[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF54635.1

[Show Plain Result]


## Summary of Sequence Search
    1::422
    1::422       0.0 100%  422 aa  RIBBA_CORGL RecName: Full=Riboflavin biosynthesis protein
    1::422       0.0 100%  422 aa  RIBBA_CORGB RecName: Full=Riboflavin biosynthesis protein
   10::420     e-149  65%  423 aa  RIBBA_CORAM RecName: Full=Riboflavin biosynthesis protein
    2::413     e-149  68%  417 aa  RIBBA_MYCA9 RecName: Full=Riboflavin biosynthesis protein
    2::416     e-148  64%  423 aa  RIBBA_MYCVP RecName: Full=Riboflavin biosynthesis protein
    2::405     e-148  66%  423 aa  RIBBA_MYCGI RecName: Full=Riboflavin biosynthesis protein
    2::416     e-147  68%  424 aa  RIBBA_RHOE4 RecName: Full=Riboflavin biosynthesis protein
    2::405     e-147  64%  425 aa  RIBBA_MYCPA RecName: Full=Riboflavin biosynthesis protein
    2::405     e-147  65%  425 aa  RIBBA_MYCMM RecName: Full=Riboflavin biosynthesis protein
    2::405     e-146  65%  425 aa  RIBBA_MYCTU RecName: Full=Riboflavin biosynthesis protein
    2::405     e-146  65%  425 aa  RIBBA_MYCTA RecName: Full=Riboflavin biosynthesis protein
    2::405     e-146  65%  425 aa  RIBBA_MYCBT RecName: Full=Riboflavin biosynthesis protein
    2::405     e-146  65%  425 aa  RIBBA_MYCBP RecName: Full=Riboflavin biosynthesis protein
    2::405     e-146  65%  425 aa  RIBBA_MYCBO RecName: Full=Riboflavin biosynthesis protein
    2::405     e-146  64%  425 aa  RIBBA_MYCA1 RecName: Full=Riboflavin biosynthesis protein
    2::405     e-146  65%  425 aa  RIBBA_MYCUA RecName: Full=Riboflavin biosynthesis protein
    2::399     e-145  68%  414 aa  RIBBA_NOCFA RecName: Full=Riboflavin biosynthesis protein
    6::397     e-143  65%  420 aa  RIBBA_SALAI RecName: Full=Riboflavin biosynthesis protein
    2::405     e-141  67%  417 aa  RIBBA_RHOSR RecName: Full=Riboflavin biosynthesis protein
    6::397     e-139  63%  400 aa  RIBBA_SALTO RecName: Full=Riboflavin biosynthesis protein
    3::395     e-119  53%  397 aa  RIBBA_GEOSW RecName: Full=Riboflavin biosynthesis protein
    3::395     e-119  55%  397 aa  RIBBA_BACSK RecName: Full=Riboflavin biosynthesis protein
    5::393     e-116  53%  397 aa  RIBBA_BACWK RecName: Full=Riboflavin biosynthesis protein
    5::393     e-116  53%  397 aa  RIBBA_BACC2 RecName: Full=Riboflavin biosynthesis protein
  130::523     e-116  58%  543 aa  RIBBA_ARATH RecName: Full=Riboflavin biosynthesis protein ribBA,
    5::393     e-116  53%  397 aa  RIBBA_BACC4 RecName: Full=Riboflavin biosynthesis protein
    5::393     e-116  53%  397 aa  RIBBA_BACCZ RecName: Full=Riboflavin biosynthesis protein
    5::393     e-116  53%  397 aa  RIBBA_BACHK RecName: Full=Riboflavin biosynthesis protein
    5::393     e-116  53%  397 aa  RIBBA_BACC3 RecName: Full=Riboflavin biosynthesis protein
    5::393     e-116  53%  397 aa  RIBBA_BACC1 RecName: Full=Riboflavin biosynthesis protein
    5::393     e-116  53%  397 aa  RIBBA_BACAN RecName: Full=Riboflavin biosynthesis protein
    5::393     e-116  53%  397 aa  RIBBA_BACAH RecName: Full=Riboflavin biosynthesis protein
    5::393     e-116  53%  397 aa  RIBBA_BACAC RecName: Full=Riboflavin biosynthesis protein
    5::393     e-116  53%  397 aa  RIBBA_BACAA RecName: Full=Riboflavin biosynthesis protein
    5::393     e-116  53%  397 aa  RIBBA_BACCR RecName: Full=Riboflavin biosynthesis protein
    5::393     e-116  53%  397 aa  RIBBA_BACCQ RecName: Full=Riboflavin biosynthesis protein
    5::393     e-116  53%  397 aa  RIBBA_BACC7 RecName: Full=Riboflavin biosynthesis protein
    5::393     e-115  53%  397 aa  RIBBA_BACC0 RecName: Full=Riboflavin biosynthesis protein
    5::394     e-112  53%  398 aa  RIBBA_BACSU RecName: Full=Riboflavin biosynthesis protein
    4::393     e-110  52%  398 aa  RIBBA_SYNWW RecName: Full=Riboflavin biosynthesis protein
    1::404     e-110  52%  406 aa  RIBBA_AQUAE RecName: Full=Riboflavin biosynthesis protein
    5::400     e-110  51%  404 aa  RIBBA_BACV8 RecName: Full=Riboflavin biosynthesis protein
    5::394     e-110  52%  398 aa  RIBBA_BACA2 RecName: Full=Riboflavin biosynthesis protein
    4::393     e-110  50%  399 aa  RIBBA_BREBN RecName: Full=Riboflavin biosynthesis protein
    5::394     e-110  52%  398 aa  RIBBA_BACAM RecName: Full=Riboflavin biosynthesis protein
    5::399     e-109  54%  414 aa  RIBBA_CLONN RecName: Full=Riboflavin biosynthesis protein
    3::396     e-108  50%  396 aa  RIBBA_THEPX RecName: Full=Riboflavin biosynthesis protein
    3::396     e-108  50%  396 aa  RIBBA_THEP3 RecName: Full=Riboflavin biosynthesis protein
    5::393     e-107  50%  397 aa  RIBBA_BACCN RecName: Full=Riboflavin biosynthesis protein
    5::400     e-106  49%  404 aa  RIBBA_BACTN RecName: Full=Riboflavin biosynthesis protein
    5::401     e-104  49%  405 aa  RIBBA_CYTH3 RecName: Full=Riboflavin biosynthesis protein
    2::401     e-103  52%  421 aa  RIBBA_PROA2 RecName: Full=Riboflavin biosynthesis protein
    5::397     e-103  49%  401 aa  RIBBA_ACTPL RecName: Full=Riboflavin biosynthesis protein
    5::397     e-103  49%  401 aa  RIBBA_ACTP2 RecName: Full=Riboflavin biosynthesis protein
    4::411     e-103  48%  418 aa  RIBBA_CHLPN RecName: Full=Riboflavin biosynthesis protein
    5::400     e-103  49%  404 aa  RIBBA_BACFR RecName: Full=Riboflavin biosynthesis protein
    5::400     e-103  49%  404 aa  RIBBA_BACFN RecName: Full=Riboflavin biosynthesis protein
   32::398     e-103  52%  556 aa  RIBBA_SYNY3 RecName: Full=Riboflavin biosynthesis protein
    5::397     e-103  49%  401 aa  RIBBA_ACTP7 RecName: Full=Riboflavin biosynthesis protein
    5::399     e-102  49%  409 aa  RIBBA_PELLD RecName: Full=Riboflavin biosynthesis protein
    5::397     e-102  49%  401 aa  RIBBA_ACTPJ RecName: Full=Riboflavin biosynthesis protein
   10::415     e-101  48%  424 aa  RIBBA_CHLTR RecName: Full=Riboflavin biosynthesis protein
    3::399     e-100  48%  410 aa  RIBBA_PROVI RecName: Full=Riboflavin biosynthesis protein
    5::404     e-100  47%  405 aa  RIBBA_PARD8 RecName: Full=Riboflavin biosynthesis protein
    7::399     e-100  51%  419 aa  RIBBA_PELPB RecName: Full=Riboflavin biosynthesis protein
    8::403     3e-99  46%  403 aa  RIBBA_UNCTG RecName: Full=Riboflavin biosynthesis protein
   10::412     2e-98  48%  424 aa  RIBBA_CHLMU RecName: Full=Riboflavin biosynthesis protein
    5::404     8e-98  45%  405 aa  RIBBA_PORGI RecName: Full=Riboflavin biosynthesis protein
    5::404     8e-98  45%  405 aa  RIBBA_PORG3 RecName: Full=Riboflavin biosynthesis protein
    2::391     4e-89  44%  393 aa  RIBBA_STAAW RecName: Full=Riboflavin biosynthesis protein
    2::391     4e-89  44%  393 aa  RIBBA_STAAS RecName: Full=Riboflavin biosynthesis protein
    2::391     5e-89  44%  393 aa  RIBBA_STAAR RecName: Full=Riboflavin biosynthesis protein
    2::391     5e-89  44%  393 aa  RIBBA_STAAC RecName: Full=Riboflavin biosynthesis protein
    2::391     2e-88  45%  393 aa  RIBBA_STAEQ RecName: Full=Riboflavin biosynthesis protein
    2::391     2e-88  44%  393 aa  RIBBA_STAAN RecName: Full=Riboflavin biosynthesis protein
    2::391     2e-88  44%  393 aa  RIBBA_STAAM RecName: Full=Riboflavin biosynthesis protein
    2::391     4e-88  44%  393 aa  RIBBA_STAES RecName: Full=Riboflavin biosynthesis protein
    2::391     5e-88  44%  393 aa  RIBBA_STAHJ RecName: Full=Riboflavin biosynthesis protein
    2::391     1e-87  44%  393 aa  RIBBA_STAS1 RecName: Full=Riboflavin biosynthesis protein
   24::372     8e-74  48%  378 aa  RIBA_ARCFU RecName: Full=GTP cyclohydrolase-2;       
   18::210     3e-62  60%  221 aa  RIBA_STRCO RecName: Full=GTP cyclohydrolase-2;       
   28::382     1e-61  40%  388 aa  RIBBA_THEMA RecName: Full=Riboflavin biosynthesis protein
    2::355     1e-58  40%  363 aa  RIBB_NEIMB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    2::355     8e-58  39%  363 aa  RIBB_NEIMA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    4::368     5e-55  38%  369 aa  RIBB_PSESM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    9::191     8e-53  56%  198 aa  RIBA_BURMA RecName: Full=GTP cyclohydrolase-2;       
    3::358     2e-52  37%  364 aa  RIBB_PHOLE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    4::193     1e-50  52%  217 aa  RIBA_ACTSZ RecName: Full=GTP cyclohydrolase-2;       
    3::363     8e-50  36%  365 aa  RIBB_PSEAE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    5::333     1e-49  41%  339 aa  RIBB_CAMJE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::193     3e-49  52%  197 aa  RIBA_NEIMF RecName: Full=GTP cyclohydrolase-2;       
   13::193     3e-49  52%  197 aa  RIBA_NEIMB RecName: Full=GTP cyclohydrolase-2;       
   13::193     3e-49  52%  197 aa  RIBA_NEIM0 RecName: Full=GTP cyclohydrolase-2;       
    4::193     7e-49  49%  197 aa  RIBA_NEIG1 RecName: Full=GTP cyclohydrolase-2;       
   17::351     9e-49  36%  356 aa  RIBB_DEHMU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::193     2e-48  51%  197 aa  RIBA_NEIMA RecName: Full=GTP cyclohydrolase-2;       
    4::195     5e-48  49%  219 aa  RIBA_MANSM RecName: Full=GTP cyclohydrolase-2;       
    4::193     1e-47  51%  216 aa  RIBA_HAES2 RecName: Full=GTP cyclohydrolase-2;       
    4::193     1e-47  51%  216 aa  RIBA_HAES1 RecName: Full=GTP cyclohydrolase-2;       
   12::194     2e-47  51%  216 aa  RIBA_HAEIE RecName: Full=GTP cyclohydrolase-2;       
    3::357     2e-47  35%  363 aa  RIBB_PHOPO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   12::194     7e-47  51%  216 aa  RIBA_HAEIN RecName: Full=GTP cyclohydrolase-2;       
   12::194     7e-47  51%  216 aa  RIBA_HAEIG RecName: Full=GTP cyclohydrolase-2;       
   12::194     7e-47  51%  216 aa  RIBA_HAEI8 RecName: Full=GTP cyclohydrolase-2;       
   12::193     9e-47  52%  197 aa  RIBA_AERHH RecName: Full=GTP cyclohydrolase-2;       
   11::205     1e-46  50%  208 aa  RIBA_AZOVD RecName: Full=GTP cyclohydrolase-2;       
    3::194     7e-46  49%  199 aa  RIBA_PROMH RecName: Full=GTP cyclohydrolase-2;       
   11::194     4e-45  51%  205 aa  RIBA_PSEPW RecName: Full=GTP cyclohydrolase-2;       
   11::192     4e-45  49%  207 aa  RIBA_HAHCH RecName: Full=GTP cyclohydrolase-2;       
    4::194     6e-45  48%  219 aa  RIBA_PASMU RecName: Full=GTP cyclohydrolase-2;       
    3::192     8e-45  50%  196 aa  RIBA_SHIDS RecName: Full=GTP cyclohydrolase-2;       
    3::192     8e-45  51%  197 aa  RIBA_ENTS8 RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_SHISS RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_SHIFL RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_SHIF8 RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_SHIBS RecName: Full=GTP cyclohydrolase-2;       
   11::192     2e-44  51%  205 aa  RIBA_PSEE4 RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_ECOSM RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_ECOSE RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_ECOLU RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_ECOLI RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_ECOLC RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_ECOHS RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_ECODH RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_ECOBW RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_ECO8A RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_ECO7I RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_ECO5E RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_ECO57 RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_ECO55 RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_ECO27 RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-44  49%  196 aa  RIBA_ECO24 RecName: Full=GTP cyclohydrolase-2;       
    3::192     3e-44  49%  196 aa  RIBA_ECOL6 RecName: Full=GTP cyclohydrolase-2;       
    3::192     3e-44  49%  196 aa  RIBA_ECOL5 RecName: Full=GTP cyclohydrolase-2;       
    3::192     3e-44  49%  196 aa  RIBA_ECO81 RecName: Full=GTP cyclohydrolase-2;       
    3::192     3e-44  49%  196 aa  RIBA_ECO45 RecName: Full=GTP cyclohydrolase-2;       
   11::193     3e-44  50%  200 aa  RIBA_ACIBS RecName: Full=GTP cyclohydrolase-2;       
   11::192     4e-44  51%  205 aa  RIBA_PSESM RecName: Full=GTP cyclohydrolase-2;       
    2::196     5e-44  50%  204 aa  RIB3_SCHPO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    3::192     9e-44  49%  196 aa  RIBA_SHIB3 RecName: Full=GTP cyclohydrolase-2;       
   11::194     9e-44  50%  205 aa  RIBA_PSEPK RecName: Full=GTP cyclohydrolase-2;       
   11::194     9e-44  50%  205 aa  RIBA_PSEPG RecName: Full=GTP cyclohydrolase-2;       
   11::194     9e-44  50%  205 aa  RIBA_PSEP1 RecName: Full=GTP cyclohydrolase-2;       
    3::196     9e-44  49%  199 aa  RIBA_BAUCH RecName: Full=GTP cyclohydrolase-2;       
   11::193     9e-44  50%  200 aa  RIBA_ACIBY RecName: Full=GTP cyclohydrolase-2;       
   11::193     9e-44  50%  200 aa  RIBA_ACIBT RecName: Full=GTP cyclohydrolase-2;       
   11::193     9e-44  50%  200 aa  RIBA_ACIBC RecName: Full=GTP cyclohydrolase-2;       
   11::193     9e-44  50%  200 aa  RIBA_ACIB3 RecName: Full=GTP cyclohydrolase-2;       
    3::337     1e-43  36%  347 aa  RIBB_WOLSU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    2::206     1e-43  44%  207 aa  RIBB_OCEIH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    3::192     1e-43  48%  196 aa  RIBA_YERPS RecName: Full=GTP cyclohydrolase-2;       
    3::192     1e-43  48%  196 aa  RIBA_YERPE RecName: Full=GTP cyclohydrolase-2;       
   11::192     1e-43  50%  205 aa  RIBA_PSEFS RecName: Full=GTP cyclohydrolase-2;       
    3::192     1e-43  49%  198 aa  RIBA_ESCF3 RecName: Full=GTP cyclohydrolase-2;       
   11::193     1e-43  50%  200 aa  RIBA_ACIB5 RecName: Full=GTP cyclohydrolase-2;       
   11::203     2e-43  48%  205 aa  RIBA_PSEA7 RecName: Full=GTP cyclohydrolase-2;       
    3::192     2e-43  49%  196 aa  RIBA_CITK8 RecName: Full=GTP cyclohydrolase-2;       
   11::203     2e-43  46%  203 aa  RIBA_SHEON RecName: Full=GTP cyclohydrolase-2;       
   11::192     2e-43  48%  205 aa  RIBA_SHEAM RecName: Full=GTP cyclohydrolase-2;       
   11::203     2e-43  49%  205 aa  RIBA_PSEAE RecName: Full=GTP cyclohydrolase-2;       
   11::203     2e-43  49%  205 aa  RIBA_PSEA8 RecName: Full=GTP cyclohydrolase-2;       
   11::203     3e-43  49%  205 aa  RIBA_PSEAB RecName: Full=GTP cyclohydrolase-2;       
    3::192     3e-43  49%  200 aa  RIBA_KLEP7 RecName: Full=GTP cyclohydrolase-2;       
    3::192     3e-43  49%  200 aa  RIBA_KLEP3 RecName: Full=GTP cyclohydrolase-2;       
   12::197     3e-43  48%  197 aa  RIBA_TOLAT RecName: Full=GTP cyclohydrolase-2;       
    3::192     3e-43  49%  196 aa  RIBA_SALTY RecName: Full=GTP cyclohydrolase-2;       
    3::192     3e-43  49%  196 aa  RIBA_SALTI RecName: Full=GTP cyclohydrolase-2;       
    3::192     3e-43  49%  196 aa  RIBA_SALPA RecName: Full=GTP cyclohydrolase-2;       
    3::192     3e-43  49%  196 aa  RIBA_SALCH RecName: Full=GTP cyclohydrolase-2;       
   16::215     4e-43  45%  218 aa  RIBB_ERWT9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    3::193     6e-43  47%  200 aa  RIBA_ACIAD RecName: Full=GTP cyclohydrolase-2;       
    3::194     8e-43  50%  197 aa  RIBA_ERWCT RecName: Full=GTP cyclohydrolase-2;       
    3::196     1e-42  48%  196 aa  RIBA_ENT38 RecName: Full=GTP cyclohydrolase-2;       
   11::192     1e-42  47%  203 aa  RIBA_SHESW RecName: Full=GTP cyclohydrolase-2;       
   11::192     1e-42  47%  203 aa  RIBA_SHEPC RecName: Full=GTP cyclohydrolase-2;       
    6::194     1e-42  47%  194 aa  RIBA_BUCAI RecName: Full=GTP cyclohydrolase-2;       
   11::203     2e-42  45%  203 aa  RIBA_SHESR RecName: Full=GTP cyclohydrolase-2;       
   11::203     2e-42  45%  203 aa  RIBA_SHESM RecName: Full=GTP cyclohydrolase-2;       
   11::192     2e-42  47%  204 aa  RIBA_SHEB5 RecName: Full=GTP cyclohydrolase-2;       
   11::202     3e-42  44%  205 aa  RIBA_SHELP RecName: Full=GTP cyclohydrolase-2;       
   14::213     4e-42  43%  217 aa  RIBB_KLEP7 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::203     4e-42  45%  203 aa  RIBA_SHESA RecName: Full=GTP cyclohydrolase-2;       
   14::213     5e-42  43%  217 aa  RIBB_KLEP3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::192     5e-42  47%  204 aa  RIBA_SHEB9 RecName: Full=GTP cyclohydrolase-2;       
   11::192     5e-42  47%  204 aa  RIBA_SHEB8 RecName: Full=GTP cyclohydrolase-2;       
   11::192     5e-42  47%  204 aa  RIBA_SHEB2 RecName: Full=GTP cyclohydrolase-2;       
   17::215     6e-42  42%  218 aa  RIBB_VIBPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    8::204     6e-42  47%  204 aa  RIB3_CANAL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::213     8e-42  42%  217 aa  RIBB_PROMH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::192     8e-42  46%  205 aa  RIBA_SHESH RecName: Full=GTP cyclohydrolase-2;       
   44::215     1e-41  49%  215 aa  RIBB_HAEIN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    3::192     1e-41  46%  199 aa  RIBA_TERTT RecName: Full=GTP cyclohydrolase-2;       
   11::192     1e-41  47%  202 aa  RIBA_SHEFN RecName: Full=GTP cyclohydrolase-2;       
   14::213     2e-41  42%  217 aa  RIBB_ECOSM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     2e-41  42%  217 aa  RIBB_ECOLU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::213     2e-41  42%  219 aa  RIBB_EDWI9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    3::192     2e-41  45%  196 aa  RIBA_HAMD5 RecName: Full=GTP cyclohydrolase-2;       
   17::215     3e-41  41%  218 aa  RIBB_VIBVY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::215     3e-41  41%  218 aa  RIBB_VIBVU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::209     3e-41  45%  214 aa  RIBB_RHORT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    8::211     3e-41  44%  234 aa  RIBB_PELPD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   32::208     3e-41  50%  208 aa  RIB3_YEAST RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::215     4e-41  42%  218 aa  RIBB_VIBSL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_SHISS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_SHIFL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_SHIF8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_SHIDS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_SHIBS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_SHIB3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_ECOSE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_ECOLI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_ECOLC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_ECOL5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_ECOHS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_ECODH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_ECOBW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_ECO8A RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_ECO7I RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_ECO5E RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_ECO57 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_ECO55 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     5e-41  42%  217 aa  RIBB_ECO24 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    1::195     5e-41  44%  195 aa  RIBA_THEVO RecName: Full=GTP cyclohydrolase-2;       
    3::192     5e-41  46%  199 aa  RIBA_BLOFL RecName: Full=GTP cyclohydrolase-2;       
   14::213     7e-41  42%  217 aa  RIBB_ESCF3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     7e-41  42%  217 aa  RIBB_ECOUT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     7e-41  42%  217 aa  RIBB_ECOL6 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     7e-41  42%  217 aa  RIBB_ECOK1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     7e-41  42%  217 aa  RIBB_ECO81 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     7e-41  42%  217 aa  RIBB_ECO45 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     7e-41  42%  217 aa  RIBB_ECO27 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::192     7e-41  47%  200 aa  RIBA_SACD2 RecName: Full=GTP cyclohydrolase-2;       
   44::215     9e-41  48%  215 aa  RIBB_HAEIG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   44::215     9e-41  48%  215 aa  RIBB_HAEI8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    6::331     1e-40  34%  355 aa  RIBB_HELHP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::192     1e-40  44%  209 aa  RIBA_SHEHH RecName: Full=GTP cyclohydrolase-2;       
   13::213     2e-40  42%  217 aa  RIBB_YERE8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    9::192     2e-40  45%  205 aa  RIBA_SHEWM RecName: Full=GTP cyclohydrolase-2;       
   11::192     2e-40  45%  205 aa  RIBA_SHEPW RecName: Full=GTP cyclohydrolase-2;       
   12::214     2e-40  44%  214 aa  RIBB_PASMU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   44::215     2e-40  47%  215 aa  RIBB_HAEIE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::192     2e-40  45%  209 aa  RIBA_SHEPA RecName: Full=GTP cyclohydrolase-2;       
   11::192     3e-40  46%  205 aa  RIBA_SHEDO RecName: Full=GTP cyclohydrolase-2;       
   16::212     4e-40  43%  217 aa  RIBB_TOLAT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::213     5e-40  42%  217 aa  RIBB_SERP5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     6e-40  41%  217 aa  RIBB_SALPK RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     6e-40  41%  217 aa  RIBB_SALPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    2::199     6e-40  47%  202 aa  RIBA_MARMS RecName: Full=GTP cyclohydrolase-2;       
   13::210     8e-40  40%  217 aa  RIBB_SHEWM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::210     8e-40  41%  217 aa  RIBB_SHELP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::215     8e-40  40%  218 aa  RIBB_SHEFN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     8e-40  41%  217 aa  RIBB_CITK8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    6::212     1e-39  42%  213 aa  RIBB_AGRT5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    1::190     1e-39  46%  192 aa  RIBA_PICTO RecName: Full=GTP cyclohydrolase-2;       
   13::209     1e-39  41%  212 aa  RIBB_SHEHH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     1e-39  41%  217 aa  RIBB_SALTY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     1e-39  41%  217 aa  RIBB_SALTI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     1e-39  41%  217 aa  RIBB_SALSV RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     1e-39  41%  217 aa  RIBB_SALPC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     1e-39  41%  217 aa  RIBB_SALPB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     1e-39  41%  217 aa  RIBB_SALNS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     1e-39  41%  217 aa  RIBB_SALHS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     1e-39  41%  217 aa  RIBB_SALG2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     1e-39  41%  217 aa  RIBB_SALEP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     1e-39  41%  217 aa  RIBB_SALDC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     1e-39  41%  217 aa  RIBB_SALCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     1e-39  41%  217 aa  RIBB_SALA4 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    8::196     1e-39  45%  199 aa  RIBA_BUCBP RecName: Full=GTP cyclohydrolase-2;       
   43::211     2e-39  48%  214 aa  RIBB_MANSM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::213     2e-39  41%  217 aa  RIBB_ENT38 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
  171::383     2e-39  42%  385 aa  RIBA_AZOBR RecName: Full=GTP cyclohydrolase-2;       
   16::210     2e-39  44%  217 aa  RIBB_SODGM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::205     3e-39  44%  217 aa  RIBB_PELCD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    5::203     3e-39  42%  219 aa  RIBB_METLZ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    8::211     3e-39  42%  211 aa  RIBB_BAUCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::191     3e-39  45%  202 aa  RIBA_COLP3 RecName: Full=GTP cyclohydrolase-2;       
    3::192     5e-39  43%  197 aa  RIBA_WIGBR RecName: Full=GTP cyclohydrolase-2;       
   14::213     7e-39  42%  217 aa  RIBB_SALAR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    1::210     7e-39  41%  214 aa  RIBB_DESVH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::210     9e-39  40%  217 aa  RIBB_SHESH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::208     9e-39  41%  217 aa  RIBB_PSEHT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    1::210     9e-39  41%  214 aa  RIBB_DESVV RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::210     1e-38  40%  217 aa  RIBB_SHESA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::214     1e-38  39%  217 aa  RIBB_VIBFI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::209     1e-38  42%  217 aa  RIBB_PECCP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   43::212     1e-38  47%  213 aa  RIBB_BLOFL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     2e-38  41%  212 aa  RIBB_SHEPW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::209     2e-38  42%  217 aa  RIBB_ERWCT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    3::192     3e-38  44%  199 aa  RIBA_BLOPB RecName: Full=GTP cyclohydrolase-2;       
   13::210     4e-38  40%  217 aa  RIBB_SHESR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::210     4e-38  40%  217 aa  RIBB_SHESM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::189     4e-38  46%  193 aa  RIBA_CAMHC RecName: Full=GTP cyclohydrolase-2;       
   13::205     6e-38  42%  217 aa  RIBB_YERPY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::205     6e-38  42%  217 aa  RIBB_YERPS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::205     6e-38  42%  217 aa  RIBB_YERPP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::205     6e-38  42%  217 aa  RIBB_YERPN RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::205     6e-38  42%  217 aa  RIBB_YERPG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::205     6e-38  42%  217 aa  RIBB_YERPE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::205     6e-38  42%  217 aa  RIBB_YERPB RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::205     6e-38  42%  217 aa  RIBB_YERPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::205     6e-38  42%  217 aa  RIBB_YERP3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::210     7e-38  40%  217 aa  RIBB_SHEB9 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::210     7e-38  40%  217 aa  RIBB_SHEB2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   33::208     7e-38  42%  344 aa  RIBB_HELPJ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::210     1e-37  39%  217 aa  RIBB_SHESW RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::210     1e-37  39%  217 aa  RIBB_SHEPC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::210     1e-37  40%  217 aa  RIBB_SHEB8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::210     1e-37  40%  217 aa  RIBB_SHEB5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::210     1e-37  42%  218 aa  RIBB_HAMD5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    3::208     1e-37  38%  344 aa  RIBB_HELPY RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     2e-37  41%  217 aa  RIBB_ENTS8 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     2e-37  40%  212 aa  RIBB_SHEPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    8::209     3e-37  39%  217 aa  RIBB_DESAD RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::213     4e-37  40%  228 aa  RIBB_CHLT3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    8::192     4e-37  42%  196 aa  RIBA_BUCAP RecName: Full=GTP cyclohydrolase-2;       
  165::324     4e-37  53%  332 aa  RIB1_PICGU RecName: Full=GTP cyclohydrolase-2;       
   43::210     5e-37  45%  217 aa  RIBB_SHEON RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   51::219     5e-37  46%  227 aa  RIBB_RALSO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::208     6e-37  42%  214 aa  RIBB_HAES2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::208     6e-37  42%  212 aa  RIBB_HAES1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   10::224     6e-37  45%  233 aa  RIB3_MAGGR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   25::194     1e-36  44%  200 aa  RIBA_PSYIN RecName: Full=GTP cyclohydrolase-2;       
    4::214     1e-36  46%  216 aa  RIBB_PSEPK RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     1e-36  40%  219 aa  RIBB_DESDG RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::214     2e-36  37%  214 aa  RIBB_DESPS RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::206     2e-36  38%  215 aa  RIBB_BUCAT RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::206     2e-36  38%  215 aa  RIBB_BUCAI RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::206     2e-36  38%  215 aa  RIBB_BUCA5 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::209     2e-36  42%  217 aa  RIBB_DESAH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   11::192     2e-36  46%  195 aa  RIBA_CAMFF RecName: Full=GTP cyclohydrolase-2;       
   14::213     3e-36  42%  217 aa  RIBB_PHOLL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
  185::379     3e-36  42%  398 aa  RIBA_XYLFA RecName: Full=GTP cyclohydrolase-2;       
   16::208     4e-36  41%  213 aa  RIBB_WIGBR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    8::209     4e-36  38%  213 aa  RIBB_CLOBL RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
  164::325     4e-36  54%  326 aa  RIB1_SCHPO RecName: Full=Probable GTP cyclohydrolase-2;       
  185::379     5e-36  42%  398 aa  RIBA_XYLFT RecName: Full=GTP cyclohydrolase-2;       
    8::210     7e-36  38%  213 aa  RIBB_CLOBH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    8::210     7e-36  38%  213 aa  RIBB_CLOB1 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    7::210     9e-36  40%  222 aa  RIBB_CHLL2 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    7::214     2e-35  39%  215 aa  RIBB_DESAA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   53::219     3e-35  46%  223 aa  RIBB_RALEJ RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::210     5e-35  39%  218 aa  RIBB_VIBCM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::210     5e-35  39%  218 aa  RIBB_VIBCH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   21::210     1e-34  41%  230 aa  RIBB_BORPE RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   21::210     1e-34  41%  230 aa  RIBB_BORPA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   21::210     1e-34  41%  230 aa  RIBB_BORBR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     2e-34  40%  228 aa  RIBB_PHOPR RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   13::206     2e-34  37%  213 aa  RIBB_BUCAP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   14::213     3e-34  38%  217 aa  RIBB_DESRM RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   43::215     3e-34  45%  217 aa  RIBB_AERHH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   23::196     8e-34  45%  198 aa  RIBA_VIBVU RecName: Full=GTP cyclohydrolase-2;       
   17::210     1e-33  38%  218 aa  RIBB_VIBC3 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   17::210     1e-33  38%  230 aa  RIBB_VIBHA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   43::215     2e-33  45%  217 aa  RIBB_AERS4 RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   47::196     2e-33  47%  198 aa  RIBA_VIBCH RecName: Full=GTP cyclohydrolase-2;       
   23::196     3e-33  43%  198 aa  RIBA_VIBPA RecName: Full=GTP cyclohydrolase-2;       
   12::190     4e-33  43%  192 aa  RIBA_HELAH RecName: Full=GTP cyclohydrolase-2;       
   16::211     6e-33  38%  223 aa  RIBB_DESDA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   16::208     7e-33  36%  211 aa  RIBB_BUCBP RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   12::190     1e-32  42%  192 aa  RIBA_HELPS RecName: Full=GTP cyclohydrolase-2;       
   23::194     6e-32  43%  200 aa  RIBA_PHOPO RecName: Full=GTP cyclohydrolase-2;       
   12::190     6e-32  41%  192 aa  RIBA_HELPY RecName: Full=GTP cyclohydrolase-2;       
   12::190     6e-32  41%  192 aa  RIBA_HELP2 RecName: Full=GTP cyclohydrolase-2;       
   33::195     8e-32  46%  199 aa  RIBA_ALISL RecName: Full=GTP cyclohydrolase-2;       
   12::190     1e-31  41%  192 aa  RIBA_HELPH RecName: Full=GTP cyclohydrolase-2;       
   50::195     1e-31  47%  199 aa  RIBA_VIBF1 RecName: Full=GTP cyclohydrolase-2;       
   50::195     2e-31  47%  199 aa  RIBA_VIBFM RecName: Full=GTP cyclohydrolase-2;       
   12::190     2e-31  41%  192 aa  RIBA_HELPJ RecName: Full=GTP cyclohydrolase-2;       
  135::311     1e-30  51%  345 aa  RIB1_YEAST RecName: Full=GTP cyclohydrolase-2;       
   11::192     2e-30  40%  194 aa  RIBA_HELHP RecName: Full=GTP cyclohydrolase-2;       
   11::207     6e-30  37%  210 aa  RIBB_CHRVO RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    1::139     1e-27  45%  141 aa  RIBA_DEHMU RecName: Full=GTP cyclohydrolase-2;       
    7::222     3e-20  36%  229 aa  RIBB_METTH RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
    1::219     2e-18  33%  227 aa  RIBB_METJA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   15::237     1e-13  28%  247 aa  RIBB_METMA RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   15::237     2e-13  28%  247 aa  RIBB_METAC RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
  256::339     9e-12  44%  444 aa  URC1_SACKL RecName: Full=Putative GTP cyclohydrolase URC1;AltName:
  247::400     3e-11  34%  439 aa  URG1_SCHPO RecName: Full=Uracil-regulated protein 1;       
   44::228     6e-11  36%  238 aa  RIBB_ARCFU RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate
   18::173     7e-04  31%  251 aa  TPIS_PSEMY RecName: Full=Triosephosphate isomerase;       
    1::422

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSEHEQAHSQLDSVEEAIADIAAGKAXXXXXXXXXXXXXXIIFAAELATPELVAFMVRYSSGYICAPLTA
RIBBA_CORGL     MSEHEQAHSQLDSVEEAIADIAAGKAXXXXXXXXXXXXXXIIFAAELATPELVAFMVRYSSGYICAPLTA
RIBBA_CORGB     MSEHEQAHSQLDSVEEAIADIAAGKAXXXXXXXXXXXXXXIIFAAELATPELVAFMVRYSSGYICAPLTA
RIBBA_CORAM     ---------RLDSIEEXXXXXXXXXXXXXXDNEDRENEGDLIFAAELATPELVAFMVRYSSGYICVPLLP
RIBBA_MYCA9     --------TRLDSIERAVADIAAGKAXXXXXXXXXXXXXXLIFAAEKATPELVAFMVRYTSGYLCVPLAG
RIBBA_MYCVP     --------TRLDSVERAVADIAAGKAVVVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLAG
RIBBA_MYCGI     --------TRLDSVERAVADIAAGKAVVVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLAG
RIBBA_RHOE4     --------TRFDSIERAVADIAAGKAXXXXXXXXXXXXXXLIFAAEKATPELVAFMVRYTSGYLCVPLDG
RIBBA_MYCPA     --------TRLDSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDG
RIBBA_MYCMM     --------TRLDSVERAVADIGAGKAVIVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLDG
RIBBA_MYCTU     --------TRLDSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDG
RIBBA_MYCTA     --------TRLDSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDG
RIBBA_MYCBT     --------TRLDSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDG
RIBBA_MYCBP     --------TRLDSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDG
RIBBA_MYCBO     --------TRLDSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDG
RIBBA_MYCA1     --------TRLDSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVPLDG
RIBBA_MYCUA     --------TRLDSVERAVADIGAGKAVIVIDDEDRENEGDLIFAAEKATPELVAFMVRYTSGYLCVPLDG
RIBBA_NOCFA     --------TRFDTIERAVADIAAGKAXXXXXXXXXXXXXXLIFAAEKATPELVAFMIRYTSGYICVPLTG
RIBBA_SALAI     ------------TIEQAMAEIVAGRPVVVVDDANRENEGDLIFAAELATPELVAFMVRYTSGYICAPLTE
RIBBA_RHOSR     --------TRFDSIERAVADIAAGKAXXXXXXXXXXXXXXLIFAAEKATPELVAFMVRYTSGYLCVPLDG
RIBBA_SALTO     ------------TIEQAMAEILAGRPVVVVDDANRENEGDLIFAAELATPELVAFMVRYTSGYICASLTE
RIBBA_GEOSW     -----------DMIEEAIYELMQGKVIIVCDDEDRENEGDFVALAEKATPEVINFMIKYGRGLVCVPITE
RIBBA_BACSK     -----------ESIDEAITQLKAGGMILVVDDEDRENEGDFLALAETASPETINFMATHGRGLICVPLTE
RIBBA_BACWK     -------------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITE
RIBBA_BACC2     -------------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITE
RIBBA_ARATH     ------------SIPEAIEDIRQGKLXXXXXXXXXXXXXXLVMAAQLATPEAMAFIVRHGTGIVCVSMKE
RIBBA_BACC4     -------------IEEALEDLKKGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITE
RIBBA_BACCZ     -------------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITE
RIBBA_BACHK     -------------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITE
RIBBA_BACC3     -------------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITE
RIBBA_BACC1     -------------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITE
RIBBA_BACAN     -------------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITE
RIBBA_BACAH     -------------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITE
RIBBA_BACAC     -------------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITE
RIBBA_BACAA     -------------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITE
RIBBA_BACCR     -------------IEEALEDLKKGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITE
RIBBA_BACCQ     -------------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITE
RIBBA_BACC7     -------------IEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPITE
RIBBA_BACC0     -------------IEEALEDLKQGKVVIVCDDENRENEGDFMALAEYITPETINFMITHGRGLVCVPITE
RIBBA_BACSU     -------------IEEALDALKKGEVIIVVDDEDRENEGDFVALAEHATPEVINFMATHGRGLICTPLSE
RIBBA_SYNWW     ------------SIEEVIQDIKEGKMIVLVDDEDRENEGDVIIAAEKAGPEAINFMATHAKGLICMPIIG
RIBBA_AQUAE     MSEREEF--KFNTVEEAIEDIRQGKMVIVVDDPDRENEGDLVMAAEKVTPEAINFMAKYGRGLICLSLTP
RIBBA_BACV8     ---------KLNTIEEAIADFREGKFVIVVDDEDRENEGDLIVAAEKITPEQVNFMLKHARGVLCAPITI
RIBBA_BACA2     -------------IEEALEALKKGEVIIVVDDEDRENEGDFVALAEHATPEVVNFMATHGRGLICTPLSE
RIBBA_BREBN     ------------SIEEALEDLRQGKAVIVVDDEDRENEGDFVCMAEAATPEMINFMVTHGRGLVCVPVTE
RIBBA_BACAM     -------------IEEALEALKKGEVIIVVDDEDRENEGDFVALAEHATPEVVNFMATHGRGLICTPLSE
RIBBA_CLONN     ---------KFNTIEEAIEDIKNGKMXXXXXXXXXXXXXXLLMAAEKVTPEAINFMAKYARGLICMPMTE
RIBBA_THEPX     -----------DRIEDAIEDIKQGKMIIVVDDENRENEGDLVMAAEKVTGEHINFMIKYGRGLVCVPMTE
RIBBA_THEP3     -----------DRIEDAIEDIKQGKMIIVVDDENRENEGDLVMAAEKVTGEHINFMIKYGRGLVCVPMTE
RIBBA_BACCN     -------------IEEALEDLKQGKVIIVCDDKNRENEGDFLALAEYITPETINFMITHGRGLVCVPLPE
RIBBA_BACTN     ---------KMDRIEDAIADFKEGKFVIVVDDEDRENEGDLIIAAEKITPEKVNFMLKHARGVLCAPITV
RIBBA_CYTH3     ---------KLDSIADAIEAIRKGEVIIVVDDEDRENEGDFICAAECVTPEIINFMSKEGRGLICAPISE
RIBBA_PROA2     ------SEKKIDSIESAIEDLKNGKLIIVIXXXXXXXXXXFIAAADKVTPEMVNFITKEARGLLCVAVTM
RIBBA_ACTPL     ---------QFSKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPIST
RIBBA_ACTP2     ---------QFSKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPIST
RIBBA_CHLPN     -TREEVGSANFVSLERAIEDLRAGKFVIVVDEASREDEGDLIIAGEKITVEKMTFLLQHTTGVVCAALSQ
RIBBA_BACFR     ---------RLNTIEEAIADFKEGNFVIVVDDEDRENEGDFIIAAEKITPEKVNFMLTHGRGVLCAPITE
RIBBA_BACFN     ---------RLNTIEEAIADFKEGNFVIVVDDEDRENEGDFIIAAEKITPEKVNFMLTHGRGVLCAPITE
RIBBA_SYNY3     ----------------------------------------LICAAQFATPALVNFMAVEARGLICLAMTG
RIBBA_ACTP7     ---------QFSKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPIST
RIBBA_PELLD     ---------KFDTIESAVEDIRQGKLVIVIDDEDRENEGDFIAAADHVTTEMINFITREARGLLCVAVTM
RIBBA_ACTPJ     ---------QFSKVEDAIEAIRQGKIILVTDDEDRENEGDFICAAEFATPENINFMATYGKGLICTPIST
RIBBA_CHLTR     ------------SVQQAIKDVAEGKFVIVIDAASRENEGDLILAGEKVSTEKMSFLLSHTTGIVCASLSR
RIBBA_PROVI     -------NKRIDTIESALEDIGQGKLVIVIDDEERENEGDFIAAADKVTTEMINFITKEARGLLCVAVTM
RIBBA_PARD8     ---------QLNTIEEAIEDFREGKFLIVVDDEDRENEGDFIIAAEKVTPEKINFMLKNGRGVLCAPITE
RIBBA_PELPB     -----------DTIDAALEDIRQGKLVIVIXXXXXXXXXXFIGAADKVTNEMVNFITREARGLLCVAVTM
RIBBA_UNCTG     ------------SIGDAVKDIKVGRMVIVVDDPGRENEGDLICAAEKASPEVINFMTKYARGLICVPMKH
RIBBA_CHLMU     ------------SVQQAIKDIADGNFVIVIDRESRENEGDLILAGEKVSAEKMAFLLSHTTGIVCASVTR
RIBBA_PORGI     ---------KLNTIEEALEDFKEGKFLIVVDDEDRENEGDFIIAAEKITPDKVNFMMHHGRGVLCAPISE
RIBBA_PORG3     ---------KLNTIEEALEDFKEGKFLIVVDDEDRENEGDFIIAAEKITPDKVNFMMHHGRGVLCAPISE
RIBBA_STAAW     ---------QFDNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSK
RIBBA_STAAS     ---------QFDNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSK
RIBBA_STAAR     ---------QFDNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSK
RIBBA_STAAC     ---------QFDNIDSALMALKNGEPIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSK
RIBBA_STAEQ     ---------QFDTIELAIEALRNGESIIVVDDEDRENEGDLVAVTEWMDDNTINFMAREGRGLICAPIDK
RIBBA_STAAN     ---------QFDNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSK
RIBBA_STAAM     ---------QFDNIDSALMALKNGETIIVVDDENRENEGDLVAVTEWMNDNTINFMAKEARGLICAPVSK
RIBBA_STAES     ---------QFDTIELAIEALRNGESIIVVDDEDRENEGDLVAVTEWMDDNTINFMAKEGRGLICAPIDK
RIBBA_STAHJ     ---------EFDEIKDALNALKRGESIIVVDDEDRENEGDLVAITQWMNDNTINFMAKEGRGLICAPISK
RIBBA_STAS1     ---------QLDSIDTALQALKKGESIIVVDDENRENEGDLVAVTEWMNDNTVNFMATYGKGLICAPISN
RIBA_ARCFU      ----------------------------------------ICIPAEVVSGEILNFMMK-NCDEIRLALTW
RIBA_STRCO      ----------------------------------------------------------------------
RIBBA_THEMA     -----------------------------------------VFPAQLITEDVVSFFVTYGKGLFCVTADE
RIBB_NEIMB      --------SHISPIPEILADIKAGKMVIITDAEDRENEGDLLMAAQFVTPEAINFMIKHARGLVCLPMDG
RIBB_NEIMA      --------SHISPIPEILADIKVGKMVIITDAEDRENEGDLLMAAQFVTPEAINFMIKHARGLVCLPMDG
RIBB_PSESM      -----------DRIEDIIEDYRQGKMVLLVDDEDRENEGDLLLAADCCTAQAISFMAREARGLICLTLTD
RIBA_BURMA      ----------------------------------------------------------------------
RIBB_PHOLE      ----------LSSAKEIIDDIRQGRMVILMDDESRENEGDLIIASEMVTPEAINFMATHGRGLICLTLSK
RIBA_ACTSZ      ----------------------------------------------------------------------
RIBB_PSEAE      ----------LNTIDELIEDIRQGKMVILMDDEDRENEGDLIMAAECVRTEDINFMVKHARGLVCMPMTR
RIBB_CAMJE      ------------SVEQAIKDLQAGKMLVMVDAEDRENEGDLIFPAQFSTQEKVNFMIKEARGVVCVALDE
RIBA_NEIMF      ----------------------------------------------------------------------
RIBA_NEIMB      ----------------------------------------------------------------------
RIBA_NEIM0      ----------------------------------------------------------------------
RIBA_NEIG1      ----------------------------------------------------------------------
RIBB_DEHMU      -------------VNQAIEDIRQGKMVVMVDDEDRENEGDLVYAASFSTPQKVNFMASHAKGLICVAISK
RIBA_NEIMA      ----------------------------------------------------------------------
RIBA_MANSM      ----------------------------------------------------------------------
RIBA_HAES2      ----------------------------------------------------------------------
RIBA_HAES1      ----------------------------------------------------------------------
RIBA_HAEIE      ----------------------------------------------------------------------
RIBB_PHOPO      ----------LSTAQEIIEDIHQGKMVILMDDEDRENEGDLIIASDKVTPEAINFMATYGRGLICLTLNK
RIBA_HAEIN      ----------------------------------------------------------------------
RIBA_HAEIG      ----------------------------------------------------------------------
RIBA_HAEI8      ----------------------------------------------------------------------
RIBA_AERHH      ----------------------------------------------------------------------
RIBA_AZOVD      ----------------------------------------------------------------------
RIBA_PROMH      ----------------------------------------------------------------------
RIBA_PSEPW      ----------------------------------------------------------------------
RIBA_HAHCH      ----------------------------------------------------------------------
RIBA_PASMU      ----------------------------------------------------------------------
RIBA_SHIDS      ----------------------------------------------------------------------
RIBA_ENTS8      ----------------------------------------------------------------------
RIBA_SHISS      ----------------------------------------------------------------------
RIBA_SHIFL      ----------------------------------------------------------------------
RIBA_SHIF8      ----------------------------------------------------------------------
RIBA_SHIBS      ----------------------------------------------------------------------
RIBA_PSEE4      ----------------------------------------------------------------------
RIBA_ECOSM      ----------------------------------------------------------------------
RIBA_ECOSE      ----------------------------------------------------------------------
RIBA_ECOLU      ----------------------------------------------------------------------
RIBA_ECOLI      ----------------------------------------------------------------------
RIBA_ECOLC      ----------------------------------------------------------------------
RIBA_ECOHS      ----------------------------------------------------------------------
RIBA_ECODH      ----------------------------------------------------------------------
RIBA_ECOBW      ----------------------------------------------------------------------
RIBA_ECO8A      ----------------------------------------------------------------------
RIBA_ECO7I      ----------------------------------------------------------------------
RIBA_ECO5E      ----------------------------------------------------------------------
RIBA_ECO57      ----------------------------------------------------------------------
RIBA_ECO55      ----------------------------------------------------------------------
RIBA_ECO27      ----------------------------------------------------------------------
RIBA_ECO24      ----------------------------------------------------------------------
RIBA_ECOL6      ----------------------------------------------------------------------
RIBA_ECOL5      ----------------------------------------------------------------------
RIBA_ECO81      ----------------------------------------------------------------------
RIBA_ECO45      ----------------------------------------------------------------------
RIBA_ACIBS      ----------------------------------------------------------------------
RIBA_PSESM      ----------------------------------------------------------------------
RIB3_SCHPO      ----------LASIEEAVNDFRDGKFLIVLDDETRENEGDLIIAGCKVTTEQMAFLVRHSSGYVCVPMTG
RIBA_SHIB3      ----------------------------------------------------------------------
RIBA_PSEPK      ----------------------------------------------------------------------
RIBA_PSEPG      ----------------------------------------------------------------------
RIBA_PSEP1      ----------------------------------------------------------------------
RIBA_BAUCH      ----------------------------------------------------------------------
RIBA_ACIBY      ----------------------------------------------------------------------
RIBA_ACIBT      ----------------------------------------------------------------------
RIBA_ACIBC      ----------------------------------------------------------------------
RIBA_ACIB3      ----------------------------------------------------------------------
RIBB_WOLSU      ----------LNRVREAIEAIKKGEMIIMMDDEDRENEGDLVYAAAFSTPEKVNFMVSEAKGLVCVCVTS
RIBB_OCEIH      --------NELSKIEQAIEDLRNGKLIIVADDADREAEGDLVGLSEFVTPEKVNFMTKYGRGLICVPITE
RIBA_YERPS      ----------------------------------------------------------------------
RIBA_YERPE      ----------------------------------------------------------------------
RIBA_PSEFS      ----------------------------------------------------------------------
RIBA_ESCF3      ----------------------------------------------------------------------
RIBA_ACIB5      ----------------------------------------------------------------------
RIBA_PSEA7      ----------------------------------------------------------------------
RIBA_CITK8      ----------------------------------------------------------------------
RIBA_SHEON      ----------------------------------------------------------------------
RIBA_SHEAM      ----------------------------------------------------------------------
RIBA_PSEAE      ----------------------------------------------------------------------
RIBA_PSEA8      ----------------------------------------------------------------------
RIBA_PSEAB      ----------------------------------------------------------------------
RIBA_KLEP7      ----------------------------------------------------------------------
RIBA_KLEP3      ----------------------------------------------------------------------
RIBA_TOLAT      ----------------------------------------------------------------------
RIBA_SALTY      ----------------------------------------------------------------------
RIBA_SALTI      ----------------------------------------------------------------------
RIBA_SALPA      ----------------------------------------------------------------------
RIBA_SALCH      ----------------------------------------------------------------------
RIBB_ERWT9      -------------VTHAIEALRAGRGVMVLDDEDRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLNE
RIBA_ACIAD      ----------------------------------------------------------------------
RIBA_ERWCT      ----------------------------------------------------------------------
RIBA_ENT38      ----------------------------------------------------------------------
RIBA_SHESW      ----------------------------------------------------------------------
RIBA_SHEPC      ----------------------------------------------------------------------
RIBA_BUCAI      ----------------------------------------------------------------------
RIBA_SHESR      ----------------------------------------------------------------------
RIBA_SHESM      ----------------------------------------------------------------------
RIBA_SHEB5      ----------------------------------------------------------------------
RIBA_SHELP      ----------------------------------------------------------------------
RIBB_KLEP7      -----------ERVEHALDALREGRGVMVLDDEDRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTE
RIBA_SHESA      ----------------------------------------------------------------------
RIBB_KLEP3      -----------ERVEHALDALREGRGVMVLDDEDRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTE
RIBA_SHEB9      ----------------------------------------------------------------------
RIBA_SHEB8      ----------------------------------------------------------------------
RIBA_SHEB2      ----------------------------------------------------------------------
RIBB_VIBPA      -------------VENALIALKEGRGVLLLDDEDRENEGDIIYSVEHLTNEQMALMIRECSGIVCLCLTD
RIB3_CANAL      -------------IEEALEAYKNGEFLIVMDDEDRENEGDLIMAAELITQEKMAFLVRYSSGYVCVPLSE
RIBB_PROMH      --------SPLERVERALEALRAGKGVMVLDDENRENEGDMVFVAETMTTEQMAMSIRHGSGIVCVCITE
RIBA_SHESH      ----------------------------------------------------------------------
RIBB_HAEIN      ----------------------------------------LIFPAETITPEQMAKLIRYGSGIVCLCITD
RIBA_TERTT      ----------------------------------------------------------------------
RIBA_SHEFN      ----------------------------------------------------------------------
RIBB_ECOSM      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_ECOLU      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_EDWI9      ----------MERVERALSALRDGRGVMVLDDENRENEGDMIFAAEKMTVEQMALTIRHGSGIVCLCITE
RIBA_HAMD5      ----------------------------------------------------------------------
RIBB_VIBVY      -------------VENALLALKEGRGVLLLDDEDRENEGDIIYSVEHLTNAQMALMIRECSGIVCLCLTD
RIBB_VIBVU      -------------VENALLALKEGRGVLLLDDEDRENEGDIIYSVEHLTNAQMALMIRECSGIVCLCLTD
RIBB_RHORT      -----------ERVSRAVDSLRQGQGVIVVDDEDRENEGDLIFAAETLTAEQMSRMIRDGSGIVCLILTD
RIBB_PELPD      ---HHQSDLSLQRVEAALDALRAGQGVLVTDDEQRENEGDLIFAAQSLTREQVAMLIRECSGIVCLCLTD
RIB3_YEAST      ----------------------------------------LICAAENVSTEQMAFLVRHSSGYVCAPMTN
RIBB_VIBSL      -------------VENALQALREGRGVLLLDDEDRENEGDIIYSVEHLTNAQMALMIRECSGIVCLCLTD
RIBB_SHISS      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_SHIFL      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_SHIF8      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_SHIDS      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_SHIBS      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_SHIB3      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_ECOSE      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_ECOLI      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_ECOLC      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_ECOL5      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_ECOHS      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_ECODH      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_ECOBW      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_ECO8A      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_ECO7I      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_ECO5E      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_ECO57      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_ECO55      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_ECO24      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBA_THEVO      ----------------------------------------------------------------------
RIBA_BLOFL      ----------------------------------------------------------------------
RIBB_ESCF3      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTIEQMALTIRHGSGIVCLCITE
RIBB_ECOUT      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITD
RIBB_ECOL6      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITD
RIBB_ECOK1      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITD
RIBB_ECO81      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITD
RIBB_ECO45      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITD
RIBB_ECO27      -----------ERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITD
RIBA_SACD2      ----------------------------------------------------------------------
RIBB_HAEIG      ----------------------------------------LIFPAETITPEQMAKLIRYGSGIVCLCITD
RIBB_HAEI8      ----------------------------------------LIFPAETITSEQMAKLIRYGSGIVCLCITD
RIBB_HELHP      -------------IKEAIEAIKQGEMIIIMDDEDRENEGDLVMAGIFSSPQKINFMAQEARGLICVSITQ
RIBA_SHEHH      ----------------------------------------------------------------------
RIBB_YERE8      ----------VERVERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTVEQMALTIRHGSGIVCLCITD
RIBA_SHEWM      ----------------------------------------------------------------------
RIBA_SHEPW      ----------------------------------------------------------------------
RIBB_PASMU      ------------SEERAIAAINAGNGVLVLDDEDRENEGDLIFPAETITVEQMTMLIRYGSGIVCLCLSD
RIBB_HAEIE      ----------------------------------------LIFPAETITPEQMAKLIRYGSGIVCLCITD
RIBA_SHEPA      ----------------------------------------------------------------------
RIBA_SHEDO      ----------------------------------------------------------------------
RIBB_TOLAT      -------------VEQALSALQQGNGVLVVDDEDRENEGDLIFSAEKMTPQQMALMIRECSGIVCLCLTE
RIBB_SERP5      ----------VERVERALEALRNGRGVMVLDDENRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTE
RIBB_SALPK      -----------ERVELALDALREGRGVMVLDDEDRENEGDMIFPAEIMTVEQMALTIRHGSGIVCLCITE
RIBB_SALPA      -----------ERVELALDALREGRGVMVLDDEDRENEGDMIFPAEIMTVEQMALTIRHGSGIVCLCITE
RIBA_MARMS      ----------------------------------------------------------------------
RIBB_SHEWM      ----------IERVEAALTSLRQGQGVLVVDDEDRENEGDLIYSAQSLTNEQMALLIRECSGIVCLCLTD
RIBB_SHELP      -------------VEAALTALRAGQGVLVVDDEDRENEGDLIYSAEHLTQEQMALLIRECSGIVCLCLTD
RIBB_SHEFN      -------------VENALAALREGRGVLLLDDEDRENEGDIIYSVEHLTTAQMALMIRECSGIVCLCLTD
RIBB_CITK8      -----------ERVEHALSALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_AGRT5      -------------IEDAIEAISRGEMVIVVDDEDRENEGDIIAASDSITPQQIAFMMNHARGLVCVAMPG
RIBA_PICTO      ----------------------------------------------------------------------
RIBB_SHEHH      ----------IERVNAALTALRQGKGVLVVDDEDRENEGDLIYSAETLTNEQMALLIRECSGIVCLCLTD
RIBB_SALTY      -----------ERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_SALTI      -----------ERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_SALSV      -----------ERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_SALPC      -----------ERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_SALPB      -----------ERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_SALNS      -----------ERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_SALHS      -----------ERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_SALG2      -----------ERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_SALEP      -----------ERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_SALDC      -----------ERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_SALCH      -----------ERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_SALA4      -----------ERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBA_BUCBP      ----------------------------------------------------------------------
RIBB_MANSM      ----------------------------------------LIFPAETITTEQMAKLIRYGSGIVCLCITD
RIBB_ENT38      --------TSIERVEHALDALREGRGVMVLDDEHRENEGDMIFAAENMTVEQMALTIRHGSGIVCLCINE
RIBA_AZOBR      ----------------------------------------------------------------------
RIBB_SODGM      -------------VENALESLRNGRGVLVLDDEDRENEGDMIFAAQNMTVEQMALTIRYGSGIVCLCLTE
RIBB_PELCD      ----------LERVHLAIDRLRQGRGVLLVDDENRENEGDLIFPAETITPAQMAMMIRECSGIVCLCLTE
RIBB_METLZ      -----------NTIEEALKSLQNGEMIIVTDDENRENEGDLICAAEYATTENVNFMAKYGRGLICMPMGR
RIBB_BAUCH      -----QFGTPIERVEIALQALRHGRGVLVLDNEDRENEGDMIFAAEKMTIEQMALAIRYGSGIICLCLTE
RIBA_COLP3      ----------------------------------------------------------------------
RIBA_WIGBR      ----------------------------------------------------------------------
RIBB_SALAR      -----------ERVELALDALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITE
RIBB_DESVH      MNQHEQFGTTHERVERGLAALRTGQGVLVADDADRENEGDLIFAAETLTPAQMAMMIRECSGIVCLCLPE
RIBB_SHESH      ----------IERVETALISLKQGRGVLVVDDEDRENEGDLIYSAETLTNEQMALLIREGSGIVCLCLPD
RIBB_PSEHT      ----------LTRVENAITALQQGQGVLVVDDENRENEGDFVFSAEHLTTAQMAEMIREGSGIVCLCMGE
RIBB_DESVV      MNQHEQFGTTHERVERGLAALRTGQGVLVADDADRENEGDLIFAAETLTPAQMAMMIRECSGIVCLCLPE
RIBB_SHESA      ----------IERVEAGLEALRQGQGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPD
RIBB_VIBFI      --------SPIERVEQAIKSVQQGNGVLLLDDESRENEGDLIYSVDHLTSEQMALMIRSCSGIVCLCLTE
RIBB_PECCP      -----------ERVERALDALRHGRGVLVLDDEDRENEGDMIFSAENMTVEQMALTIRHGSGIVCLCLTE
RIBB_BLOFL      ----------------------------------------MIFAAENMTVKQMALAIRYGSGIVCLCLTE
RIBB_SHEPW      ----------IERVNAALTALREGKGVLVVDDEDRENEGDLIYSAETLTNEQMALLIRECSGIVCLCLTD
RIBB_ERWCT      -----------ERVERALDALRHGRGVLVLDDEDRENEGDMIFSAESMTVEQMALTIRHGSGIVCLCLTE
RIBA_BLOPB      ----------------------------------------------------------------------
RIBB_SHESR      ----------IERVEAGLEALRQGQGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPD
RIBB_SHESM      ----------IERVEAGLEALRQGQGVLVVDDEDRENEGDLIFAAESLTNAQMAMLIRECSGIVCLCLPD
RIBA_CAMHC      ----------------------------------------------------------------------
RIBB_YERPY      ----------VERVERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITD
RIBB_YERPS      ----------VERVERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITD
RIBB_YERPP      ----------VERVERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITD
RIBB_YERPN      ----------VERVERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITD
RIBB_YERPG      ----------VERVERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITD
RIBB_YERPE      ----------VERVERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITD
RIBB_YERPB      ----------VERVERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITD
RIBB_YERPA      ----------VERVERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITD
RIBB_YERP3      ----------VERVERAIDALRNGRGVMVLDDESRENEGDMVFAAEAMTLEQMALTIRHGSGIVCLCITD
RIBB_SHEB9      ----------IERVEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPD
RIBB_SHEB2      ----------IERVEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPD
RIBB_HELPJ      ----------------------------------------LVLAGIFSTPEKINFMATHARGLICVSLTK
RIBB_SHESW      ----------IERVEAGLNALRQGQGVLVVDDEDRENEGDLIFAAQTLTNAQMAMLIRECSGIVCLCLPD
RIBB_SHEPC      ----------IERVEAGLNALRQGQGVLVVDDEDRENEGDLIFAAQTLTNTQMAMLIRECSGIVCLCLPD
RIBB_SHEB8      ----------IERVEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPD
RIBB_SHEB5      ----------IERVEAGLNALRQGQGVLVVDDEDRENEGDLIFAAETLTNAQMAMLIRECSGIVCLCLPD
RIBB_HAMD5      -------------VKKALENLKNGHGVMVLDDENRENEGDFVFAAETMTVEQMALTIRHGSGIVCLCLTE
RIBB_HELPY      ----------LKRVTEALEAYKNGEMLIVMDDEDRENEGDLVLAGIFSTPEKINFMATHARGLICVSLTK
RIBB_ENTS8      -----------ERVENAIAALREGRGVMVLDDENRENEGDMIFAAETMTVEQMALTIRHGSGIVCLCLTE
RIBB_SHEPA      ----------IERVNAALSALRQGKGVLVVDDEDRENEGDLIYSAETLTNQQMALLIRECSGIVCLCLTD
RIBB_DESAD      -----QYGTPVERVEKGLQALREGRGILVTDNESRENEGDLIFSAEKLSDEQMAMMIRECSGIVCLCLTD
RIBB_CHLT3      -------------VENALTALRSGKGILVSDSPDRENEADLIFSAEFLTETQMAMLIRECSGIVCLCLTT
RIBA_BUCAP      ----------------------------------------------------------------------
RIB1_PICGU      ----------------------------------------------------------------------
RIBB_SHEON      ----------------------------------------LIFAAESLTNAQMAMLIRECSGIVCLCLPD
RIBB_RALSO      ----------------------------------------LIIAADRLTHAGMAMLIRECSGIVCLCLTA
RIBB_HAES2      -----------ERVKRAIEAFKRGNGVLVLDDEDRENEGDLIFPAETITVEQMAKLIRYGSGIVCLCITD
RIBB_HAES1      -----------ERVKRAIEAFKRGNGVLVLDDEDRENEGDLIFPAETITVEQMAKLIRYGSGIVCLCITD
RIB3_MAGGR      --------SNFDAIPDVIQAFKNGEFVVVLDDPSRENEADLIIAAESVTTEQMAFMVRHSSGLICAPLTP
RIBA_PSYIN      ----------------------------------------------------------------------
RIBB_PSEPK      -----QHHAQFPNVSAAIAAFQAGRPVXXXXXXXXXXXXXXXXXXXXXTLQTMAMMIRDCSGIVCLCLDE
RIBB_DESDG      -----------ERVEAALDALRRGHGVLVTDDEDRENEGDLIFAAETLSDSQMAMLIRECSGIVCLCLTD
RIBB_DESPS      -------------VEKSLQALRQGEGVLLVDDEDRENEGDLIYSAEHLTAKQMALMIREGSGIVCLCLTG
RIBB_BUCAT      ----------IERIKNAILALKSGQGVIILDDEERENEGDLVFACENMTVEQMALSIRYGSGIVCLCITE
RIBB_BUCAI      ----------IERIKNAILALKSGQGVIILDDEERENEGDLVFACENMTVEQMALSIRYGSGIVCLCITE
RIBB_BUCA5      ----------IERIKNAILALKSGQGVIILDDEERENEGDLVFACENMTVEQMALSIRYGSGIVCLCITE
RIBB_DESAH      ----------IERVDRAIDALVSGRGVLLVDDEDRENEGDLIFPAGNITAEQVALLIRECSGIICLCLPP
RIBA_CAMFF      ----------------------------------------------------------------------
RIBB_PHOLL      -----------ERVEHAINALRDGKGVMVLDNEDRENEGDIIFAAETMTVEQMALTIRYGSGIVCLCLTE
RIBA_XYLFA      ----------------------------------------------------------------------
RIBB_WIGBR      -------------VKNALQSLKRGNGILVLDDENRENEGDMIFAAENMTVNQMALAIRFGSGIVCICLTK
RIBB_CLOBL      -----QFGNSLTRVEKALENLKNGKGVLLVDDENRENEGDLIFPAETITVPQMAMLIRECSGIVCLCLTD
RIB1_SCHPO      ----------------------------------------------------------------------
RIBA_XYLFT      ----------------------------------------------------------------------
RIBB_CLOBH      -----QFGNSLTRVEKALENLKNGKGVLLVDDENRENEGDLIFPAETITVPQMVMLIRECSGIVCLCLTD
RIBB_CLOB1      -----QFGNSLTRVEKALENLKNGKGVLLVDDENRENEGDLIFPAETITVPQMVMLIRECSGIVCLCLTD
RIBB_CHLL2      ----EQLLNQLNLVEKALAALRNGQGVLVADDPGRENEADLIFPAESVTIPQMALLIRECSGIVCLCMTD
RIBB_DESAA      ----EQFGNARERVEKGLQALRDGQGVLVADDENRENEGDLIFSAESLTEAQMAMLIRECSGIVCLCMPD
RIBB_RALEJ      ----------------------------------------LILAAECLTPSNMAMMIRECSGIVCLCLTT
RIBB_VIBCM      -------------VENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTAQMALMIRECSGIVCLCLTE
RIBB_VIBCH      -------------VENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTAQMALMIRECSGIVCLCLTE
RIBB_BORPE      -------------LERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLPG
RIBB_BORPA      -------------LERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLPG
RIBB_BORBR      -------------LERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLPG
RIBB_PHOPR      -----------ERVEAGLTAIREGRGVLVVDDEDRENEGDIIFAAETLTSEQMALMIRECSGIVCLCLTD
RIBB_BUCAP      ----------IERVKKAISALQLGEGIIILDDEKRENEGDLVFSSETMTVEQMALTIRYGSGIVCLCITE
RIBB_DESRM      -----------ERVERALRSLRNGNGVLVTDDENRENEGDLIFPAQTLNEVQMAMLIRECSGIVCLCLTD
RIBB_AERHH      ----------------------------------------LIFAAESMTNEQMAMMIRECSGIVCLCLTD
RIBA_VIBVU      ----------------------------------------------------------------------
RIBB_VIBC3      -------------VENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTVQMALMIRECSGIVCLCLTE
RIBB_VIBHA      -------------VERAIEALKNGLGVLLMDDEDRENEGDLIFSAQHLTEAQMALMIREGSGIVCLCLTE
RIBB_AERS4      ----------------------------------------LIFAAQTMTNEQMAMMIRECSGIVCLCLTD
RIBA_VIBCH      ----------------------------------------------------------------------
RIBA_VIBPA      ----------------------------------------------------------------------
RIBA_HELAH      ----------------------------------------------------------------------
RIBB_DESDA      -----------ERVQKALASLRAGGGVLVVDDEDRENEGDLIFPAQTITVPQMAMLIRHCSGIVCLCLTD
RIBB_BUCBP      -------------VKNAISALRYGHGIIVLDNEDRENEGDLIFSGETMTTEQMALTIRYGSGIVCLCITE
RIBA_HELPS      ----------------------------------------------------------------------
RIBA_PHOPO      ----------------------------------------------------------------------
RIBA_HELPY      ----------------------------------------------------------------------
RIBA_HELP2      ----------------------------------------------------------------------
RIBA_ALISL      ----------------------------------------------------------------------
RIBA_HELPH      ----------------------------------------------------------------------
RIBA_VIBF1      ----------------------------------------------------------------------
RIBA_VIBFM      ----------------------------------------------------------------------
RIBA_HELPJ      ----------------------------------------------------------------------
RIB1_YEAST      ----------------------------------------------------------------------
RIBA_HELHP      ----------------------------------------------------------------------
RIBB_CHRVO      -----RVHAALDALRRGLPVIVADDADRENEAD-------LILAADTLTVPEMARMIRDGSGIVCLCLTP
RIBA_DEHMU      ----------------------------------------------------------------------
RIBB_METTH      -------------IQEALKALRRGEIVLVFDADNRERETDMIVAAEKIKPEHIRIMRNDAGGLICVPVSW
RIBB_METJA      ----------MNNVEKAIEALKKGEIILVYDSDEREGETDMVVASQFITPEHIRIMRKDAGGLICTALHP
RIBB_METMA      -----------ENINRALEALRAGKMIQIYDSDSREGETDLVIPAKAVTYTDVKWMRKDAGGLICVAVDP
RIBB_METAC      -----------ENINRALEVLRAGKMIQIYDSDSREGETDLVIPAKAVTYKDVKWMRKDAGGLICVAVDP
URC1_SACKL      ----------------------------------------------------------------------
URG1_SCHPO      ----------------------------------------------------------------------
RIBB_ARCFU      ----------------------------------------------------VAMMRIDGGGLICVAIHP
TPIS_PSEMY      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KDADRLDLPPMTAHNQDARGTAYTVTVDANTGTTGISATDRAHTLRLLADPEADRTDFTRPGHVVPLRAR
RIBBA_CORGL     KDADRLDLPPMTAHNQDARGTAYTVTVDANTGTTGISATDRAHTLRLLADPEADRTDFTRPGHVVPLRAR
RIBBA_CORGB     KDADRLDLPPMTAHNQDARGTAYTVTVDANTGTTGISATDRAHTLRLLADPEADRTDFTRPGHVVPLRAR
RIBBA_CORAM     EDCKRLNLPPMMGRNEDVRGTAYTVTVDANTGTTGISATSRAETMLRLADPMSVVDDFTRPGHVVPLAAR
RIBBA_MYCA9     EDCDRLGLLPQYAVNQDKHGTAYTVTVDAKNGITGISASDRAATMRLLADAASTADDFTKPGHVVPLRAK
RIBBA_MYCVP     DICDRLGLLPMYAVNQDKHGTAYTVTVDAKKGVTGISAMDRATTMRLLADPDAVADDFTKPGHVVPLRAK
RIBBA_MYCGI     EICDRLGLLPMYAVNQDKHGTAYTVTVDAKVGVTGISASDRATTMRLLADPDSVADDFTKPGHVVPLRAK
RIBBA_RHOE4     DDCDRLGLPPMYATNQDKHGTAYTVTVDAREGITGISASDRAATMRLLANPESGANDFTRPGHVVPLRAK
RIBBA_MYCPA     AICDRLGLLPMYAVNQDKHGTAYTVTVDARNGVTGISASDRATTMRLLADPTSIAEDFTRPGHVVPLRAK
RIBBA_MYCMM     AVCDRLGLLPMYAVNQDKHGTAYTVTVDAKNGVTGISASDRATTMRLLADPASVAEDFTRPGHVVPLRAK
RIBBA_MYCTU     AICDRLGLLPMYAVNQDKHGTAYTVTVDARNGITGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAK
RIBBA_MYCTA     AICDRLGLLPMYAVNQDKHGTAYTVTVDARNGITGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAK
RIBBA_MYCBT     AICDRLGLLPMYAVNQDKHGTAYTVTVDARNGITGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAK
RIBBA_MYCBP     AICDRLGLLPMYAVNQDKHGTAYTVTVDARNGITGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAK
RIBBA_MYCBO     AICDRLGLLPMYAVNQDKHGTAYTVTVDARNGITGISASDRATTMRLLADPTSVADDFTRPGHVVPLRAK
RIBBA_MYCA1     AICDRLGLLPMYAVNQDKHGTAYTVTVDARNGVTGISASDRATTMRLLADPTSIAEDFTRPGHVVPLRAK
RIBBA_MYCUA     AVCDRLGLLPMYAVNQDKHGTAYTVTVDAKNGVTGISASDRATTMRLLADPASVAEDFTRPGHVVPLRAK
RIBBA_NOCFA     EDCDRLGLPPMYATNQDKHGTAYTVSVDAREGTTGISAADRATTMRXXXXXXXXXXXXTRPGHVVPLRAK
RIBBA_SALAI     DECDRLDLPPMHHTNQDRRGTAYTVTVDAREGSTGISAADRAHTIRLLADPRTGPADLARPGHVVPLRAR
RIBBA_RHOSR     ADCDRLGLPPMYATNQDKHGTAYTVTVDAREGITGISASDRAATMRLLADPSSGAQDFTRPGHVVPLRAK
RIBBA_SALTO     DDCDRLDLPPMHHTNQDRRGTAYMVTVDARKGSTGISAADRARVIRLLADPSTTPDDLARPGHVVPLRAR
RIBBA_GEOSW     ELADKLDLAPMVNHNTDSHGTAFTVSIDYKSTTTGISAYERSMTIQALLDPNAKASDFKRPGHVFPLVAK
RIBBA_BACSK     EQAERLQLGQMVSHSTDPHGTAFTVSVDHSHTTTGISAFERAETVRALADANAQPSDFKRPGHVFPLVAK
RIBBA_BACWK     EYAERLQLEPMVSHNTDSHHTAFTVSIDHVSTTTGISAHERATTIQELLNPASKGSDFNRPGHIFPLIAK
RIBBA_BACC2     GYAERLQLEPMVSHNTDSHHTAFTVSIDHVSTTTGISAHERATTIQELLNPASKGTDFNRPGHIFPLIAK
RIBBA_ARATH     DDLERLHLPLMVKENEEKLSTAFTVTVDAKHGTTGVSARDRATTILSLASRDSKPEDFNRPGHIFPLKYR
RIBBA_BACC4     GYAERLQLEPMVSHNTDSHHTAFTVSIDHVSTTTGISAHERATTIQELLNPASKGADFNRPGHIFPLIAK
RIBBA_BACCZ     GYAERLQLEPMVSHNTDSHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAK
RIBBA_BACHK     GYAERLQLEPMVSHNTDSHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAK
RIBBA_BACC3     GYAERLQLEPMVSHNTDSHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAK
RIBBA_BACC1     GYAERLQLEPMVAHNTDSHHTAFTVSIDHVSTTTGISAHERATTIREMLNPASKGADFNRPGHIFPLIAK
RIBBA_BACAN     GYAERLQLEPMVSHNTDSHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAK
RIBBA_BACAH     GYAERLQLEPMVSHNTDSHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAK
RIBBA_BACAC     GYAERLQLEPMVSHNTDSHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAK
RIBBA_BACAA     GYAERLQLEPMVSHNTDSHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAK
RIBBA_BACCR     GYAERLQLEPMVSHNTDSHHTAFTVSIDHVSTTTGISAHERATTIQELLNPASKGADFNRPGHIFPLIAK
RIBBA_BACCQ     GYAERLQLEPMVAHNTDSHHTAFTVSIDHVSTTTGISAHERATTIREMLNPASKGADFNRPGHIFPLIAK
RIBBA_BACC7     GYAERLQLEPMVAHNTDSHHTAFTVSIDHVSTTTGISAHERATTIREMLNPASKGADFNRPGHIFPLIAK
RIBBA_BACC0     GYAERLQLEPMVSHNTDSHHTAFTVSIDHVSTTTGISAHERATTIQQLLNPASKGADFNRPGHIFPLIAK
RIBBA_BACSU     EIADRLDLHPMVEHNTDSHHTAFTVSIDHRETKTGISAQERSFTVQALLDSKSVPSDFQRPGHIFPLIAK
RIBBA_SYNWW     ERLDELEIHDMVTENTDNHETAFTVTVDYRGTTTGISAFERAATVKALIDSVSKPSDFRKPGHIFPLRYR
RIBBA_AQUAE     ERCEQLDLHPMTPMNTDPKGTYFCVSIDAHPKTTGISAYDRALTIKLAISPDAKPSDFVRPGHVFPLKAR
RIBBA_BACV8     SRCKELELPHQVDTNTSVLGTPFTVTVDKLEGSTGVSIHDRAATIRALADPTSTPETFGRPGHVNPLYAQ
RIBBA_BACA2     DIAGRLDLHPMVDHNTDSHETAFTVSIDHRLTKTGISAQERSFTIQALLNEESVSDDFQRPGHIFPLIAK
RIBBA_BREBN     EHATRLQLAPMVNANTDKQGTAFTVSIDEGSTNTGISAHERSQTVLAMLDEQKDADDFRRPGHIFPLIAK
RIBBA_BACAM     DIAGRLDLHPMVDHNTDSHETAFTVSIDHKLTKTGISAQERSFTIQALLDEESVPGDFQRPGHIFPLIAK
RIBBA_CLONN     EKLKELDLYQMVINNTDTKETAFTVSIDSVETTTGISAFERALTITKAVEKGAKAKDFQRPGHIFPLRAR
RIBBA_THEPX     KRLNELGIYQMVENNTDHKETAFTVSVDYKECTTGISAFERALTVKKLVDDNSKPEDFTKPGHIFPLRAK
RIBBA_THEP3     KRLNELGIYQMVENNTDHKETAFTVSVDYKECTTGISAFERALTVKKLVDDNSKPEDFTKPGHIFPLRAK
RIBBA_BACCN     HYAKRLQLEPMVSQNTDSHHTAFTVSIDHISTTTGISAHERATTVRELLNPSSKGSDFNRPGHIFPLIAK
RIBBA_BACTN     SRCKELDLPHQVSDNTSVLGTPFTVTIDKLEGSTGVSASDRAATIQALADPASTPATFGRPGHINPLYAQ
RIBBA_CYTH3     ARCTELKLDLMVGSNTATHETPFTVSVDGNGCTTGISASDRSKTIRALVDPDTKPEDLGRPGHIFPLKAK
RIBBA_PROA2     DRAKELQLDPMVQRNTSQHETNFTVSVDALAETTGISAFDRYMTIKMLADPVSHADNFSRPGHIFPLRAM
RIBBA_ACTPL     EIAKKLNFHPMVAVNQDNHETAFTVSVDHIDTGTGISAFERSITAMKIVDDNAKATDFRRPGHMFPLIAK
RIBBA_ACTP2     EIAKKLNFHPMVAVNQDNHETAFTVSVDHIDTGTGISAFERSITAMKIVDDNAKATDFRRPGHMFPLIAK
RIBBA_CHLPN     ERLLSLDLPPMVKDNRCRFKTPFTVSVDAAHGTTGVSAADRTKVVQLLADPKSKPEDFISPGHFFPLASS
RIBBA_BACFR     ERCAELELDMQVSSNTSIYETPFTVTVDLLEGTTGVSMHDRAMTIRALADPKTKPADLGRPGHINPLRAR
RIBBA_BACFN     ERCAELELDMQVSSNTSIYETPFTVTVDLLEGTTGVSMHDRAMTIRALADPKTKPADLGRPGHINPLRAR
RIBBA_SYNY3     DRLDELDLPLMVSKNTDSNQTAFTVSIDAAPHTTGISAEDRARTIQIAINPVTRPEDLSRPGHIFPLRAK
RIBBA_ACTP7     EIAKKLNFHPMVAVNQDNHETAFTVSVDHIDTGTGISAFERSITAMKIVDDNAKATDFRRPGHMFPLIAK
RIBBA_PELLD     ERARELQLDPMVQRNTSQHETNFTVSVDAIAETTGISVYDRATTIKMLGDPASHADSFSRPGHIFPLRAM
RIBBA_ACTPJ     EIAKKLNFHPMVAVNQDNHETAFTVSVDHIDTGTGISAFERSITAMKIVDDNAKATDFRCPGHMFPLIAK
RIBBA_CHLTR     EQAKSLDLPAMVQDNQCAFKTAFTVSVDASSGTTGVSASDRTRTVQLLADPAATAESFVRPGHVFPLISQ
RIBBA_PROVI     DRAKELQLEPMVQRNTSQHETNFTVSVDAIAETTGISVYDRAMTIKMLGDETSHADSFSRPGHIFPLRAM
RIBBA_PARD8     ERCQELELDMQVANNTSLLGTPFTITVDKLGGTTGVSMYDRAETILALADPKTKPSDLGRPGHINPLRAR
RIBBA_PELPB     DRAKELQLDPMVQRNTSQHETNFTVSVDAIAETTGISVYDRAMTIKMLGDLSSTADDFSRPGHIFPLRAM
RIBBA_UNCTG     ERLKELEIENMVEKPTEKKGCSFTVSVDYKIGTTGISAYDRSVTVRKLIDKTAKHEDFARPGHIFPLRCK
RIBBA_CHLMU     EQARVLDLPAMVQENQCAFKTAFTVSVDASSGTTGVSAADRTRTVQLLSDPTSISQSFVRPGHVFPLVSQ
RIBBA_PORGI     ERAHELELEMQVPDNTSVHETPFTVTVDGNGCTTGVSMYDRAQTILALADPNTRPSDLGRPGHICPLRAR
RIBBA_PORG3     ERAHELELEMQVPDNTSVHETPFTVTVDGNGCTTGVSMYDRAQTILALADPNTRPSDLGRPGHICPLRAR
RIBBA_STAAW     DIAQRLDLVQMVDDNSDIFGTQFTVSIDHVDTTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQ
RIBBA_STAAS     DIAQRLDLVQMVDDNSDIFGTQFTVSIDHVDTTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQ
RIBBA_STAAR     DIAQRLDLVQMVDDNSDIFGTQFTVSIDHVDTTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQ
RIBBA_STAAC     DIAQRLDLVQMVDDNSDIFGTQFTVSIDHVDTTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQ
RIBBA_STAEQ     SIAERLKLQSMEQNNTDIYGTHFTVSIDHYKTTTGISAHERTQTARALIDENTNPEDFHRPGHLFPLIAK
RIBBA_STAAN     DIAQRLDLVQMVDDNSDIFGTQFTVSIDHVDTTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQ
RIBBA_STAAM     DIAQRLDLVQMVDDNSDIFGTQFTVSIDHVDTTTGISAYERTLTAKKLIDPSSEAKDFNRPGHLFPLVAQ
RIBBA_STAES     SIAERLKLQSMEQNNTDIYGTHFTVSIDHYKTTTGISAHERTQTARALIDENTNPEDFHRPGHLFPLIAK
RIBBA_STAHJ     DLALKFNLMPMVEHNTDGFGTNFTVSIDHATTSTGISAFDRMATARALINPESTPEDFHKPGHLFPLIAK
RIBBA_STAS1     AIAEKLDLNPMVTHNSDVYGTQFTVSVDHIQTTTGISADERTMTARALIDEQATGSDFNKPGHLFPLIAQ
RIBA_ARCFU      KQILNLGLNRFRFQNGNL------IPIDPNLEK--ISAEERAKFIRELVSGNAG--DIKYPGRIFVEETK
RIBA_STRCO      ----------------------------------------------------------------------
RIBBA_THEMA     EDLLKRGFVKLSSNY----GANYFVPVDWGTGT-GISALERAETCRKLAEGRYFH-EFRYPGHVTVIGGI
RIBB_NEIMB      EMVEKLGLPMMTQKNGAQYGTNFTVSIEAAHGTTGISAADRALTIQTAVSPTAKPEDIVQPGHIFPLRAQ
RIBB_NEIMA      EMVEKLGLPMMTQKNGAQYGTNFTVSIEAAHGTTGISAADRALTIQTAVSPTAKPEDIVQPGHIFPLRAQ
RIBB_PSESM      EHCKSLGLEQMVPSNGSVFATAFTVSIEATTGTTGISAADRARTVQAAVNPGAVPDDLVQPGHIFPLRAR
RIBA_BURMA      ----------------------------------------------------------------------
RIBB_PHOLE      ARCKTLNLPLMVQGNNDNFSTPFTISIEAKYVTTGISASDRAKTVLAAVAPNAKSTDIVMPGHIFPLMAQ
RIBA_ACTSZ      ----------------------------------------------------------------------
RIBB_PSEAE      ERCERLGLPLMVQRNGSGFGTKFTVSIEAAEGTTGISXXXXXXXXXXXXXXXXXXXXIVSPGHIFPLMAQ
RIBB_CAMJE      TLAKKFELPLMVPKNTSNHETAFTITVDAKDATTGVSAYERNMTIQIFADDNAKASDFVRPGHINPLIAK
RIBA_NEIMF      ----------------------------------------------------------------------
RIBA_NEIMB      ----------------------------------------------------------------------
RIBA_NEIM0      ----------------------------------------------------------------------
RIBA_NEIG1      ----------------------------------------------------------------------
RIBB_DEHMU      KIANRLQLEPMVKKNDSSYETAFTITVDARTAATGISAGERDMTIKILADGGSHESELVRPGHIFPLIAK
RIBA_NEIMA      ----------------------------------------------------------------------
RIBA_MANSM      ----------------------------------------------------------------------
RIBA_HAES2      ----------------------------------------------------------------------
RIBA_HAES1      ----------------------------------------------------------------------
RIBA_HAEIE      ----------------------------------------------------------------------
RIBB_PHOPO      ERCLQLELPMMVKSNTDKFATPFTISIEAASGTTGISVNDRXXXXXXXXXXXXXXKDIVMPGHIFPLMAQ
RIBA_HAEIN      ----------------------------------------------------------------------
RIBA_HAEIG      ----------------------------------------------------------------------
RIBA_HAEI8      ----------------------------------------------------------------------
RIBA_AERHH      ----------------------------------------------------------------------
RIBA_AZOVD      ----------------------------------------------------------------------
RIBA_PROMH      ----------------------------------------------------------------------
RIBA_PSEPW      ----------------------------------------------------------------------
RIBA_HAHCH      ----------------------------------------------------------------------
RIBA_PASMU      ----------------------------------------------------------------------
RIBA_SHIDS      ----------------------------------------------------------------------
RIBA_ENTS8      ----------------------------------------------------------------------
RIBA_SHISS      ----------------------------------------------------------------------
RIBA_SHIFL      ----------------------------------------------------------------------
RIBA_SHIF8      ----------------------------------------------------------------------
RIBA_SHIBS      ----------------------------------------------------------------------
RIBA_PSEE4      ----------------------------------------------------------------------
RIBA_ECOSM      ----------------------------------------------------------------------
RIBA_ECOSE      ----------------------------------------------------------------------
RIBA_ECOLU      ----------------------------------------------------------------------
RIBA_ECOLI      ----------------------------------------------------------------------
RIBA_ECOLC      ----------------------------------------------------------------------
RIBA_ECOHS      ----------------------------------------------------------------------
RIBA_ECODH      ----------------------------------------------------------------------
RIBA_ECOBW      ----------------------------------------------------------------------
RIBA_ECO8A      ----------------------------------------------------------------------
RIBA_ECO7I      ----------------------------------------------------------------------
RIBA_ECO5E      ----------------------------------------------------------------------
RIBA_ECO57      ----------------------------------------------------------------------
RIBA_ECO55      ----------------------------------------------------------------------
RIBA_ECO27      ----------------------------------------------------------------------
RIBA_ECO24      ----------------------------------------------------------------------
RIBA_ECOL6      ----------------------------------------------------------------------
RIBA_ECOL5      ----------------------------------------------------------------------
RIBA_ECO81      ----------------------------------------------------------------------
RIBA_ECO45      ----------------------------------------------------------------------
RIBA_ACIBS      ----------------------------------------------------------------------
RIBA_PSESM      ----------------------------------------------------------------------
RIB3_SCHPO      ERLDSLEIPMMVDNNEDRMRTAYAVTLDANGTTTGISAHDRALTTRQLANPEVTSPEFNRPGHIVPLRAR
RIBA_SHIB3      ----------------------------------------------------------------------
RIBA_PSEPK      ----------------------------------------------------------------------
RIBA_PSEPG      ----------------------------------------------------------------------
RIBA_PSEP1      ----------------------------------------------------------------------
RIBA_BAUCH      ----------------------------------------------------------------------
RIBA_ACIBY      ----------------------------------------------------------------------
RIBA_ACIBT      ----------------------------------------------------------------------
RIBA_ACIBC      ----------------------------------------------------------------------
RIBA_ACIB3      ----------------------------------------------------------------------
RIBB_WOLSU      TCSDRLGLAPMVRENNSQHETAFTVSIDARECSTGISAFERDLTIRKMVDGTSKPEDFVRPGHIFPLIAK
RIBB_OCEIH      ERALELDLHAMATNNTDTYGTQFTVSVDYYTNSTGISTADRADTIRALAEPLSKAADFKRPGHMFPLIAK
RIBA_YERPS      ----------------------------------------------------------------------
RIBA_YERPE      ----------------------------------------------------------------------
RIBA_PSEFS      ----------------------------------------------------------------------
RIBA_ESCF3      ----------------------------------------------------------------------
RIBA_ACIB5      ----------------------------------------------------------------------
RIBA_PSEA7      ----------------------------------------------------------------------
RIBA_CITK8      ----------------------------------------------------------------------
RIBA_SHEON      ----------------------------------------------------------------------
RIBA_SHEAM      ----------------------------------------------------------------------
RIBA_PSEAE      ----------------------------------------------------------------------
RIBA_PSEA8      ----------------------------------------------------------------------
RIBA_PSEAB      ----------------------------------------------------------------------
RIBA_KLEP7      ----------------------------------------------------------------------
RIBA_KLEP3      ----------------------------------------------------------------------
RIBA_TOLAT      ----------------------------------------------------------------------
RIBA_SALTY      ----------------------------------------------------------------------
RIBA_SALTI      ----------------------------------------------------------------------
RIBA_SALPA      ----------------------------------------------------------------------
RIBA_SALCH      ----------------------------------------------------------------------
RIBB_ERWT9      ERLEQLDLPMMVQNNTSAYGTGFTVTIEAAEGTTGVSATDRLTTIRAAIADDARPSDLNRPGHVFPLRAR
RIBA_ACIAD      ----------------------------------------------------------------------
RIBA_ERWCT      ----------------------------------------------------------------------
RIBA_ENT38      ----------------------------------------------------------------------
RIBA_SHESW      ----------------------------------------------------------------------
RIBA_SHEPC      ----------------------------------------------------------------------
RIBA_BUCAI      ----------------------------------------------------------------------
RIBA_SHESR      ----------------------------------------------------------------------
RIBA_SHESM      ----------------------------------------------------------------------
RIBA_SHEB5      ----------------------------------------------------------------------
RIBA_SHELP      ----------------------------------------------------------------------
RIBB_KLEP7      ERRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRVTTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBA_SHESA      ----------------------------------------------------------------------
RIBB_KLEP3      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRVTTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBA_SHEB9      ----------------------------------------------------------------------
RIBA_SHEB8      ----------------------------------------------------------------------
RIBA_SHEB2      ----------------------------------------------------------------------
RIBB_VIBPA      AQADKLELPPMVVNNNSANQTAFTVSIEAKVGTTGVSAADRVTTIKTAANPHAKPEDLARPGHVFPLRAR
RIB3_CANAL      ERANQLELPPMLANRSDRHGTAYTITCDFAEGTTGISAHDRALTTRSLANPNSKPQDFIKPGHILPLRAV
RIBB_PROMH      ERRQQLDLPMMVENNTSHFHTAFTVTIEAAQGTTGVSAADRLTTVRAAAADNAKPSDLNRPGHVFPLRAQ
RIBA_SHESH      ----------------------------------------------------------------------
RIBB_HAEIN      ERCQQLDLPPMVEHNNSVNKTAFTVTIEAAKGSTGVSAADRVTTIQTAIADNAVLTDLHRPGHVFPLRAA
RIBA_TERTT      ----------------------------------------------------------------------
RIBA_SHEFN      ----------------------------------------------------------------------
RIBB_ECOSM      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADDAKPSDLNRPGHVFPLRAQ
RIBB_ECOLU      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADDAKPSDLNRPGHVFPLRAQ
RIBB_EDWI9      ARRQQLDLPMMVSNNTSHYGTAFTVTIEAAEGTTGVSAQDRLTTVRAAIADDAKPGDLHRPGHVFPLRAR
RIBA_HAMD5      ----------------------------------------------------------------------
RIBB_VIBVY      EHANKLELPPMVVNNNSANQTAFTVSIEAKQGTTGVSAQDRVTTIKTAANPSAKADDLARPGHVFPLRAR
RIBB_VIBVU      EHANKLELPPMVVNNNSANQTAFTVSIEAKQGTTGVSAQDRVTTIKTAANPSAKADDLARPGHVFPLRAR
RIBB_RHORT      PDLDRLALPPMVAHNTSRNGTGFTVSIEAREGTTGVSAADRVTTIRAAIDPASTADDLARPGHVFPLRAH
RIBB_PELPD      EAVRRLDLPLMVSDNSSRYQTAFTVSIEAAEGTTGVSAADRLTTIRAAIADDAGPLCLSRPGHVFPLRAR
RIB3_YEAST      AIADKLDLPLLRSNDDDRHGTAYTITVDVAQGTTGISAHDRSMTCRALADSSSTPKSFLKPGHICPLRAA
RIBB_VIBSL      EQANQLELPPMVVDNNSANQTAFTVTIEAKVGTTGVSAADRVTTIKTAANPTAKPTDLARPGHVFPLRAR
RIBB_SHISS      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_SHIFL      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_SHIF8      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_SHIDS      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_SHIBS      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_SHIB3      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECOSE      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECOLI      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECOLC      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECOL5      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECOHS      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECODH      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECOBW      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECO8A      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECO7I      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECO5E      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECO57      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECO55      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECO24      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBA_THEVO      ----------------------------------------------------------------------
RIBA_BLOFL      ----------------------------------------------------------------------
RIBB_ESCF3      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECOUT      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECOL6      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECOK1      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECO81      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECO45      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_ECO27      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRITTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBA_SACD2      ----------------------------------------------------------------------
RIBB_HAEIG      ERCQQLDLPSMVEHNNSVNKTAFTVTIEAAKGSTGVSAADRVTTIQTAIADNAVPTDLHRPGHVFPLRAV
RIBB_HAEI8      ERCQQLDLPPMVEHNNSVNKTAFTVTIEAAKGSTGVSAADRVTTIQTAIADNAVPTDLHRPGHVFPLRAA
RIBB_HELHP      ELAQKLDLPPMVQKNDSNHETAFTISIDAKEAKTGISAFERDMTIRLMCESNTKPSDFVRPGHIFPLIAK
RIBA_SHEHH      ----------------------------------------------------------------------
RIBB_YERE8      ERRQQLDLPMMVANNSSQFQTAFTVTIEAAKGTTGVSAADRLTTIRAAIADNAKPTDLNRPGHVFPLRGQ
RIBA_SHEWM      ----------------------------------------------------------------------
RIBA_SHEPW      ----------------------------------------------------------------------
RIBB_PASMU      EICQQLDLPPMVTENTSVNKTAFTVTIEAAKGSTGVSATDRVTTIRAAVADNAKPSDLSRPGHIFPLRAM
RIBB_HAEIE      ERCQQLDLPSMVEHNNSVNKTAFTVTIEAAKGSTGVSAADRVTTIQTAIADNAVPTDLHRPGHVFPLRAA
RIBA_SHEPA      ----------------------------------------------------------------------
RIBA_SHEDO      ----------------------------------------------------------------------
RIBB_TOLAT      ERIRQLALPMMVEHNTSANQTGFTVTIEAARGTTGVSAQDRITTIRTAIADGAVASDLNRPGHVFPLRAR
RIBB_SERP5      ERRQQLELPMMVTNNSSQFQTAFTVTIEAAQGTTGVSASDRLTTIRAAVADNAKPSDLNRPGHVFPLRAQ
RIBB_SALPK      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQ
RIBB_SALPA      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQ
RIBA_MARMS      ----------------------------------------------------------------------
RIBB_SHEWM      ERIKQLDLPPMVEDNSSQYGTAFTVSIEAKVGTTGVSAADRVTTIKAAIADNAVPEDLARPGHVYPLRAQ
RIBB_SHELP      ERVKQLELPPMVEDNSSQYGTAFTVSIEAKVGTTGVSAADRVTTIKAAIADDAKPSDLARPGHVYPLRAQ
RIBB_SHEFN      EHANKLQLPPMVINNNSANQTAFTISIEAKHGTTGVSAQDRVTTIKTAANRDAKASDLAHPGHVFPLRAR
RIBB_CITK8      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAKGTTGVSAADRVTTVRAAIADGAKPADLHRPGHVFPLRAQ
RIBB_AGRT5      ERLDALDIPLMVSRNTESLKTAFTVSVDYIPGTTGISAADRAKTVRALVSEGSRPEDFARPGHIFPLRAN
RIBA_PICTO      ----------------------------------------------------------------------
RIBB_SHEHH      ERIEQLQLPPMVSDNNSQYGTAFTVSIEAKQGTTGVSAADRVTTIKTAIADNAKPDDLARPGHVYPLRAR
RIBB_SALTY      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQ
RIBB_SALTI      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQ
RIBB_SALSV      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQ
RIBB_SALPC      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQ
RIBB_SALPB      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQ
RIBB_SALNS      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQ
RIBB_SALHS      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQ
RIBB_SALG2      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQ
RIBB_SALEP      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQ
RIBB_SALDC      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQ
RIBB_SALCH      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQ
RIBB_SALA4      DRRKQLDLPMMVENNTSAYGTGFTVTIEAAEGTTGVSAADRVTTVRAAIKDGAKPSDLNRPGHVFPLRAQ
RIBA_BUCBP      ----------------------------------------------------------------------
RIBB_MANSM      ELCQKLELPPMVAANTSVNKTAFTVTIEAAEGSTGVSAADRVTTVKVAVADNAKPSDLHHPGHVFPLRAA
RIBB_ENT38      ERRKQLDLPMMVENNTSAFGTGFTVTIEAAHGTTGVSAADRLTTVRAAIADGAKPSDLHRPGHVFPLRAQ
RIBA_AZOBR      ----------------------------------------------------------------------
RIBB_SODGM      ERRQQLALPMMVERNSSHYQTAFTVTIEAAEGSTGVSAADRLTTIRAAIKDNAKPTDLNRPGHVFPLCAQ
RIBB_PELCD      DKLKQLELPQMVSDNTSANQTAFTLSIEARQGTTGVSAADRVTTIRTAVADDCRPDDLARPGHVFPLRAR
RIBB_METLZ      SLVEKLCLPPMVLKNTDNHETAFTVSIDHVDTTTGISAVERGITARKCIDPNARPEDFRRPGHMFPLQAK
RIBB_BAUCH      ERRQQLELPMMVEHNTSHYQTAFTVTIEAAEGTTGVSAADRITTIRTAIKNDAIPEDLNRPGHVFPLLAQ
RIBA_COLP3      ----------------------------------------------------------------------
RIBA_WIGBR      ----------------------------------------------------------------------
RIBB_SALAR      DRRKQLDLPMMVQNNTSAYGTGFTVTIEAAEGTTGVSAADRVTTVRAAIADGAKPSDLNRPGHVFPLRAQ
RIBB_DESVH      ERVSRLGLPMMVAHNTSSMGTAFTISIEAAEGTTGVSAADRVRTVKAAIDDAACPGCLRSPGHVFPLRAS
RIBB_SHESH      ERVKHLALPPMVENNSSQYGTAFTVSIEAKEGTTGVSAADRVTTIKTAIADDAQPDDLARPGHVYPLRAQ
RIBB_PSEHT      ERIKQLDLPQMVTHNTSQNNTAYTITIEAKEGTTGVSAADRVTTIKAATADNAKPEDLSRPGHVFGLKAK
RIBB_DESVV      ERVSRLGLPMMVAHNTSSMGTAFTISIEAAEGTTGVSAADRVRTVQAAIDDAACPGCLRSPGHVFPLRAS
RIBB_SHESA      EKVKALELPPMVENNSSQYGTAFTVSIEAKVGTTGVSAADRVTTIKTAIADNAKPSDLARPGHVYPLRAQ
RIBB_VIBFI      DKADYLELSPMVEHNESVNQTAFTISIEAKKGTTGVSATDRVTTIKTACKNGALPHELAKPGHVFPLRAK
RIBB_PECCP      ERRQQLELPMMVEKNSSHYQTAFTVTIEAAEGTTGVSAADRLTTIRAAIADNAKPSDLNRPGHVFPLRAQ
RIBB_BLOFL      EKCRQLKLPMMVKNNSNHYKTAFTVTIEASKGTTGVSAKDRLTTIKTSIEDYAKPSDLNRPGHVFPLRAH
RIBB_SHEPW      ERITQLELPPMVVDNNSQYGTAFTVSIEAKEGTTGVSAADRVTTVKAAIADGAKPGDLARPGHVYPLRAR
RIBB_ERWCT      ERRQQLELPMMVEKNSSHYQTAFTVTIEAAEGTTGVSAADRLTTIRAAIADNARPSDLNRPGHVFPLRAQ
RIBA_BLOPB      ----------------------------------------------------------------------
RIBB_SHESR      EKVKALELPPMVENNSSQYGTAFTVSIEAKVGTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQ
RIBB_SHESM      EKVKALELPPMVENNSSQYGTAFTVSIEAKVGTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQ
RIBA_CAMHC      ----------------------------------------------------------------------
RIBB_YERPY      ERRQQLDLPMMVTHNSSQFQTAFTVTIEAAEGTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQ
RIBB_YERPS      ERRQQLDLPMMVTHNSSQFQTAFTVTIEAAEGTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQ
RIBB_YERPP      ERRQQLDLPMMVTHNSSQFQTAFTVTIEAAEGTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQ
RIBB_YERPN      ERRQQLDLPMMVTHNSSQFQTAFTVTIEAAEGTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQ
RIBB_YERPG      ERRQQLDLPMMVTHNSSQFQTAFTVTIEAAEGTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQ
RIBB_YERPE      ERRQQLDLPMMVTHNSSQFQTAFTVTIEAAEGTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQ
RIBB_YERPB      ERRQQLDLPMMVTHNSSQFQTAFTVTIEAAEGTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQ
RIBB_YERPA      ERRQQLDLPMMVTHNSSQFQTAFTVTIEAAEGTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQ
RIBB_YERP3      ERRQQLDLPMMVTHNSSQFQTAFTVTIEAAEGTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQ
RIBB_SHEB9      EKVKALELPAMVEHNSSQYGTAFTVSIEATVGTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQ
RIBB_SHEB2      EKVKALELPAMVEHNSSQYGTAFTVSIEATVGTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQ
RIBB_HELPJ      DLANKFELPPMVSVNDSNHETAFTVSIDAKEAKTGISAFERHLTIELLCKDTTKPSDFVRPGHIFPLIAK
RIBB_SHESW      EKVKALELPPMVENNSSQYGTAFTVSIEAKVGTTGVSAADRVTTIKAAIADGAKPSDLARPGHVYPLRAQ
RIBB_SHEPC      EKVKALELPPMVENNSSQYGTAFTVSIEAKVGTTGVSAADRVTTIKAAIADGAKPSDLARPGHVYPLRAQ
RIBB_SHEB8      EKIKALELPAMVEHNSSQYGTAFTVSIEATVGTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQ
RIBB_SHEB5      EKIKALELPAMVEHNSSQYGTAFTVSIEATVGTTGVSAADRVTTIKAAIADNAKPSDLARPGHVYPLRAQ
RIBB_HAMD5      ERCQQLELPMMVEKNSSTFQTPFTVSIEAAKGTTGVSASDRITTIKAAISQTAKPADLHRPGHVFPLKGH
RIBB_HELPY      DLAKKFELPPMVSVNDSNHETAFTVSIDAKEARTGISAFERHLTIELLCKDTTKPSDFVRPGHIFPLIAK
RIBB_ENTS8      ERRKQLDLPMMVENNTSAFGTGFTVTIEAAHGTTGVSXXXXXXXXXXXXXXXXKPSDLHRPGHVFPLRAQ
RIBB_SHEPA      ERIKQLQLPPMVSDNNSQYGTAFTVSIEAKQGTTGVSAADRVTTXXXXXXXXXXXXXLARPGHVYPLRAR
RIBB_DESAD      EKTEQLGLPMMVESNSSRYQTGFTVTIEAAEGTTGVSAADRVTTVKAAIADGAKPADLHRPGHVFPLRAR
RIBB_CHLT3      EKVQALALPMMVSENTSGFQTAFTVSIEAKTGVTGVSAADRVRTVKTAIAADAKPEELARPGHVFPLRAR
RIBA_BUCAP      ----------------------------------------------------------------------
RIB1_PICGU      ----------------------------------------------------------------------
RIBB_SHEON      EKVKALALPPMVENNSSQYGTAFTVSIEAKVGTTGVSAADRVTTIKTAIADHAKPSDLARPGHVYPLRAQ
RIBB_RALSO      EKAAVLGLRPMVEHNRSQYGTAFTVSIEARVGSTGVSAADRITTIRAAVAPDADAQSVVSPGHVFPLVAQ
RIBB_HAES2      ELCQQLDLPPMVQNNTSINQTAFTVSIEAAQGSTGVSAQDRVTTIQVAIADNAKPQDLSRPGHVFPLRAK
RIBB_HAES1      ELCQQLDLSPMVQNNTSINQTAFTVSIEAAQGSTGVSAQDRVTTIQAAIADNAKPQDLSRPGHVFPLRAK
RIB3_MAGGR      ERTTALDLPQMVTHNADPRGTAYTVSVDAESTTTGISAHDRALACRMLAAPDAQPSHFRRPGHVFPLXXX
RIBA_PSYIN      ----------------------------------------------------------------------
RIBB_PSEPK      ATVDELQLAPMVQNNQARHGTGFTVTIEAAEGTTGVSAQDRITTIDAALRSSAEQRHIVSPGHVFPLRAR
RIBB_DESDG      EKVRALGLPMMVENNSSQYQTAFTVSIEASCGSTGVSAADRVCTIQAAIADDACPSDLCRPGHVFPLRAR
RIBB_DESPS      EKVDELKLPQMVTNNNSRHGTGFTISIEARDGTTGVSAADRTQTVKAAIAEGAVAEDLCQPGHVFPLRAR
RIBB_BUCAT      SKRKQLNLPMMVKKNTSAYRTGFTVTIEASKGSTGVSAKDRLTTIKTAIADDAKPSDLNRPGHVFPLRAH
RIBB_BUCAI      SKRKQLNLPMMVKKNTSAYRTGFTVTIEASKGSTGVSAKDRLTTIKTAIADDAKPSDLNRPGHVFPLRAH
RIBB_BUCA5      SKRKQLNLPMMVKKNTSAYRTGFTVTIEASKGSTGVSAKDRLTTIKTAIADDAKPSDLNRPGHVFPLRAH
RIBB_DESAH      ERIEQLGLPQMVTCNTSAYQTAFTISIEAAEGTTGVSAADRATTIRCAAALDARPEDIHSPGHVFPLRAV
RIBA_CAMFF      ----------------------------------------------------------------------
RIBB_PHOLL      ERRQQLQLPMMVENNSSPFQTAFTVTIEAAQGTTGVSXXXXXXXXXXXXXXNAKPSDLNRPGHVFPLRAQ
RIBA_XYLFA      ----------------------------------------------------------------------
RIBB_WIGBR      EKCKILNLPMMVKKNNSKYKTAFTVSIESAYGTTGVSAYDRIITIKTAIKDNAKPDDLNRPGHVFPLQAH
RIBB_CLOBL      EKVKKLGLTQMVSNNTCTYETAFTISIEAKEGTTGVSAADRVTTILTAVKDDCKPEDLCHPGHVFPLRAR
RIB1_SCHPO      ----------------------------------------------------------------------
RIBA_XYLFT      ----------------------------------------------------------------------
RIBB_CLOBH      KKVKKLGLTQMVHNNTCTYETAFTISIEAKEGTTGVSAADRVTTILTAVKDDCKPEDLCHPGHVFPLRAR
RIBB_CLOB1      KKVKKLGLTQMVHNNTCTYETAFTISIEAKEGTTGVSAADRVTTILTAVKDDCKPEDLCHPGHVFPLRAR
RIBB_CHLL2      GKIRSLELPMMVENNTSGFQTAFTVSIEAAEGTTGVSAADRVKTVRTAVSENARPSDLRHPGHIFPLRAR
RIBB_DESAA      EKIRSLELPMMVEDNSSRYGTAFTVSIEAAQGTTGVSAKDRVTTVKTAAADGAKPADLSKPGHVFPLRAR
RIBB_RALEJ      DKVRQLGLRPMVENNRSQYGTAFTVSIEAREGTTGVSAVDRITTIRAAIAKDAGTDAVVSPGHVFPLVAV
RIBB_VIBCM      AQADRLALPPMVVNNNSANQTAFTVSIEAKHGTTGVSAQDRVTTIKTAANPQAKPEDLARPGHVFPXXXX
RIBB_VIBCH      AQADRLALPPMVVNNNSANQTAFTVSIEAKHGTTGVSAQDRVTTIKTAANPQAKPEDLARPGHVFPXXXX
RIBB_BORPE      ETLDRLELPPMVDSNRSRYSTAFTVSIEAREGTTGVSAVDRVTTIRAAIAPGARSGDVVSPGHVFPLRAQ
RIBB_BORPA      ETLDRLELPPMVDSNRSRYSTAFTVSIEAREGTTGVSAVDRVTTIRAAIAPGARSGDVVSPGHVFPLRAQ
RIBB_BORBR      ETLDRLELPPMVDSNRSRYSTAFTVSIEAREGTTGVSAVDRVTTIRAAIAPGARSGDVVSPGHVFPLRAQ
RIBB_PHOPR      ERVKQLELPMMVENNTSANETGFTVTIEAAKGTTGVSAADRVTTIKTAIADGAVPADLNHPGHVFPLKAN
RIBB_BUCAP      SKRKKLNLPMMVKHNTSTYRTGFTVTIEASKGSTGVSAKDRLTTIKTATADDAQPSDLNRPGHVFPLRAN
RIBB_DESRM      EKVRSLGLPMMVENNSSRFKTAFTVTIEAAHGTTGVSAADRVKTVKTAVAENAKPEDLNRPGHVFPLRAC
RIBB_AERHH      ERVRQLELPMMVEANSSHYQTAFTVTIEAAQGTTGVSXXXXXXXXXXXXXXXXXPSDLHRPGHVFPLRAR
RIBA_VIBVU      ----------------------------------------------------------------------
RIBB_VIBC3      AQADRLALPLMVVNNNSANQTAFTVSIEAKHGTTGVSAQDRVTTIKTAANPQAKPEDLARPGHVFPXXXX
RIBB_VIBHA      ERANWLDLPPMVKDNCSKNQTAFTVSIEAKEGTTGVSAKDRVTTVKTATYFDAQPEDLARPGHVFPLVAK
RIBB_AERS4      ERVRQLALPMMVEANSSHYQTAFTVTIEAAQGTTGVSXXXXXXXXXXXXXXGAKPSDLHRPGHVFPLRAR
RIBA_VIBCH      ----------------------------------------------------------------------
RIBA_VIBPA      ----------------------------------------------------------------------
RIBA_HELAH      ----------------------------------------------------------------------
RIBB_DESDA      EYTRRLDLPMMTERNTNTQQTAFTISIEXXXXXXXXXXXDRVATIQAAVAENASPENLRRPGHVFPLRAK
RIBB_BUCBP      SKRKQLKLPMMVQNNTSKFGTNFTVTIEAAEGSTGVSAKDRLTTIRAAINDNAKPSDLNRPGHIFPLQAH
RIBA_HELPS      ----------------------------------------------------------------------
RIBA_PHOPO      ----------------------------------------------------------------------
RIBA_HELPY      ----------------------------------------------------------------------
RIBA_HELP2      ----------------------------------------------------------------------
RIBA_ALISL      ----------------------------------------------------------------------
RIBA_HELPH      ----------------------------------------------------------------------
RIBA_VIBF1      ----------------------------------------------------------------------
RIBA_VIBFM      ----------------------------------------------------------------------
RIBA_HELPJ      ----------------------------------------------------------------------
RIB1_YEAST      ----------------------------------------------------------------------
RIBA_HELHP      ----------------------------------------------------------------------
RIBB_CHRVO      ERAERLQLPPMAAENGSRYGTAFTVAIEAAQGTTGVSXXXXXXXXXXXXHPDAKPGDLVRPGHVYPIXXX
RIBA_DEHMU      ----------------------------------------------------------------------
RIBB_METTH      ENSEKLGIPYMTDIMEEASGSAFSITVNHRKTFTGITDNDRALTIGELAGIRDDRHEFRSPGHVTLLRAA
RIBB_METJA      DICNKLGIPFMVDILEFAEKSSFSITINHRKTFTGITDNDRAFTIKKLAEKEGRFNDFGKPGHVTLLRAA
RIBB_METMA      VASKQLKLPFMADLVREASKTSFSLWVNHRDTRTGIPDIERALTIRKIGEITEESNEFRTPGHVALLRAA
RIBB_METAC      VASKQLKLPFMADLVREASRTSFSIWVNHRDTRTGIPDLERALTIRKIGEITEKSNEFRTPGHVALLRAA
URC1_SACKL      ----------------------------------------------------------------------
URG1_SCHPO      ----------------------------------------------------------------------
RIBB_ARCFU      VAAEKLGLPFMVADADDIKRSSFSLWVNHRDTFTGITDVDRALTIRRIGEVVDEKVDFGRPGHVALLRAA
TPIS_PSEMY      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EGGVLVRAGHTEAAVDLARAAGLRPAGVICEVVSEEDPTGMARVPELRRFCDEHDLKLISIEQLIEWRRK
RIBBA_CORGL     EGGVLVRAGHTEAAVDLARAAGLRPAGVICEVVSEEDPTGMARVPELRRFCDEHDLKLISIEQLIEWRRK
RIBBA_CORGB     EGGVLVRAGHTEAAVDLARAAGLRPAGVICEVVSEEDPTGMARVPELRRFCDEHDLKLISIEQLIEWRRK
RIBBA_CORAM     PNGVLERDGHTEAAIDLARLAGLRPAGVLCEIVSEEDPTTMARSEELRRFSDEHDLKMISIEQLIEWRRH
RIBBA_MYCA9     DGGVLRRPGHTEASVDLAKLAGLRPAAVICEIVSQKDEGAMAQTEELRVFADEHNLALVSIADLIEWRRK
RIBBA_MYCVP     DGGVLRRPGHTEAAVDLARLAGLQPAGAICEIVSQKDEGAMAQTDELRIFADEHDLALISIADLIEWRRK
RIBBA_MYCGI     DGGVLRRPGHTEAAVDLARLAGLQAAGTICEIVSQKDEGAMAQTDELRIFADEHDLALISIADLIEWRRK
RIBBA_RHOE4     EGGVLRRPGHTEAAVDLARMADLRPAGVICEIVSQKDEGAMAQTDELRVFADEHNLALISIADLIAWRRK
RIBBA_MYCPA     DGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAQTDELRVFADEHDLAMITIADLIEWRRK
RIBBA_MYCMM     DGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAQTDELRVFADEHGLALITIADLIEWRRK
RIBBA_MYCTU     DGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAHTDELRVFADEHGLALITIADLIEWRRK
RIBBA_MYCTA     DGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAHTDELRVFADEHGLALITIADLIEWRRK
RIBBA_MYCBT     DGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAHTDELRVFADEHGLALITIADLIEWRRK
RIBBA_MYCBP     DGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAHTDELRVFADEHGLALITIADLIEWRRK
RIBBA_MYCBO     DGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAHTDELRVFADEHGLALITIADLIEWRRK
RIBBA_MYCA1     DGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAQTDELRVFADEHDLAMITIADLIEWRRK
RIBBA_MYCUA     DGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSRKDEGSMAQTDELRVFADEHGLALITIADLIEWRRK
RIBBA_NOCFA     DGGVLRRPGHTEAAVDLARMAGLRPAGVICEIVSQKDEGHMARTEELRVFADDHDLALISIADMIAWRRK
RIBBA_SALAI     QGGVLRRPGHTEAAIDLTRLAGLRPAGVLCELVNDDGT--MMRVPDLERFCAEHSLVLITIADLVAYRRR
RIBBA_RHOSR     EGGVLRRPGHTEAAVDLARMADLRPAGVICEIVSQKDEGHMAQTDELRVFADDHNLALISIADLIAWRRK
RIBBA_SALTO     EGGVLRRTGHTEAATDLTRLAGLRPAGVLCELVNDDGT--MMRVPDLERFCAEHSLVLVTIADLVMYRRR
RIBBA_GEOSW     KGGVLRRAGHTEAAVDLARLCGAKPAGVICEIIKEDGT--MARVSDLRKIADEFDLKMITIKDLIEYXXX
RIBBA_BACSK     NGGVLRRAGHTEAAVDFAKLCGAKPAGVICEVMNEDG--SMARVPELRIIADQHNLPLVTIKDLIAYRRK
RIBBA_BACWK     EGGVLRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGT--MARVPDLLECAKQFDIKMITIEDLIAYRRH
RIBBA_BACC2     EGGVLRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGT--MARVPDLIECAKQFDIKMITIEDLIAYRRH
RIBBA_ARATH     EGGVLKRAGHTEASVDLTVLAGLDPVGVLCEIV--DDDGSMARLPKLREFAAENNLKVVSIADLIRYRRK
RIBBA_BACC4     EGGVLRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGT--MARVPDLIECAKQFDIKMITIEDLIAYRRH
RIBBA_BACCZ     EGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDG--AMARVPDLLQCAKQFDIKMITIEDLIAYRRH
RIBBA_BACHK     EGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGT--MARVPDLLQCAKQFDIKMITIEDLIAYRRH
RIBBA_BACC3     EGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGT--MARVPDLLQCAKQFDIKMITIEDLIAYRRH
RIBBA_BACC1     EGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGT--MARVPDLLQCAKQFDIKMITIEDLIAYRRH
RIBBA_BACAN     EGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGT--MARVPDLLQCAKQFDIKMITIEDLIAYRRH
RIBBA_BACAH     EGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGT--MARVPDLLQCAKQFDIKMITIEDLIAYRRH
RIBBA_BACAC     EGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGT--MARVPDLLQCAKQFDIKMITIEDLIAYRRH
RIBBA_BACAA     EGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGT--MARVPDLLQCAKQFDIKMITIEDLIAYRRH
RIBBA_BACCR     EGGVLRRAGHTEAAVDLAKLCGAEPAGVICEIINEDGT--MARVPDLIECAKQFDIKMITIEDLIAYRRH
RIBBA_BACCQ     EGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGT--MARVPDLLQCAKQFDIKMITIEDLIAYRRH
RIBBA_BACC7     EGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGT--MARVPDLLQCAKQFDIKMITIEDLIAYRRH
RIBBA_BACC0     EGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGT--MARVPDLLQCAKQFDIKMITIEDLIAYRRH
RIBBA_BACSU     KGGVLKRAGHTEAAVDLAEACGSPGAGVICEIMNEDGT--MARVPELIEIAKKHQLKMITIKDLIQYRYN
RIBBA_SYNWW     EGGVLRRAGHTEGSIDLTRLAGLYPAAVICEVMNEDGT--MARLPQLLEFARQHNLKLASIADLIEYRRR
RIBBA_AQUAE     PGGVLERAGHTEASVDLARLAGLYPAGVICEIMKDDGT--MARVPDLMEFAKKHNLKIITIADLIKYRLR
RIBBA_BACV8     DKGVLRRAGHTEACIDMARLAGLYPAAALMEIMSEDGT--MARLPELRKMADEWGLKLISIRDLIAYRLK
RIBBA_BACA2     KGGVLKRAGHTEAAVDLAKACGSQGAGVICEIMNEDGT--MARVPELAEIAERHQLKMITIKDLIEYRYN
RIBBA_BREBN     AGGVLRRAGHTEAAVDLARLAGGIPAGVICEIMNEDG--SMARLPQLVEIARRFDLKLITIADLIAYRMR
RIBBA_BACAM     KGGVLKRAGHTEAAVDLAKACGSQGADVICEIMNEDGT--MARVPEISEIAKSHQLKMITIKDLIEYRYN
RIBBA_CLONN     KGGVLKRAGHTEAAVDLATLAGLTPAGTICEIMNEDGT--MARVPDLMKYVKVHNLKIVTIADLIEYRRK
RIBBA_THEPX     DGGVLVRAGHTEAAVDLAVLAGLKPAGVICEII--KDDGNMARLPDLLEFAKKFGLRIISIEDLIKYRMK
RIBBA_THEP3     DGGVLVRAGHTEAAVDLAVLAGLKPAGVICEII--KDDGNMARLPDLLEFAKKFGLRIISIEDLIKYRMK
RIBBA_BACCN     DGGVLRRAGHTEAAVDLAKLCGTEPVGVICEIIKEDGT--MARVPDLIQVAKQFDIKMITIEDLIAYRRH
RIBBA_BACTN     EKGVLRRAGHTEATIDMARLAGLYPAGALMEIMSDDGT--MARLPELRAMADEHGLKLISIHDLIAYRLK
RIBBA_CYTH3     DEGVLRRVGHTEAAVDLARLAGFKPAGVLIEIMSEDG--SMARLPELKQIATKFNLKLISIKDLIEYRLT
RIBBA_PROA2     DGGVLRRVGHTEAAVDLAELAGSTPVGLLCEIL--HDDGSMARLPELLKIKEKFDLKLITIKDLVAYQMK
RIBBA_ACTPL     EGGVLVRNGHTEATVDLARLAGLKHAGLCCEIMADDGT--MMTMPDLQKFAVEHNMPFITIQQLQEYRRK
RIBBA_ACTP2     EGGVLVRNGHTEATVDLARLAGLKHAGLCCEIMADDGT--MMTMPDLQKFAVEHNMPFITIQQLQEYRRK
RIBBA_CHLPN     PGGVLKRAGHTESTVDLMELAGLQPCGVLAELVNED--YSMMRLPQILEFARKHNIAVIPVTSIIAHRML
RIBBA_BACFR     SRGVLRRAGHTEASVDLAKLAGLYPAAALIEIINEDGT--MARLPQLVEVARRFGLKIISIKDLIAYRLQ
RIBBA_BACFN     SRGVLRRAGHTEASVDLAKLAGLYPAAALIEIINEDGT--MARLPQLVEVARRFGLKIISIKDLIAYRLQ
RIBBA_SYNY3     TGGVLKRAGHTEAAVDLSRLAGLYPAGVICEIQNADG--SMARLPELVEYARKYDLKLISIADLISYRLQ
RIBBA_ACTP7     DGGVLVRNGHTEATVDLARLAGLKHAGLCCEIMADDGT--MMTMPDLQKFAVEHNMPFITIQQLQEYRRK
RIBBA_PELLD     DGGVLRRVGHTEAAVDLARLAGCSPVGLLCEIL--HDDGSMARLPXXXXXXXXXXXXXITIKDLVAYRMQ
RIBBA_ACTPJ     DGGVLVRNGHTEATVDLARLAGLKHAGLCCEIMADDGT--MMTMPDLQKFAVEHNMPFITIQQLQEYRRK
RIBBA_CHLTR     PGGAVQRPGHTEAAMDLMRLAGMQPCGIFAELVNPDH--SMMRQQQVLAFAEQHDLTVITVDDLITYRYT
RIBBA_PROVI     DGGVLRRVGHTEAAVDLARLAGCSPVGLLCEILHEDG--SMARLADLMTIKEKFGLKLITIKDLVAFQMR
RIBBA_PARD8     SRGVLRRAGHTEAAVDLARLAGLYPAGALIEIINEDGT--MARLPQLIEVAXXXXXXXXXXXXXXAYRLR
RIBBA_PELPB     DGGVLRRVGHTEAAVDLARLAGCSPTGLLCEILNDDG--SMARLPQLIKLKAKFGLKLITIKELVAYQMQ
RIBBA_UNCTG     EGGVLARTGHTEAAVDLVRLAGFYPAGIICEIMNNDGT--MARMSDLIKFAKKHDLHIITIGELVNYRRR
RIBBA_CHLMU     PGGVVKRPGHTEASMDLMRLAGMYPCGIFAELVNADH--SMMRQQQILDFAEQHGFTVITVDDLITYRWT
RIBBA_PORGI     SRGVLRRAGHTEAAVDLARLCGMQPAAALIEIINEDGT--MARLPQLWEVSKRFGLKIIAIKDLIAYRLK
RIBBA_PORG3     SRGVLRRAGHTEAAVDLARLCGMQPAAALIEIINEDGT--MARLPQLWEVSKRFGLKIIAIKDLIAYRLK
RIBBA_STAAW     DKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGT--MAKGQDLQKFKEKHQLKMITIDDLIEYRKK
RIBBA_STAAS     DKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGT--MAKGQDLQKFKEKHQLKMITIDDLIEYRKK
RIBBA_STAAR     DKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGT--MAKGQDLQKFKEKHKLKMITIDDLIEYRKK
RIBBA_STAAC     DKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGT--MAKGQDLQKFKEKHQLKMITIDDLIEYRKK
RIBBA_STAEQ     ENGVLTRNGHTEAAVDLARLTGAQPAGVICEIMNDDGT--MAKGEDLQSFKERHHLKMITIKSLVAFRKA
RIBBA_STAAN     DKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGT--MAKGQDLQNFKEKHQLKMITIDDLIEYRKK
RIBBA_STAAM     DKGVLARNGHTEAAVDLAKLTGAKPAGVICEIMNDDGT--MAKGQDLQNFKEKHQLKMITIDDLIEYRKK
RIBBA_STAES     ENGVLTRNGHTEAAVDLARLTGAQPAGVICEIMNDDGT--MAKGEDLQSFKERHHLKMITIKSLVAFRKA
RIBBA_STAHJ     ENGVLERTGHTEAAVDLAKLTKAAPAGVICEIMNEDGT--MAKGEQLEAFKHQHGLKMITIESLVNYQKD
RIBBA_STAS1     DNGVLSRRGHTEASVDLAKLTGAKPAALICEIMDEDGT--MAKGASLEAFKETHGLVMISIEDLEKYRKS
RIBA_ARCFU      EMGVLERPGIAEACVDLARMAGFAPSAVYAPLMTAEG--GVAGEDYALKFAKEHSMPVFRIKDMIEFRIK
RIBA_STRCO      ----------------------------------------------------------------------
RIBBA_THEMA     --GFQRRKGHTEASLEISELAGFSRHAVIVEILDEKGNSH--NLDYVLKLSEKFSLPVLEMDDV--WREK
RIBB_NEIMB      KGGVLVRAGHTEAGVDLAQMNGLIPASVICEIINDDGT--MARMPELMKFAEEHKLKIGTIADLIEYRSR
RIBB_NEIMA      KGGVLVRAGHTEAGVDLAQMNGLIPAAVICEIINDDGT--MARMPELMKFAEEHKLKIGTITDLIEYRSR
RIBB_PSESM      DGGVLTRAGHTEAGCDLARMAGFTPASVIVEVMNDDGT--MARRPDLELFAEKHGIRIGTIADLIHYRLS
RIBA_BURMA      ----------------------------------------------------------------------
RIBB_PHOLE      DGGVLIRAGHTEAGCDVARLAGLEPSSVIVEILNEDG--SMARRPQLEIFAEKHGLKLGTIADLIEYRTQ
RIBA_ACTSZ      ----------------------------------------------------------------------
RIBB_PSEAE      PGGTLARAGHTEAACDLARMAGFEPSGVICEVMN--DDGSMARRPELEAFAAEHGIKIGTIADLIHYRLI
RIBB_CAMJE      KGGVLERTGHTEGTVDLCKLAGLKGACVICEIV--KDNGDMARREDLEIFCQKHDLNMIAVSDLIEYRLK
RIBA_NEIMF      ----------------------------------------------------------------------
RIBA_NEIMB      ----------------------------------------------------------------------
RIBA_NEIM0      ----------------------------------------------------------------------
RIBA_NEIG1      ----------------------------------------------------------------------
RIBB_DEHMU      EGGALVRIGHTEGSVDLCRLAGQGDSAVICEIMKEDGT--MARRPDLDIFCAKHELNIVYISDIVEYRMM
RIBA_NEIMA      ----------------------------------------------------------------------
RIBA_MANSM      ----------------------------------------------------------------------
RIBA_HAES2      ----------------------------------------------------------------------
RIBA_HAES1      ----------------------------------------------------------------------
RIBA_HAEIE      ----------------------------------------------------------------------
RIBB_PHOPO      DGGVLARAGHTEAGCDVARLAGLEPSSVIVEILNDDGT--MARRPQLEVFAKKHGLKLGTVADLIEYRNK
RIBA_HAEIN      ----------------------------------------------------------------------
RIBA_HAEIG      ----------------------------------------------------------------------
RIBA_HAEI8      ----------------------------------------------------------------------
RIBA_AERHH      ----------------------------------------------------------------------
RIBA_AZOVD      ----------------------------------------------------------------------
RIBA_PROMH      ----------------------------------------------------------------------
RIBA_PSEPW      ----------------------------------------------------------------------
RIBA_HAHCH      ----------------------------------------------------------------------
RIBA_PASMU      ----------------------------------------------------------------------
RIBA_SHIDS      ----------------------------------------------------------------------
RIBA_ENTS8      ----------------------------------------------------------------------
RIBA_SHISS      ----------------------------------------------------------------------
RIBA_SHIFL      ----------------------------------------------------------------------
RIBA_SHIF8      ----------------------------------------------------------------------
RIBA_SHIBS      ----------------------------------------------------------------------
RIBA_PSEE4      ----------------------------------------------------------------------
RIBA_ECOSM      ----------------------------------------------------------------------
RIBA_ECOSE      ----------------------------------------------------------------------
RIBA_ECOLU      ----------------------------------------------------------------------
RIBA_ECOLI      ----------------------------------------------------------------------
RIBA_ECOLC      ----------------------------------------------------------------------
RIBA_ECOHS      ----------------------------------------------------------------------
RIBA_ECODH      ----------------------------------------------------------------------
RIBA_ECOBW      ----------------------------------------------------------------------
RIBA_ECO8A      ----------------------------------------------------------------------
RIBA_ECO7I      ----------------------------------------------------------------------
RIBA_ECO5E      ----------------------------------------------------------------------
RIBA_ECO57      ----------------------------------------------------------------------
RIBA_ECO55      ----------------------------------------------------------------------
RIBA_ECO27      ----------------------------------------------------------------------
RIBA_ECO24      ----------------------------------------------------------------------
RIBA_ECOL6      ----------------------------------------------------------------------
RIBA_ECOL5      ----------------------------------------------------------------------
RIBA_ECO81      ----------------------------------------------------------------------
RIBA_ECO45      ----------------------------------------------------------------------
RIBA_ACIBS      ----------------------------------------------------------------------
RIBA_PSESM      ----------------------------------------------------------------------
RIB3_SCHPO      DGGVLERDGHTEAAVDLCKLAGLPPVGAICELVREEDGL-MSRFDDCISFGKKWGIKVITIESL------
RIBA_SHIB3      ----------------------------------------------------------------------
RIBA_PSEPK      ----------------------------------------------------------------------
RIBA_PSEPG      ----------------------------------------------------------------------
RIBA_PSEP1      ----------------------------------------------------------------------
RIBA_BAUCH      ----------------------------------------------------------------------
RIBA_ACIBY      ----------------------------------------------------------------------
RIBA_ACIBT      ----------------------------------------------------------------------
RIBA_ACIBC      ----------------------------------------------------------------------
RIBA_ACIB3      ----------------------------------------------------------------------
RIBB_WOLSU      EGGVLVRTGHTEGSVDICKLAGVAPVAVICEIIKKDG--HMARRDDLMEFAKEHHLKIVYISDLIEYRMQ
RIBB_OCEIH      NAGVLERRGHTEAAVDLARLSNSIPSAYICEILNDDGT--MARYPALETLAKDWDLTLITVEDLVQYREK
RIBA_YERPS      ----------------------------------------------------------------------
RIBA_YERPE      ----------------------------------------------------------------------
RIBA_PSEFS      ----------------------------------------------------------------------
RIBA_ESCF3      ----------------------------------------------------------------------
RIBA_ACIB5      ----------------------------------------------------------------------
RIBA_PSEA7      ----------------------------------------------------------------------
RIBA_CITK8      ----------------------------------------------------------------------
RIBA_SHEON      ----------------------------------------------------------------------
RIBA_SHEAM      ----------------------------------------------------------------------
RIBA_PSEAE      ----------------------------------------------------------------------
RIBA_PSEA8      ----------------------------------------------------------------------
RIBA_PSEAB      ----------------------------------------------------------------------
RIBA_KLEP7      ----------------------------------------------------------------------
RIBA_KLEP3      ----------------------------------------------------------------------
RIBA_TOLAT      ----------------------------------------------------------------------
RIBA_SALTY      ----------------------------------------------------------------------
RIBA_SALTI      ----------------------------------------------------------------------
RIBA_SALPA      ----------------------------------------------------------------------
RIBA_SALCH      ----------------------------------------------------------------------
RIBB_ERWT9      SGGVLTRGGHTEATLDLVTLAGFKPAGVLCELTN--DDGSMAHAPEVIVFARQHDMPVVTIEDLVSYRRS
RIBA_ACIAD      ----------------------------------------------------------------------
RIBA_ERWCT      ----------------------------------------------------------------------
RIBA_ENT38      ----------------------------------------------------------------------
RIBA_SHESW      ----------------------------------------------------------------------
RIBA_SHEPC      ----------------------------------------------------------------------
RIBA_BUCAI      ----------------------------------------------------------------------
RIBA_SHESR      ----------------------------------------------------------------------
RIBA_SHESM      ----------------------------------------------------------------------
RIBA_SHEB5      ----------------------------------------------------------------------
RIBA_SHELP      ----------------------------------------------------------------------
RIBB_KLEP7      PGGVLTRGGHTEATIDLVTLAGFKPAGVLCELTNDDGT--MARAPECIKFAQQHNMAVVTIEDLVAYRRE
RIBA_SHESA      ----------------------------------------------------------------------
RIBB_KLEP3      PGGVLTRGGHTEATIDLVTLAGFKPAGVLCELTNDDGT--MARAPECIKFAQQHNMAIVTIEDLVAYRRE
RIBA_SHEB9      ----------------------------------------------------------------------
RIBA_SHEB8      ----------------------------------------------------------------------
RIBA_SHEB2      ----------------------------------------------------------------------
RIBB_VIBPA      PGGVMTRRGHTEGTIDLMQMAGLQPAGVLCEVTNPDGT--MAKAPEIVAFGHLHNMPVLTIEDMVAYRNQ
RIB3_CANAL      PGLLKKRRGHTEAAVQLSTLAGLQPAGVICELVRDEDGL-MMRLDDCIQFXXXXXXXXXXXXQLVEYISK
RIBB_PROMH      PGGVLTRGGHTEASIDLATLAGFKPVAVLCELTNDDGT--MARAPEVVTFAKQHDMPVLTIEDLVAYRLR
RIBA_SHESH      ----------------------------------------------------------------------
RIBB_HAEIN      NGGVLTRRGHTEASVDLARLAGFKEAGVICEITNDDGT--MARAPEIVEFAKKFGYSVLTIEDLVEYRLA
RIBA_TERTT      ----------------------------------------------------------------------
RIBA_SHEFN      ----------------------------------------------------------------------
RIBB_ECOSM      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECOLU      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_EDWI9      PGGVLARRGHTEATIDLVSLAGFRPAGVLCELTNDDGT--MARAPQVMAFARQHEMPVVTIEDLVAYRQA
RIBA_HAMD5      ----------------------------------------------------------------------
RIBB_VIBVY      PGGVLARRGHTEGTVDLMQMAGLQPAGVLCELTNPDGT--MAKTPEIIAFGKQHNMPVLTIEDMVMYRNQ
RIBB_VIBVU      PGGVLARRGHTEGTVDLMQMAGLQPAGVLCELTNPDGT--MAKTPEIIAFGKQHNMPVLTIEDMVMYRNQ
RIBB_RHORT      ADGLSARRGHTEATIALMRLAGLRPAGVLCEVMNPDGT--MARLPTLIGYGQAHGLPIVSIEDLV-----
RIBB_PELPD      PGGVLERRGHTEATVDLMRLAGLKPCGVLCELTNPDG--SMARMPEIVAFSRKHGFPLITVEELVQYR--
RIB3_YEAST      DGGVLQRRGHTEAGVDLCKLSGLSPVAVIGELVNDDEQGTMMRLNDCQAFGKKHGIPLISIEELAQYLKK
RIBB_VIBSL      KGGVLARRGHTEGTVDLMQMAGLQSAGVLCEVTNPDGT--MAKAPEIVAFGKMHNMPVLTIEDMVMYRTE
RIBB_SHISS      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_SHIFL      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_SHIF8      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_SHIDS      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_SHIBS      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_SHIB3      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECOSE      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECOLI      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECOLC      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECOL5      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECOHS      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECODH      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECOBW      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECO8A      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECO7I      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECO5E      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECO57      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECO55      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECO24      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBA_THEVO      ----------------------------------------------------------------------
RIBA_BLOFL      ----------------------------------------------------------------------
RIBB_ESCF3      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECOUT      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECOL6      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECOK1      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECO81      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECO45      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBB_ECO27      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIEFANKHNMALVTIEDLVAYRQA
RIBA_SACD2      ----------------------------------------------------------------------
RIBB_HAEIG      NGGVLTRRGHTEASVDLARLAGFKEAGVICEITNDDGT--MARTPDIVEFAKKFGYSVLTIEDLVEYRLA
RIBB_HAEI8      NGGVLTRRGHTEASVDLARLAGFKEAGVICEITNDDGT--MARTPEIVEFAKKFGYSVLTIEDLVEYRLA
RIBB_HELHP      EGGVLVRTGHTEASVDICRLAGVAPISVICEIMKKDGTMAGRGDKFLLDFASQHHLKILYVSDIIQYRLN
RIBA_SHEHH      ----------------------------------------------------------------------
RIBB_YERE8      PGGVLSRRGHTEASIDLATLAGYKPAGVLCELTN--DDGSMAHAPEVIEFAKLHDMPVVTIDDLAEYRQS
RIBA_SHEWM      ----------------------------------------------------------------------
RIBA_SHEPW      ----------------------------------------------------------------------
RIBB_PASMU      TGGVLKRRGHTEASVDLARLAGYKAAGVICEITN--DDGSMARAPEIVTFAQKFGFPVVTIEDLVAYRQK
RIBB_HAEIE      NGGVLTRRGHTEASVDLARLAGFKEAGVICEITNDDGT--MARTPDIVEFAKKFGYSVLTIEDLVEYRLA
RIBA_SHEPA      ----------------------------------------------------------------------
RIBA_SHEDO      ----------------------------------------------------------------------
RIBB_TOLAT      AGGVLTRRGHTEATIDLMKLAGLKPYGVLCEVQNEDG--SMARLPGIVEFANKHNMPVLCIEDLVAYLTE
RIBB_SERP5      PGGVLSRRGHTEATIDLVSMAGFKPAGVLCELTN--DDGSMAHAPEVILFAKQHDMTVLTIEDLVAYRQA
RIBB_SALPK      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIAFAGQHNMAVVTIEDLVAYRQA
RIBB_SALPA      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIAFAGQHNMAVVTIEDLVAYRQA
RIBA_MARMS      ----------------------------------------------------------------------
RIBB_SHEWM      SGGVFSRRGHTEGTIDLMLLAGLKPAGVLCEITNPDGT--MARLPEIIQFGQQHNLPVLTIEDIVEYRK-
RIBB_SHELP      PGGVLTRRGHTEGTIDLMKLAGLKPAGVLCEVTNVNGT--MARLPEIIAFGEQHKMPVLTIEDIVCYRK-
RIBB_SHEFN      AGGVMSRRGHTEGTVDLMQMAGLMPAGVLCELANEDG--SMAKTPEIIAFGLKHNMPVLTIEDMVMYRNQ
RIBB_CITK8      PGGVLTRGGHTEATIDLVTLAGFKPAGVLCELTNDDGT--MARAPECIAFAGKHNMAVVTIEDLVAYRQA
RIBB_AGRT5      PEGVLGRTGHTEAAVDLCRLAGKFPSGTICEVANDDGT--MARLPQLEIFAERHGLLVVTIKDLVSYLKG
RIBA_PICTO      ----------------------------------------------------------------------
RIBB_SHEHH      PGGVLERRGHTEGTVDLMKLAGLKPYGVLCEVTLVDGT--MARLPEIIEFGQQHDMPVLTIEDIVAYR--
RIBB_SALTY      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIAFAGQHNMAVVTIEDLVAYRQA
RIBB_SALTI      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIAFAGQHNMAVVTIEDLVAYRQA
RIBB_SALSV      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIAFAGQHNMAVVTIEDLVAYRQA
RIBB_SALPC      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIAFAGQHNMAVVTIEDLVAYRQA
RIBB_SALPB      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIAFAGQHNMAVVTIEDLVAYRQA
RIBB_SALNS      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIAFAGQHNMAVVTIEDLVAYRQA
RIBB_SALHS      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIAFAGQHNMAVVTIEDLVAYRQA
RIBB_SALG2      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIAFAGQHNMAVVTIEDLVAYRQA
RIBB_SALEP      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIAFAGQHNMAVVTIEDLVAYRQA
RIBB_SALDC      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIAFAGQHNMAVVTIEDLVAYRQA
RIBB_SALCH      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIAFAGQHNMAVVTIEDLVAYRQA
RIBB_SALA4      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTNDDGT--MARAPECIAFAGQHNMAVVTIEDLVAYRQA
RIBA_BUCBP      ----------------------------------------------------------------------
RIBB_MANSM      ENGVLARPGHTEAAVDLARLCGYKPAGVICEITNDDGT--MARTPELVAFAQKFGYAVVTIEDLIAYRTK
RIBB_ENT38      AGGVLTRGGHTEATLDLVTLAGFKPAGVLCELTNDDGT--MARAPECVTFARLHNMPVVTIEDLVEYRQA
RIBA_AZOBR      ----------------------------------------------------EHDLLLVRARDIADYRVH
RIBB_SODGM      PGGVLVRGGHTEAAVDLTTLAGLKPAGVLCEVTN--DDGSMAHAPEIIAFGRRHNMPVLTIEDLVAYRR-
RIBB_PELCD      PGGVLTRRGHTEGTVDLMRMAGYKPAGVLCELTNEDGT--MARLPEIITFAERHYLSVVSIEDL------
RIBB_METLZ      DNGVFEREGHTEATVDLMKLAGLREAGLCCEIMA--DNGEMMRTPELISMAKQYNLTFVTIKDLQAYRRK
RIBB_BAUCH      PGGVLNRGGHTEAAIDLTLLAGLKPAGVLCEVTNEDG--SMARALEIIAFSNQHNMPVLTINDLVAYRSR
RIBA_COLP3      ----------------------------------------------------------------------
RIBA_WIGBR      ----------------------------------------------------------------------
RIBB_SALAR      AGGVLTRGGHTEATIDLMTLAGFKPAGVLCELTN--DNGTMARAPECIAFAGQHNMAVVTIEDLVAYRLA
RIBB_DESVH      PGGVLERRGHTEATVDLMRLAGLKPYGVLCELTNPDGT--MARLPQLVDFAQRNRMTVLTVEDLVAYRQ-
RIBB_SHESH      PGGVMTRRGHTEGTIDLMILAGLKPAGVLCEITNPDGT--MARLAEIISFGAKHDLPVLTIEDIVEYRK-
RIBB_PSEHT      TGGVLVRRGHTEASVDLMQLAGLKPFGVICELTNPDG--SMARLPEVSGYANKHNMPVVSIEDLVQY---
RIBB_DESVV      PGGVLERRGHTEATVDLMRLAGLKPYGVLCELTNPDGT--MARLPQLVDFAQRNRMTVLTVEDLVAYRQ-
RIBB_SHESA      PGGVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGT--MARLPEIIAFGAEHNMPVLTIEDIVIYRK-
RIBB_VIBFI      DGGVLTRRGHTEGTVDLMRLAELTPAGVLCEVTNSDG--SMAKTPEIIIFAEQHHLPVLTVNDIALYRKE
RIBB_PECCP      PGGVLTRGGHTEATVDLMTLAGLKPSGVLCELTN--DDGSMAHAPEVIAFAKQHDMPVLTIEDLVAYR--
RIBB_BLOFL      NGGVLSRSGHTEAAVDLTTLAGLKPFGVICEVTNEDG--SMARTTEIIKFSKQYDMPVLTISDVIAYRMS
RIBB_SHEPW      PGGVLERRGHTEGTVDLMKLAGLKPFGVLCEVTLPDGT--MARLPEIVEFGQQHNMPVLTIEDIVAYR--
RIBB_ERWCT      PGGVLTRGGHTEATVDLMTLAGLKPSGVLCELTN--DDGSMAHAPEVIAFAKQHDMLVLTIEDLVAYR--
RIBA_BLOPB      ----------------------------------------------------------------------
RIBB_SHESR      PGGVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGT--MARLPEIIAFGAAHNMPVLTIEDIVVYRK-
RIBB_SHESM      PGGVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGT--MARLPEIIAFGAAHNMPVLTIEDIVVYRK-
RIBA_CAMHC      ----------------------------------------------------------------------
RIBB_YERPY      PGGVLSRRGHTEASIDLATLAGYKPAGVLCELTN--DDGSMAHAPEVIAFAKLHDMPVVTIDDL------
RIBB_YERPS      PGGVLSRRGHTEASIDLATLAGYKPAGVLCELTN--DDGSMAHAPEVIAFAKLHDMPVVTIDDL------
RIBB_YERPP      PGGVLSRRGHTEASIDLATLAGYKPAGVLCELTN--DDGSMAHAPEVIAFAKLHDMPVVTIDDL------
RIBB_YERPN      PGGVLSRRGHTEASIDLATLAGYKPAGVLCELTN--DDGSMAHAPEVIAFAKLHDMPVVTIDDL------
RIBB_YERPG      PGGVLSRRGHTEASIDLATLAGYKPAGVLCELTN--DDGSMAHAPEVIAFAKLHDMPVVTIDDL------
RIBB_YERPE      PGGVLSRRGHTEASIDLATLAGYKPAGVLCELTN--DDGSMAHAPEVIAFAKLHDMPVVTIDDL------
RIBB_YERPB      PGGVLSRRGHTEASIDLATLAGYKPAGVLCELTN--DDGSMAHAPEVIAFAKLHDMPVVTIDDL------
RIBB_YERPA      PGGVLSRRGHTEASIDLATLAGYKPAGVLCELTN--DDGSMAHAPEVIAFAKLHDMPVVTIDDL------
RIBB_YERP3      PGGVLSRRGHTEASIDLATLAGYKPAGVLCELTN--DDGSMAHAPEVIAFAKLHDMPVVTIDDL------
RIBB_SHEB9      PGGVLTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGT--MARLPEIIAFGALHNMPVLTIEDIVVYRK-
RIBB_SHEB2      PGGVLTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGT--MARLPEIIAFGALHNMPVLTIEDIVVYRK-
RIBB_HELPJ      DGGVLARTGHTEASVDLCKLAGLKPVSVICEIMKEDGSMARRGDKFLSDFAIKHNLKTLYVSDLISYRLE
RIBB_SHESW      PGGVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGT--MARLPEIIAFGAQHNIPVLTIEDIVLYRK-
RIBB_SHEPC      PGGVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGT--MARLPEIIAFGAQHNIPVLTIEDIVLYRK-
RIBB_SHEB8      PGGVLTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGT--MARLPEIIAFGALHNMPVLTIEDIVVYRK-
RIBB_SHEB5      PGGVLTRRGHTEGTIDLVQLAGLKPAGVLCEVTNPDGT--MARLPEIIAFGALHNMPVLTIEDIVVYRK-
RIBB_HAMD5      PKGVLGRSGHTEAAIDLARLAGLKPAGVLCELTN--DNGTMARAPEVIAFAKKHKMTVLSIEDLIEYRQ-
RIBB_HELPY      DGGVLARTGHTEASVDLCKLAGLKPVSVICEIMKEDGSMARRGDKFLSDFALKHNLKTLYVSDLISYRLE
RIBB_ENTS8      PGGVLTRGGHTEATIDLVSLAGFKPAGVLCELTNDDGT--MARAPECIAFAREHNMPVVTIEDLVSYRQA
RIBB_SHEPA      PGGVLERRGHTEGTVDLMKLAGLQPFGVLCEVTLPDGT--MARLPEIVEFAQQHDMPVLTIEDIVAYR--
RIBB_DESAD      EGGVLEREGHTEATVDMMTLAGLNPCGVLCELTNPDGT--MARLPEIVEFGQKHDMPVLTVDDIINYR--
RIBB_CHLT3      TGGVLERPGHTEATVDLMRLAGLSPYGVLCELTNPDGT--MANLDEAIAFAEKHDFPVLTVEDVINYRLE
RIBA_BUCAP      ----------------------------------------------------------------------
RIB1_PICGU      ----------------------------------------------------------------------
RIBB_SHEON      PGGVLTRRGHTEGTIDLMQLAGLKPAGVLCEVTNPDGT--MARLPEIIAFGALHNMPVLTIEDIVVYRK-
RIBB_RALSO      AGGVLARRGHTEGSVDLARLAGLSPAGVLCELMLPDGT--MARRDDAVRFADQHGLPVLTIEDIARYREQ
RIBB_HAES2      KGGVLARRGHTEAAVDLASWAGHKPAGVICEITN--DDGSMARTLEIVEFGKKFNYPVVTIEDLVRY---
RIBB_HAES1      KGGVLARRGHTEAAVDLASWAGHKPAGVICEITN--DDGSMARTPEIVEFGKKFNYPVVTIEDLVRY---
RIB3_MAGGR      XXXXXXXXXHTEAGVELCRLAGKRPVAVISEIVDDGQEVGMLRGDECVAFARRWGLKVCTIEDMIAHVEK
RIBA_PSYIN      ----------------------------------------------------------------------
RIBB_PSEPK      NGGVLTRRGHTEGSVDLARLAGLRPAAVLCELMNPDG--SMARGEQVAVYARQYNLPVLTIEELARYR--
RIBB_DESDG      PGGVLERRGHTEATVDLMRLAGLKPCGVLCEVTNPDGT--MARLPQIVDFGRKHDMVVLTVDDLVRYREM
RIBB_DESPS      DNGVLDRRGHTEGTVDLMKLSGLAPAGLLCELTNVDGT--MARLPEIVDFARKRDMQVLSIEDIAQYRQG
RIBB_BUCAT      KGGVLSRPGHTEAAIEIVSLAGFKPAGVICELTNKDGT--MARTPEIIKFSENKKMQVLTIQDLI-----
RIBB_BUCAI      KGGVLSRPGHTEAAIEIVSLAGFKPAGVICELTNKDGT--MARTPEIIKFSENKKMQVLTIQDLI-----
RIBB_BUCA5      KGGVLSRPGHTEAAIEIVSLAGFKPAGVICELTNKDGT--MARTPEIIKFSENKKMQVLTIQDLI-----
RIBB_DESAH      EQGVLGRRGHTEGTVDLMRLAGLAPAGVLCELTNVDGT--MARLPQIITFADEHGFPVLSIEDIAAYR--
RIBA_CAMFF      ----------------------------------------------------------------------
RIBB_PHOLL      PGGVLVRQGHTEAAIDLVSLAGFKPAGVLCELTN--DDGSMARTLEVVQFAKLHNMPVVTIEDLVIYRQA
RIBA_XYLFA      ----------------------------------------------------------------------
RIBB_WIGBR      PGGILSRAGHTEAAVDLTKLAGLKPAGVICEVMN--DDGSMARMPEIINFSKKYNMPVLIIKDIIEY---
RIBB_CLOBL      AGGVLTRPGHTEGTVDLMRLAGYNPAGILCELTNPDGT--MARLPQIINFAKKHNLTILSIEDIIKYK--
RIB1_SCHPO      ----------------------------------------------------------------------
RIBA_XYLFT      ----------------------------------------------------------------------
RIBB_CLOBH      AGGVLTRPGHTEGTVDLMRLAGYNPAGILCELTNPDGT--MARLPQIINFAKKHNLAVLSIEDIIKYKK-
RIBB_CLOB1      AGGVLTRPGHTEGTVDLMRLAGYNPAGILCELTNPDGT--MARLPQIINFAKKHNLAVLSIEDIIKYKK-
RIBB_CHLL2      PGGVLERPGHTEATVDLMRLAGLSPAGVLCELTNPDG--SMAGIEETFAFSVQHGFPVLSIGDIVAYRK-
RIBB_DESAA      PGGVLERRGHTEATVDMMRLAGLKPCGVLCELTNPDGT--MARLPQLADFAKKHGMVLLTVEDLAAYRES
RIBB_RALEJ      DGGVLVRRGHTEGSVELARMAGLSPAAVLCELMNPDGT--MARRPEALSFAEMYRLPILTIADLVAWR--
RIBB_VIBCM      XXXXXXXXXHTEGTVDLMQMAGLQPAGVLCELTNPDG--SMAKTPEIIEFGKLHNMPVLTIEDMVQYR--
RIBB_VIBCH      XXXXXXXXXHTEGTVDLMQMAGLQPAGVLCELTNPDG--SMAKTPEIIEFGKLHNMPVLTIEDMVQYR--
RIBB_BORPE      PGGVLTRRGHTEGSVDLAALAGLRPAGVLCELMNADGT--MMRGASLERYAAKEGLVALAIDEL------
RIBB_BORPA      PGGVLTRRGHTEGSVDLAALAGLRPAGVLCELMNADGT--MMRGASLERYAAKEGLVALAIDEL------
RIBB_BORBR      PGGVLTRRGHTEGSVDLAALAGLRPAGVLCELMNADGT--MMRGASLERYAAKEGLVALAIDEL------
RIBB_PHOPR      ADGVLGRRGHTEATIDLMRLSGLKPYGVLCELTNIDGT--MARLPEVIVFGKKFNMPVLTIEDLAAYRLA
RIBB_BUCAP      GGGILARAGHTEAAIEIVSLAGFKPYGVICELTNKDG--SMSRTPEXXXXXXXXXXXXLTIKDLI-----
RIBB_DESRM      PGGVLERQGHTEATVDLMKLAGLQPYGVLCELTNIDGT--MARLPEVVTFANKNNIPVVTIDDLIMYRKQ
RIBB_AERHH      TGGVLTRRGHTEATVDLMQLAGLKPFGVLCELTKEDG--SMARLPDLVAFGRQHQMPVLTIEDLVQYR--
RIBA_VIBVU      ----------------------------------------------------------------------
RIBB_VIBC3      XXXXXXXXXHTEGTVDLMQMAGLQPAGVLCELTNPDG--SMAKTPEIIAFGKLHNMPVLTIEDMVQYR--
RIBB_VIBHA      TNGVLARRGHTEGTIDLMYLANLVPSGILCELTNPDGT--MAKLPETIEFARRHGMPVLTIEDIVDYR--
RIBB_AERS4      TGGVLTRRGHTEATVDLMQLAGLKPFGVLCELTKEDG--SMARLPDLVAFGRLHQMPVLTIEDLVQYR--
RIBA_VIBCH      ----------------------------------------------------------------------
RIBA_VIBPA      ----------------------------------------------------------------------
RIBA_HELAH      ----------------------------------------------------------------------
RIBB_DESDA      PGGVLERRGHTEATVDLMRLAGHAPCGVLCELTL--DDGSMARLPQVAAFAVAHAIPLCSVEDLVAWR--
RIBB_BUCBP      KNGILGRIGHTEAAIEFVTLAGFKPAGIICELTNRNGT--MSKVPDIIKFSKLKKMTIVTIRDLIQY---
RIBA_HELPS      ----------------------------------------------------------------------
RIBA_PHOPO      ----------------------------------------------------------------------
RIBA_HELPY      ----------------------------------------------------------------------
RIBA_HELP2      ----------------------------------------------------------------------
RIBA_ALISL      ----------------------------------------------------------------------
RIBA_HELPH      ----------------------------------------------------------------------
RIBA_VIBF1      ----------------------------------------------------------------------
RIBA_VIBFM      ----------------------------------------------------------------------
RIBA_HELPJ      ----------------------------------------------------------------------
RIB1_YEAST      ----------------------------------------------------------------------
RIBA_HELHP      ----------------------------------------------------------------------
RIBB_CHRVO      XXXXXXXXXHTEASVELARLAGFSPAGVLCELMNPDGT--MMRGQQVQDYAERHDLPQLSVAELAEWLQR
RIBA_DEHMU      ----------------------------------------------------------------------
RIBB_METTH      DGHVLRRGGHTEMSIALMEMAGLTGVAVCCEMM--DDRTGNSSTEDAMKYAREHDLIFMSGAELIE----
RIBB_METJA      EGLVKNRQGHTEMTVALAELANLVPITTICEMMG-DDGNAMSK-NETKRYAEKHNLIYLSGEEIINY---
RIBB_METMA      EGLLDERMGQTELSVALARMAGITPAMVVCEMLDDDSGKALSK-EKSKEYGKEHGLVFLEGREIVE----
RIBB_METAC      EGLLDERMGQTELSVALARMAGITPAMVVCEMLDDESGRALSK-ENSKDYGKDHGLVFLEGQEILE----
URC1_SACKL      ----------------------------------------------------------------------
URG1_SCHPO      ----------------------------------------------------------------------
RIBB_ARCFU      DKLTYERVGQTELSVALAEMAGIAPAVAICEMLDAE--TGKALTKEAMEYAEEKGIPFIDGRTIVEHYRK
TPIS_PSEMY      -----------------------------------------------------------SVAELIEGLRR


                         .         .         .         +         .         .         .:280
query           NEILVERQVETVLPTDFGTFKAVGYRSIIDGTELVAIVAGDVASDGGENVLVRVHSECLTGDVFGSRRCD
RIBBA_CORGL     NEILVERQVETVLPTDFGTFKAVGYRSIIDGTELVAIVAGDVASDGGENVLVRVHSECLTGDVFGSRRCD
RIBBA_CORGB     NEILVERQVETVLPTDFGTFKAVGYRSIIDGTELVAIVAGDVASDGGENVLVRVHSECLTGDVFGSRRCD
RIBBA_CORAM     NETQVRRTVETQLPTDFGSFTALGYKHEIDGQEHVALIAGGVEENGAEDVFVRVHSECLTGDVFHSRRCD
RIBBA_MYCA9     HEKHVQRIAEARIPTQHGEFRAVGYTSIYDDVEHVALVLGDISGDGGNDVLVRVHSECLTGDVFGSRRCD
RIBBA_MYCVP     HEKHIARVAEARIPTRHGEFRAVGYTSIYEDVEHVALVKGEISGSDGHDVLVRVHSECLTGDVFGSRRCD
RIBBA_MYCGI     HEKHIARVAEARIPTRHGEFRAVGYTSIYEDVEHVALVKGDIAGPHGDDVLVRVHSECLTGDVFGSRRCD
RIBBA_RHOE4     HEKHVLRIAEARIPTRHGEFTAVGYTSIYDEVEHVALVRGDIAGDGGSDVLVRVHSECLTGDVFGSLRCD
RIBBA_MYCPA     HEKHIERIAEARIPTRHGEFRAIGYTSIYEEVEHVALVRGEIANSDGDDVLVRVHSECLTGDVFGSRRCD
RIBBA_MYCMM     HEKHIERVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGEIANSDGDDVLVRVHSECLTGDVFGSRRCD
RIBBA_MYCTU     HEKHIERVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGEIAGPNGDDVLVRVHSECLTGDVFGSRRCD
RIBBA_MYCTA     HEKHIERVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGEIAGPNGDDVLVRVHSECLTGDVFGSRRCD
RIBBA_MYCBT     HEKHIERVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGEIAGPNGDDVLVRVHSECLTGDVFGSRRCD
RIBBA_MYCBP     HEKHIERVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGEIAGPNGDDVLVRVHSECLTGDVFGSRRCD
RIBBA_MYCBO     HEKHIERVAEARIPTRHGEFRAIGYTSIYEDVEHVALVRGEIAGPNGDDVLVRVHSECLTGDVFGSRRCD
RIBBA_MYCA1     HEKHIERIAEARIPTRHGEFRAIGYTSIYEEVEHVALVRGEIANSDGDDVLVRVHSECLTGDVFGSRRCD
RIBBA_MYCUA     HEKHIERVAEARIPTRRGEFRAIGYTSIYENVEHVALVRGEIANSDGDDVLVRVHSECLTGDVFGSRRCD
RIBBA_NOCFA     HEKQVVRVAEARIPTAHGAFTAVGYQSIYDDVEHVALVRGDIGD--GEDVLVRVHSECLTGDVFGSLRCD
RIBBA_SALAI     TEKQVELVAEARMPTRHGVFRAFGYRSDYDSAEHVALVMGDLGD--GRDVLVRVHSECLTGDVLGSLRCD
RIBBA_RHOSR     HEKHVERVASARIPTRHGEFTAVGYRSIYDDVEHVALVRXXXXXXXXXXXXXRVHSECLTGDVFGSLRCD
RIBBA_SALTO     TEKQVELVAEARLPTRHGDFRVAGYRGDYDSAEHVALVMGDLGD--GRDVLVRAHSECLTGDVFGSLRCD
RIBBA_GEOSW     XXXXXXXXXXXMLPTEFGKFKAIGYTNIVDGKEHVALVKGEIIPD--EPTLVRVHSECLTGDVFGSCRCD
RIBBA_BACSK     TEKVVTREVAISLPTEYGDFKAVGYTNTIDGKESVALVKGDVGN--GEPVLVRVHSECLTGDVFGSKRCD
RIBBA_BACWK     HETLVTREVEITLPTDFGTFHAIGYSNSLDMKEHIALVKGDIST--GEPVLVRVHSECLTGDVFGSCRCD
RIBBA_BACC2     HETLVTREVEITLPTDFGTFHAIGYSNSLDTKEHIALVKGDISI--GEPVLVRVHSECLTGDVFGSHRCD
RIBBA_ARATH     RDKLVERASAARIPTMWGPFTAYCYRSILDGIEHIAMVKGEIGD--GQDILVRVHSECLTGDIFGSARCD
RIBBA_BACC4     HETLVTREVEITLPTDFGTFHAIGYSNSLDTKEHIALVKGDIST--GEPVLVRVHSECLTGDVFGSHRCD
RIBBA_BACCZ     HETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDIST--GEPVLVRVHSECLTGDVFGSCRCD
RIBBA_BACHK     HETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDIST--GEPVLVRVHSECLTGDVFGSCRCD
RIBBA_BACC3     HETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDIST--GEPVLVRVHSECLTGDVFGSCRCD
RIBBA_BACC1     HETLVTREVEITLPTDFGTFHAIGYSNSLDTKEHIALVKGDIST--GEPVLVRVHSECLTGDVFGSCRCD
RIBBA_BACAN     HETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDIST--GEPVLVRVHSECLTGDVFGSCRCD
RIBBA_BACAH     HETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDIST--GEPVLVRVHSECLTGDVFGSCRCD
RIBBA_BACAC     HETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDIST--GEPVLVRVHSECLTGDVFGSCRCD
RIBBA_BACAA     HETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDIST--GEPVLVRVHSECLTGDVFGSCRCD
RIBBA_BACCR     HETLVTREAEITLPTDFGTFHAIGYSNSLDTKEHIALVKGDIST--GEPVLVRVHSECLTGDVFGSHRCD
RIBBA_BACCQ     HETLVTREVEITLPTDFGTFHAIGYSNSLDSKEHIALVKGDIST--GDPVLVRVHSECLTGDVFGSCRCD
RIBBA_BACC7     HETLVTREVEITLPTDFGTFHAIGYSNSLDSKEHIALVKGDIST--GDPVLVRVHSECLTGDVFGSCRCD
RIBBA_BACC0     HETLVTREVEITLPTDFGTFQAIGYSNSLDTKEHIALVKGDIST--GEPVLVRVHSECLTGDVFGSCRCD
RIBBA_BACSU     LTTLVEREVDITLPTDFGTFKVYGYTNEVDGKEHVAFVMGDVPF-GEEPVLVRVHSECLTGDVFGSHRCD
RIBBA_SYNWW     KEKLVVRVTDAQLPTMYGDFVAVAYESLLDNKGHIALVKGEWEED--EPILVRVHSECLTGDVFGSRRCD
RIBBA_AQUAE     RETLVEKVASAHLPTPWGVFKIHAYRHKLTGEEQVALTMGEWKED--EPVLVRVHSECLTGDVFRSFRCD
RIBBA_BACV8     QESLVEKGVEVDMPTEYGHFRLIPFRQKSNGLEHIAIIKGDIKE--GEPVLVRVHSSCATGDIFGSMRCD
RIBBA_BACA2     ITTLVNREVDITLPTDFGTFRVYGYTNEVDGKEHLAFVMGDVPFN-SEPVLVRVHSECLTGDVFASHRCD
RIBBA_BREBN     TESMVKKEIEVQLPTAYGDFRIAAYTNELDGKEHVALIKGEIGPD--EPILVRVHSECLTGDIFGSYRCD
RIBBA_BACAM     ITTLVNREVDITLPTDFGTFRVYGYTNEVDGKEHLAFVMGDVPFNSGP-VLVRVHSECLTGDVFASHRCD
RIBBA_CLONN     TESFIERQGSASLPTKYGEFEIIGYEDKLTGKEHVALVKGDIKN--GEPVLIRVHSECLTGDVLGSLRCD
RIBBA_THEPX     NEILVRRVAQAKLPTKYGNFEIVGYEEILTGKQHVALIKGDV---NKEPVLVRIHSECLTGDILGSLRCD
RIBBA_THEP3     NEILVRRVAQAKLPTKYGNFEIVGYEEILTRKQHVALIKGDI---NKEPVLVRIHSECLTGDILGSLRCD
RIBBA_BACCN     HETFVTKEVEITLPTEFGTFHAIGYTNSLDQKEHIALIKGDVSTD--EPVLVRVHSECLTGDVFGSCRCD
RIBBA_BACTN     QESIVEKGVEVNMPTEHGMFRLIPFRQKSNGLEHMAIFKGTWNED--EPILVRVHSSCATGDILGSHRCD
RIBBA_CYTH3     HESLVKREIGVDMPTNLGDFDLIAFRQISTGEVHLALIKGTWEKD--EPVMVRVHSSCVTGDIFGSCRCD
RIBBA_PROA2     RKKLVARAVETSLPTRHGDFRLIAYEACCDSQQQLAFVKGDFSTD--EPVLVRVHSQCATGDIFASLRCD
RIBBA_ACTPL     HDSLVKQISVVKMPTKYGEFMAHSFVEVISGKEHVALVKGDLTD--GEQVLARIHSECLTGDAFGSQRCD
RIBBA_ACTP2     HDSLVKQISVVKMPTKYGEFMAHSFVEVISGKEHVALVKGDLTD--GEQVLARIHSECLTGDAFGSQRCD
RIBBA_CHLPN     SDRLVSKISSARLPTIYGDFTIHVYESLLEGMQHLALVKGNVA--GKSNVLVRVHSECVTGDILGSKRCD
RIBBA_BACFR     MESIVDRGVEVDMPTQFGHFRLIPFRQKSNGMEHIALIKGTWDTD--EPILVRVHSSCMTGDIFGSCRCE
RIBBA_BACFN     MESIVDRGVEVDMPTQFGHFRLIPFRQKSNGMEHIALIKGTWDTD--EPILVRVHSSCM