACC1 RecName: Full=Protein arsC 2;AltName: Full=Arsenate
    1::127     7e-07  27%  134 aa  ARSC_BACC3 RecName: Full=Protein arsC;AltName: Full=Arsenate
    6::132     9e-07  26%  139 aa  ARSC_OCEIH RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::127     2e-06  27%  134 aa  ARSC_BACCR RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::133     3e-06  27%  140 aa  ARSC_BACME RecName: Full=Protein arsC;AltName: Full=Arsenate
    1::127     9e-06  26%  134 aa  ARSC_BACC2 RecName: Full=Protein arsC;AltName: Full=Arsenate
    4::143     4e-04  23%  145 aa  EPSP2_RALSO RecName: Full=Probable low molecular weight
    1::140

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIDQPSVLFVCVGNGGKSQMXXXXXXXXXXXXXEIHSAGTKPGTKLNQQSLESIAEVGADMSQGFPKGID
ARSC1_STAHJ     -MDKKTIYFICSGNSCRSQMAEGWGKEILGEDWNVYSAGIET-HGVNPKAIEAMKEVDIDISNHTSDLID
ARSC_BACSK      ------IYFLCTGNSCRSQMAEGFGKHYLSDEWEVYSAGME-AHGLNPNAVKAMNEVGIDISDQTSDLIH
ARSC2_STAHJ     -MDKKTIYFICTGNSCRSQMAEGWGKKILGDEWQVYSGGIE-AHGVNPKAIEAMKEVGIDISNHTSNLID
ARSC_STAAB      -----TIYFICTGNSCRSQMAEGWAKQILAEDWNVYSAGIETHG-VNPKAIEAMKEVGIDISNHTSDLID
ARSC_GEOTN      MKNKKIIYFLCTGNSCRSQMAEGWAKKYLGDDWEVYSAGIE-AHGLNPNAVKVMKEVGIDISNQTSDVID
ARSC_STAAU      -MDKKTIYFICTGNSCRSQMAEGWGKEILGEGWNVYSAGIET-HGVNPKAIEAMKEVDIDISNHTSDLID
ARSC_STAAR      -MDKKTIYFICTGNSCRSQMAEGWGKEILGEGWNVYSAGIET-HGVNPKAIEAMKEVDIDISNHTSDLID
ARSC_STAAN      -MDKKTIYFICTGNSCRSQMAEGWGKEILGEGWNVYSAGIET-HGVNPKAIEAMKEVDIDISNHTSDLID
ARSC_STAAT      -----TIYFICTGNSCRSQMAEGWAKQILADDWNVYSAGIETHG-VNPKAIEAMKEVGIDISNHTSDLID
ARSC_STAAE      -----TIYFICTGNSCRSQMAEGWAKQILADDWNVYSAGIETHG-VNPKAIEAMKEVGIDISNHTSDLID
ARSC_STAAC      -----TIYFICTGNSCRSQMAEGWAKQILADDWNVYSAGIETHG-VNPKAIEAMKEVGIDISNHTSDLID
ARSC_STAA8      -----TIYFICTGNSCRSQMAEGWAKQILADDWNVYSAGIETHG-VNPKAIEAMKEVGIDISNHTSDLID
ARSC_STAA3      -----TIYFICTGNSCRSQMAEGWAKQILADDWNVYSAGIETHG-VNPKAIEAMKEVGIDISNHTSDLID
ARSC_MACCJ      -MEKKTLYFICTGNSCRSQMAEGWGKHILGDTWNVYSAGIETHG-VNPKAIEAMREVGIDISHHTSDLID
ARSC2_STAS1     -MDKKTIYFICTGNSCRSQMAEGWGREILGEEWNVYSAGIET-HGVNPKAIEAMKEVDIDISNHTSDLID
ARSC_STAES      -MDKKTIYFICTGNSCRSQMAEGWGKKILGDEWQVYSGGIE-AHGVNPKAIEAMKEVGIDISNHTSNLID
ARSC2_STAEQ     -MDKKTIYFICTGNSCRSQMAEGWGKKILGDEWQVYSGGIE-AHGVNPKAIEAMKEVGIDISNHTSNLID
ARSC_STAXY      -MDKKTIYFICTGNSCRSQMAEGWGREILGEDWNVYSAGIET-HGVNPKAIEAMKEVDIDISNHTSDLID
ARSC1_STAS1     -MDKKTIYFICTGNSCRSQMAEGWGKEILGEDWNVYSAGIET-HGVNPRAIEAMKEVDIDISNHTSDLID
ARSC1_STAEQ     -MQKKTIYFICTGNSCRSQMAEGFGKLILGDKWNVYSAGIETHG-VNPHAIKAMKEVGIDISHHTSDLIN
ARSC_BREBN      MENKKTIYFLCTGNSCRSQMAEAWGKKYLGNAWNVFSAGIE-AHGVNPNAVRAMKEVGIDISDQTSDVID
ARSC_BACHD      ------IYFLCTGNSCRSQMAEGWGKKYLGDEWDVYSAGIE-AHGVNPNAVKAMKEIGIDISEQTSDTID
ARSC_BACLD      -MSKKTIYFLCTGNSCRSQMAEGWAKKHLGDEWNVYSAGIE-AHGLNPNAVKAMREAGIDISEQTSDIID
ARSC_BACSU      ------IYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIE-AHGLNPNAVKAMKEVGIDISNQTSDIID
ARSC_BACCQ      MENKKTIYFLCTGNSCRSQMAEAWGKQYLGDKWNVYSAGIE-AHGVNPNAIKAMNEVNIDITNQTSDIID
ARSC_BACC7      MENKKTIYFLCTGNSCRSQMAEAWGKKYLGDNWNVYSAGIE-AHGVNPNAIKAMNEVNIDITNQTSDIID
ARSC_BACHK      MENKKTIYFLCTGNSCRSQMAEAWGKQYLGDKWNVYSAGIE-AHGVNPNAIKAMNEVNIDITNQTSDIID
ARSC_BACAN      MENKKTIYFLCTGNSCRSQMAEAWGKQYLGDKWNVYSAGIE-AHGVNPNAIKAMNEVNIDITNQTSDIID
ARSC_BACAC      MENKKTIYFLCTGNSCRSQMAEAWGKQYLGDKWNVYSAGIE-AHGVNPNAIKAMNEVNIDITNQTSDIID
ARSC_BACAA      MENKKTIYFLCTGNSCRSQMAEAWGKQYLGDKWNVYSAGIE-AHGVNPNAIKAMNEVNIDITNQTSDIID
ARSC_BACCZ      MENKKTIYFLCTGNSCRSQMAEAWGKQYLGDKWNVYSAGIEV-HGVNPNAIKAMNEVNIDITNQTSDIID
ARSC2_BACC1     MENKKTIYFLCTGNSCRSQMAEAWGKQYLGDKWNVYSAGIE-AHGVNPNAIKAMNEVNIDITNQTSDIID
ARSC_BACC3      MENKKTIYFLCTGNSCRSQMAEAWGKQYLGDKWNVYSAGIE-AHGVNPNAIKAMNEVNIDITNQTSDMID
ARSC_OCEIH      ------IYFLCTGNSCRSQMAEGWGKKILGEEWDVYSAGIE-AHGLNPNAIKAMREVDIDITNQTSDQID
ARSC_BACCR      MENKKTIYFLCTGNSCRSQMAEAWGKQYLGDKWNVYSAGME-AHGVNPNAIKAMNEVNIDITNQTSDIID
ARSC_BACME      -MSKKTLYFLCTGNSCRSQMAEGWAKKYLNNNEDVRSAGLE-AHGLNPNAVKAMKEAGVDISNQTSDVID
ARSC_BACC2      MENKKTIYFLCTGNSCRSQMAEAWGKQFLEDKWNVYSAGIE-AHGVNPNAIKAMNEVNIDITNQTSDIID
EPSP2_RALSO     -----TILVVCIGNICRSPMAQALLRQALPGVSVISAGGALSGYPADPSAVEVMAQHGIDISEHRAQQLT


                         .         .         *         .         .         .         .:140
query           LDLIRRVDRVIILGAEAQLEMPINANGTLQRWLTDEPSERGIEGMERMRLVRDDIDARVQNLIAxxxxxx
ARSC1_STAHJ     SDILEQSDLVVTLCSDADDNCPIPPNVKKEHWGFDDPA--GKEWPEFQR-VRDEIGKRIQ----------
ARSC_BACSK      IDLLNNADFVVTLCGDAADKCPLTAHVKREHWGFDDPAKAEGTKEERFQRVRDEIGARIK----------
ARSC2_STAHJ     KNILNQSDLVVTLCSDADNNCPIPPNVKKEHWGFDDPAGKPWSEFQR---VRDEIKTAIES---------
ARSC_STAAB      NNIIKNSNLVVTLCSDADVNCPLPANVKKEHWGFDNPAGKPWSEFQR---VRDEIKIAIEN---------
ARSC_GEOTN      PEILNKADLVVTLCGHAADHCPVTPNVKRVHWGFDDPAK--AEGTEEEKLVRDEIGARIK----------
ARSC_STAAU      NDILKQSDLVVTLCSDADNNCPIPPNVKKEHWGFDDPA--GKEWSEFQR-VRDEIKLAIE----------
ARSC_STAAR      NDILKQSDLVVTLCSDADNNCPIPPNVKKEHWGFDDPA--GKEWSEFQR-VRDEIKLAIE----------
ARSC_STAAN      NDILKQSDLVVTLCSDADNNCPIPPNVKKEHWGFDDPA--GKEWSEFQR-VRDEIKLAIE----------
ARSC_STAAT      NNIIKNSNLVVTLCSDADVNCPLPTNVKKEHWGFDDPAGKPWSEFQR---VRDEIKIAIEN---------
ARSC_STAAE      NNIIKNSNLVVTLCSDADVNCPLPTNVKKEHWGFDDPAGKPWSEFQR---VRDEIKIAIEN---------
ARSC_STAAC      NNIIKNSNLVVTLCSDADVNCPLPTNVKKEHWGFDDPAGKPWSEFQR---VRDEIKIAIEN---------
ARSC_STAA8      NNIIKNSNLVVTLCSDADVNCPLPTNVKKEHWGFDDPAGKPWSEFQR---VRDEIKIAIEN---------
ARSC_STAA3      NNIIKNSNLVVTLCSDADVNCPLPTNVKKEHWGFDDPAGKPWSEFQR---VRDEIKIAIEN---------
ARSC_MACCJ      QDILNNSDLVVTLCSDADNNCPIPPNVKKEHWGFDDPAGKAWSEFQR---VRDEIGHAIE----------
ARSC2_STAS1     NKILRQSDLVVTLCSDADENCPIPPNVKKEHWGFDDPAGKSWSEFQR---VRDEIGQKIK----------
ARSC_STAES      QNILHQSDLVVTLCSDADKNCPIPPSVKKEHWGFDDPAGKPWSEFQR---VRDEIKTAIES---------
ARSC2_STAEQ     QNILHQSDLVVTLCSDADKNCPIPPSVKKEHWGFDDPAGKPWSEFQR---VRDEIKTAIES---------
ARSC_STAXY      NHILKQSDLVVTLCSDADDNCPIPPNVKKEHWGLEDPA--GKEWSEFQR-VRDEIKLAIEN---------
ARSC1_STAS1     NDILKQSDLVVTLCSDADDNCPIPPNVKKEHWGFEDPA--GKEWSEFQR-VRDEIKLAIE----------
ARSC1_STAEQ     NDILIASDIVVTLCSDADANCPVPKNVTKEHWGFDDPAGKDWSEFQR---VRDEIKAAIE----------
ARSC_BREBN      SDILNKADLIVTLCSHADSVCPTTPTHVNRHWGFDDPA--GKEWPEFQR-VRDEIGARIK----------
ARSC_BACHD      QELLQKADLVVTLCGHAADVCPATSNKERVHWGFDDPAK--AEGTDEFRRVRDEIGKRIK----------
ARSC_BACLD      PDILHNADLVITLCGDAADKCPMTPHVKREHWGFDDPAK--AEGTEEFQRVRDEIGERIK----------
ARSC_BACSU      SDILNNADLVVTLCGDAADKCPMTPHVKREHWGFDDPAR--AQGTEEFQRVRDEIGNRLK----------
ARSC_BACCQ      ANILNRADLVVTLCSHADAVCPSTPPDVHRHWGFDDPA--GKEWSEFQR-VRDEIGERIK----------
ARSC_BACC7      ANILNRADLVVTLCSHADSVCPSTPPDVNRHWGFDDPA--GKEWSEFQR-VRDEIGERIK----------
ARSC_BACHK      ANILNRADLVVTLCSHADSVCPSTPHVNRVHWGFDDPA--GKEWSEFQR-VRDEIGERIK----------
ARSC_BACAN      ANILNRADLVVTLCSHADAVCPSTPHVNRVHWGFDDPA--GKEWPEFQR-VRDEIGERIK----------
ARSC_BACAC      ANILNRADLVVTLCSHADAVCPSTPHVNRVHWGFDDPA--GKEWPEFQR-VRDEIGERIK----------
ARSC_BACAA      ANILNRADLVVTLCSHADAVCPSTPHVNRVHWGFDDPA--GKEWPEFQR-VRDEIGERIK----------
ARSC_BACCZ      ANILNRADLVVTLCSHADSVCPSTPPDVNRHWGFDDPA--GKEWSEFQR-VRDEIGERIK----------
ARSC2_BACC1     ANILNRADLVVTLCSHADSVCPSTPHINRVHWGFDDPA--GKEWSEFQR-VRDEIGERIK----------
ARSC_BACC3      INILNNADLVVTLCSHADSVCPSTPHVNRVHWGFDDPA--GKEWSEFQR-VRDEIRERIK----------
ARSC_OCEIH      KDILNKADFVVTLCGDAKDKCPMTPHVKRDHWGFEDPAK--AQGTEEFQQVRDKIGDRIK----------
ARSC_BACCR      ANILNSADLVVTLCSHADSVCPSTPHVNRVHWGFDDPA--GKEWSEFQR-VRDEIGERIK----------
ARSC_BACME      PEILNNADLVVTLCGHAADHCPVTPHVKREHWGFDDPAK--AEGTDEFQRVRDEIAERIQ----------
ARSC_BACC2      ATILNSADLVVTLCSHADAVCPSTPHVNRVHWGFDDPA--GKEWSEFQR-VRDEIGEHIK----------
EPSP2_RALSO     GSLVNRADLILVMGGEIQARHPSKTGGEMEQFDIDDPYRKQMMAFEALAMIQRGVDAWVPRIRA------